CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	0 crisprs	NA	0	0	2	0
NZ_CP052036	Klebsiella pneumoniae strain KPN41053 chromosome, complete genome	1 crisprs	DEDDh,cas3,csa3,DinG,WYL	0	1	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP052036_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP052036_1

3986412-3986506

Orphan

Consensus_repeat	Method
TGCACTACCCCCTGGTGAATCTCCTGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP052036_1

>merge|NZ_CP052036|1|3986412-3986506|CRISPRCasFinder
TGCACTACCCCCTGGTGAATCTCCTGCACCAGGTAGTGAATCTGTTGCACCAGGTAGTGAACGATTTGCACTACCCCCTGGTGAATCTCCTGCAC

>NZ_CP052036|1|1|3986412-3986506|CRISPRCasFinder
TGCACTACCCCCTGGTGAATCTCCTGCAC	CAGGTAGTGAATCTGTTGCACCAGGTAGTGAACGATT
TGCACTACCCCCTGGTGAATCTCCTGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP052036.1\|WP_031280381.1\|3981219_3981666_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_004190674.1\|3979429_3979774_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_032430925.1\|3986767_3986956_-\|DUF4222-domain-containing-protein	unknown	unknown	gnl\|CDD\|372855
NZ_CP052036.1\|WP_019705436.1\|3988912_3989137_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_049109620.1\|3982761_3983238_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_049109615.1\|3983319_3983688_-\|RusA-family-crossover-junction-endodeoxyribonuclease	unknown	unknown	gnl\|CDD\|377564
NZ_CP052036.1\|WP_102024164.1\|3988249_3988558_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_023328643.1\|3987383_3988091_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225484
NZ_CP052036.1\|WP_074187737.1\|3987031_3987259_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|374243
NZ_CP052036.1\|WP_004184488.1\|3979770_3980310_-\|glycoside-hydrolase-family-108-protein	unknown	unknown	gnl\|CDD\|226439
NZ_CP052036.1\|WP_064156006.1\|3989137_3989470_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_019705435.1\|3988547_3988742_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_004184721.1\|3981571_3981829_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_023328640.1\|3983674_3985054_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|273206
NZ_CP052036.1\|WP_141097430.1\|3989721_3989940_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_049109614.1\|3985050_3985929_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|181180
NZ_CP052036.1\|WP_040186816.1\|3989495_3989750_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_064156004.1\|3981982_3982765_-\|antitermination-protein	unknown	unknown	gnl\|CDD\|367572
NZ_CP052036.1\|WP_004152156.1\|3989936_3990362_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052036.1\|WP_031281240.1\|3980306_3980606_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|374352

Protein	Function_ID	Function_description	E-value
NZ_CP052036.1\|WP_023328640.1\|3983674_3985054_-\|AAA-family-ATPase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	3.25684e-106
NZ_CP052036.1\|WP_032430925.1\|3986767_3986956_-\|DUF4222-domain-containing-protein	gnl\|CDD\|372855	pfam13973, DUF4222, Domain of unknown function (DUF4222). This short protein is likely to be of phage origin. For example it is found in the Enterobacteria phage YYZ-2008. It is largely found in enteric bacteria. The molecular function of this protein is unknown.	2.10618e-15
NZ_CP052036.1\|WP_049109614.1\|3985050_3985929_-\|ATP-binding-protein	gnl\|CDD\|181180	PRK07952, PRK07952, DNA replication protein DnaC; Validated.	4.04914e-37
NZ_CP052036.1\|WP_049109615.1\|3983319_3983688_-\|RusA-family-crossover-junction-endodeoxyribonuclease	gnl\|CDD\|377564	pfam05866, RusA, Endodeoxyribonuclease RusA. This family consists of several bacterial and phage Holliday junction resolvase (RusA) like proteins. The RusA protein of Escherichia coli is an endonuclease that can resolve Holliday intermediates and correct the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC.	2.23959e-11
NZ_CP052036.1\|WP_064156004.1\|3981982_3982765_-\|antitermination-protein	gnl\|CDD\|367572	pfam03589, Antiterm, Antitermination protein.	6.70154e-29
NZ_CP052036.1\|WP_023328643.1\|3987383_3988091_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225484	COG2932, COG2932, Predicted transcriptional regulator [Transcription].	2.01457e-35
NZ_CP052036.1\|WP_074187737.1\|3987031_3987259_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|374243	pfam15943, YdaS_antitoxin, Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254.	4.39517e-19
NZ_CP052036.1\|WP_004184488.1\|3979770_3980310_-\|glycoside-hydrolase-family-108-protein	gnl\|CDD\|226439	COG3926, zliS, Lysozyme family protein [General function prediction only].	1.31966e-44
NZ_CP052036.1\|WP_031281240.1\|3980306_3980606_-\|phage-holin-family-protein	gnl\|CDD\|374352	pfam16083, Phage_holin_3_3, LydA holin phage, holin superfamily III. Phage_holin_3_3 is a family of small hydrophobic holin proteins with one or more transmembrane domains. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as those of the bacteriophages of these organisms. Their primary function appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyze the cell wall polymer as a prelude to cell lysis. When chromosomally encoded, these enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases. LydA and lydB are encoded on the dar operon. The phenotype of a rapid lysis in the absence of active LydB suggests that this protein might be an antagonist of the holin LydA.	8.28402e-16

>NZ_CP052036.1|WP_049109614.1|3985050_3985929_-|ATP-binding-protein
MLNLNQLKEREDLRAQQAKLGDELAFAEEHKLPWGFEGYNSNHTSMASCPEHGDYEQFTLVGKDFRGAETFKHSRCPSCIRAEQTSVKSSLRKLHVTSLLNDAGITRRFGDCEFENYLELNPEASRNLAACRRYADNWPAVLEAGKSLVLTGSCGTGKNHLAVSLAKSIIRNHLASVELTDVMRLTRAVKSTWRHNAETTEESVLDHYSSLDLLVIDEVGVQFGSPAEMTILHEVINARYESVLPTILISNLPPEQLKEFISDRIFDRVTDGGRNYLVFNWASFRGNNGGHA
>NZ_CP052036.1|WP_023328640.1|3983674_3985054_-|AAA-family-ATPase
MTPVWRNDELEEAVIGALFLRGDDPEVLDVLSRLPASTFSVRQYREIYTGICRQARGGGVIDPLLLCESLPALQTTILAATRVSWAKSALLSYVDVLRRNAGVRDAEAALEKVLEQIRSARNGESALAALEAAKLTVSAIDISADTVQPVHISELLTAVADEVESRSQGKEETRCLLTGIEELDAMTGGIESTDLVFIAARPSMGKTELALDIIDKVSAQGHGVLFFSMEMSDTQITKRMVSAAGGMSMSRLKAVDKFEDEDWARFFNGMERMATRNIWITDATGLTIDQIQQTATRYQIAHPEIALVVIDYLALIKIQSTARYDLAVGEVSKGLKNLAKSNKTPVLALSQLSRGVESRPNKRPMNSDMKNSGEIEADADLILMLYRDEVYNPESPAKGIAEINVTKQRNGELGTIYRRFYNGHFLPIDQEEARQRSTPQPKAHQRRYTKGSRAGHEDF
>NZ_CP052036.1|WP_049109615.1|3983319_3983688_-|RusA-family-crossover-junction-endodeoxyribonuclease
MKIFNITPMGKPRMTRADKWKQREVVMRYRAFCDEVRLKNVAMPEQGGHITFVVPMPKSWSQKKRVTMNGQAHQQKPDADNMIKALMDALFTDDAHIWDFRVTKRWGESGQILISDIGEVAA
>NZ_CP052036.1|WP_049109620.1|3982761_3983238_-|hypothetical-protein
MRSNNNEHNKYFSVDAGISSETITKAERLVMERYSNMYSNWKEKEKNYRQEVEDLRQKEIAGFKNILPAPFTLSDVTIEWDYWESVLRHRYKTQNGDGYVQIIWDRRGWHTDLLCVMKPVTRAEALTVCKWLLACDYFEERDSLFDRIILNLVGECEE
>NZ_CP052036.1|WP_064156004.1|3981982_3982765_-|antitermination-protein
MKLEASLKHFSPQGMHISDDVKSTSPNRLTGTDVMAAIGTTSSRARFGLAAFLGKAGISKTDEQLAIQALAQFAIKNAPKNVRKAAGDKLAACMLTLAQFAFAEYSRSAATRATCQSCSGTGFISRHEDVIKHPGIFDADGVEVKAPKIRNELVKRVCGVCGGKKVIHARCRCGGKGEVLDRKATKELGAPVFKTCERCSGNGFSVVPSATVHRAILKRLPDLHQSSWSRNWKPFYEGLVDMLHKGERQAAAEFEKVTIY
>NZ_CP052036.1|WP_004184721.1|3981571_3981829_-|hypothetical-protein
MQQPYFFNPGMTTQQLEDWLGQQKIYLAHFNRLIAEKAALEERLSQISAEIGRVATGSFEGMLSFPWDPSPLVENPQQDSGQSAD
>NZ_CP052036.1|WP_031280381.1|3981219_3981666_+|hypothetical-protein
MSKYSDLLQVIKSRVCQNNNFPQTLLADSHSYRARQVWYRIGQIFTLECILDEYRKHFSSDYYYLDNDKALHHLIFEMTKWKPEEIRRLSLNDCLFIIASQLKPSYMSEDAAAVLASLNLPTGHYPVEDFPQEDWDPRENSAFLQSYQ
>NZ_CP052036.1|WP_031281240.1|3980306_3980606_-|phage-holin-family-protein
MQDKESIAGMSWLVLLIIACWGGLVRYLIDVKQSKATWSLINALAQMVVSGFTGVIAGLVSIESGLSIYMILATSGISGAMGSVALTYLWERITGVKAP
>NZ_CP052036.1|WP_004184488.1|3979770_3980310_-|glycoside-hydrolase-family-108-protein
MTADQIIEGILGKEGGYVDHPSDKGGPTRWGITQTTARAHGYTGDMRNLPRETAKQILLSDYWTGPRFDQVAALSTLLADELCDTGVNMGPSVASKFFQRWLTAMNMRGKLYPDLIPDGAIGPRTITALKGYLSARGKEGEQVLLRALNCSQGARYLELAEGREANEDFLYGWVKERVL
>NZ_CP052036.1|WP_004190674.1|3979429_3979774_-|hypothetical-protein
MKMIIFALLVLVAVLVLLLLRKYTRLEFVGHASLLLKTWSVKLGAIGALVGVWAQSFPDAALHAWAVLPPDIKNILPPNIVALISPALVVLAVLSQYVRQPALKEKADELKEQQ
>NZ_CP052036.1|WP_032430925.1|3986767_3986956_-|DUF4222-domain-containing-protein
MFPEAGSIKALDRLYHDPRGVVVHVTGWDREKQQVYFTRPDYPHECMQPVWKFQQYFTRVLV
>NZ_CP052036.1|WP_074187737.1|3987031_3987259_-|helix-turn-helix-domain-containing-protein
MISEPIDKAVRCTGSQGALAKQCGVSQATVWKWRHGKRVKAEHVLKIVAAANGQVAAYEIRPDLPELFPHPTQGE
>NZ_CP052036.1|WP_023328643.1|3987383_3988091_+|helix-turn-helix-transcriptional-regulator
MSKTTFAERLVESMKAAGFTQASLAAAVGMSQSSIWKLTSGAASGSRKTVELAKALHVRPEWLASGELPMNDNESNDLPTVYRQQRPVDPGIYRVDLLDVQVSAGPGVYLSSEFIKTVQAIEFTEEYARSMFGSRPASSIKVITVRGDSMEGTIDPGDYIFVDTSVNHFEGDGIYVFVFGKTIHIKRLQMQKNSLVVLSDNKLYSPWEIDACDEDQFHVLAKVLVKQSAAFKRFA
>NZ_CP052036.1|WP_102024164.1|3988249_3988558_+|hypothetical-protein
MATKNFIQLVDIPDYRFDKRATDIDYDGIACDCDSKTISILNAISHISLNVFSLVEESLVDKEKIADLSCIIADLAELAIAINKISQSASYLSGLKGDNNGA
>NZ_CP052036.1|WP_019705435.1|3988547_3988742_+|hypothetical-protein
MAHEISLEQAAEKAHQAEIICRMMEVYPNKMDCTEIEALSSLLRVLTGDVCAWLIEEQAVKNNK
>NZ_CP052036.1|WP_019705436.1|3988912_3989137_+|hypothetical-protein
MSIQRRQDIQCVTIKAEQLNFLMQTIFTHHKDFDCHQLDGVLGLAYDLAGEVYSWMEKEEKIVQQNEEHKRRGN
>NZ_CP052036.1|WP_064156006.1|3989137_3989470_+|hypothetical-protein
MSNLITTYRRRILKAALLRHQRKTGSSLLVIKLNKGGISTIELTEILLDGLLRKFERLALGEYGNVEGVKALKGIYSNSVDVNGSGEFLTESGKELIDELISELVEFVKK
>NZ_CP052036.1|WP_040186816.1|3989495_3989750_+|hypothetical-protein
MNNQQTMLYQGVLIPRPVLNVDLHVHPDFTGRVVVHIENGRVICDHQLFDDEHICTLATFIEMAREMELRLEEVAGGTDSNTNS
>NZ_CP052036.1|WP_141097430.1|3989721_3989940_+|hypothetical-protein
MALTAIRIPERVHLQALQVLLRYRRRRIFPRRMRRTGYLSLKFNPRWRLLSKDDGRNWEVMSHETYNREKDK
>NZ_CP052036.1|WP_004152156.1|3989936_3990362_+|hypothetical-protein
MIDNRTVSAIDLALQKHPTPVGDLFAAIRHGRMKRCFSRDTAIRYLAFFMTSRAFGRSGFKQRYPDVQVIHPLNPELSSWQRGAVTTEYFNAHQRTVRRLRRILARKREMQKWCKKWDAMHDRYVKEREELQACKPGGLSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP052036_1	1.1\|3986441\|37\|NZ_CP052036\|CRISPRCasFinder	3986441-3986477	37	MH178096	Aeromonas phage AsXd-1, complete genome	10850-10886	5	0.865

1. spacer 1.1|3986441|37|NZ_CP052036|CRISPRCasFinder matches to MH178096 (Aeromonas phage AsXd-1, complete genome) position: , mismatch: 5, identity: 0.865

caggtagtgaatctgttgcaccaggtagtgaacgatt	CRISPR spacer
tacggggtgaatctgctgcaccaggtagtgaacgatt	Protospacer
.* * .*********.*********************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

296195 : 306220

Liberibacter_phage(50.0%)

integrase,transposase

attL 301883:301896|attR 315002:315015

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088498129.1\|296195_299258_-	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	0.0e+00	70.8
WP_102024244.1\|299270_299732_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_004225014.1\|299788_300757_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-172	91.3
WP_088498128.1\|301490_302981_-	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	9.9e-204	77.7
301883:301896	attL	NA	NA	NA	NA
WP_088498127.1\|302986_304486_-	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	3.6e-230	77.6
WP_001608810.1\|304485_304713_-	helix-turn-helix transcriptional regulator	A0A0E3U244	Fusobacterium_phage	2.3e-11	43.2
WP_088498126.1\|304960_306220_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	4.8e-82	43.2
315002:315015	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2448569 : 2546170

Enterobacteria_phage(14.04%)

capsid,head,tail,protease,terminase,holin,transposase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004175048.1\|2448569_2449061_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_002912992.1\|2449235_2450345_-	AI-2E family transporter	NA	NA	NA	NA
WP_102024189.1\|2450974_2452255_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_102024190.1\|2452494_2453673_-	recombinase	A0A2H4J1K3	uncultured_Caudovirales_phage	8.8e-30	29.8
WP_102024191.1\|2453675_2453885_-	hypothetical protein	NA	NA	NA	NA
WP_102024192.1\|2453928_2454498_-	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	2.5e-78	70.9
WP_102024193.1\|2454576_2454789_-	hypothetical protein	NA	NA	NA	NA
WP_102024194.1\|2455221_2456007_-	hypothetical protein	A4JX52	Burkholderia_virus	2.0e-62	51.7
WP_102024195.1\|2455999_2456200_-	hypothetical protein	NA	NA	NA	NA
WP_042934058.1\|2456199_2456727_-	hypothetical protein	A0A192Y8M4	Salmonella_phage	9.3e-64	70.9
WP_086519469.1\|2456862_2457693_-	DUF2303 family protein	Q8HAA2	Salmonella_phage	9.3e-127	81.7
WP_020804341.1\|2457745_2458117_-	hypothetical protein	Q8HAA1	Salmonella_phage	7.0e-50	79.5
WP_101858686.1\|2458955_2459471_+	hypothetical protein	NA	NA	NA	NA
WP_041937775.1\|2459705_2460362_-	helix-turn-helix domain-containing protein	K7PLZ5	Enterobacterial_phage	7.9e-105	83.9
WP_074423532.1\|2460461_2460665_+	Cro/Cl family transcriptional regulator	K7PHB1	Enterobacterial_phage	3.5e-19	69.2
WP_124036882.1\|2460714_2461164_+	hypothetical protein	NA	NA	NA	NA
WP_101858685.1\|2461440_2461989_+	DNA-binding protein	A0A1C9II13	Salmonella_phage	1.8e-65	67.4
WP_023322342.1\|2462161_2462341_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	5.6e-13	67.3
WP_048323720.1\|2462330_2463242_+	conserved phage C-terminal domain-containing protein	A0A1C9IHW0	Salmonella_phage	9.1e-51	79.0
WP_008806045.1\|2463238_2463697_+	PerC family transcriptional regulator	NA	NA	NA	NA
WP_102024197.1\|2465058_2467041_+	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	3.2e-197	52.2
WP_102024198.1\|2467037_2467514_+\|protease	SOS-response repressor and protease LexA	U5P451	Shigella_phage	6.1e-14	60.3
WP_042934062.1\|2467510_2467909_+	RusA family crossover junction endodeoxyribonuclease	K7PKN5	Enterobacterial_phage	1.2e-44	70.6
WP_102024199.1\|2467998_2468820_+	KilA-N domain-containing protein	A0A0P0ZCS0	Stx2-converting_phage	5.3e-90	65.8
WP_077268456.1\|2468901_2469888_+	DUF968 domain-containing protein	Q8SBE5	Shigella_phage	2.8e-90	48.9
WP_040235788.1\|2469906_2470737_+	antitermination protein	K7P7B9	Enterobacteria_phage	2.9e-59	46.9
WP_048290386.1\|2470946_2471138_+	TrmB family transcriptional regulator	Q8SBE3	Shigella_phage	4.1e-22	82.5
WP_102024200.1\|2471287_2472337_+	site-specific DNA-methyltransferase	A5LH81	Enterobacteria_phage	1.5e-166	76.4
WP_042920238.1\|2473031_2473421_+\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	4.5e-47	79.1
WP_015874667.1\|2473410_2473689_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	1.8e-34	76.1
WP_042920239.1\|2473688_2474315_+	glycoside hydrolase family 19 protein	F1C591	Cronobacter_phage	9.9e-89	76.8
WP_012967894.1\|2474322_2474499_+	hypothetical protein	NA	NA	NA	NA
WP_012967895.1\|2474520_2474703_-	hypothetical protein	NA	NA	NA	NA
WP_012967896.1\|2474788_2475082_+	hypothetical protein	G8C7W3	Escherichia_phage	4.0e-32	73.2
WP_141828104.1\|2475490_2475610_-	small membrane protein	NA	NA	NA	NA
WP_042921403.1\|2476161_2476521_+	hypothetical protein	NA	NA	NA	NA
WP_004184480.1\|2477793_2478039_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	1.6e-34	97.5
WP_162823012.1\|2478491_2478848_-	hypothetical protein	NA	NA	NA	NA
WP_040241924.1\|2478779_2479121_+	HNH endonuclease	K7P7P4	Enterobacteria_phage	5.4e-49	75.7
WP_025713390.1\|2479304_2479769_+\|terminase	phage terminase small subunit P27 family	Q9B019	Phage_GMSE-1	3.7e-48	62.7
WP_025713389.1\|2479722_2481459_+\|terminase	terminase large subunit	A0A0U2C138	Paracoccus_phage	1.3e-138	45.3
WP_141828106.1\|2481465_2482785_+\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	1.3e-138	58.9
WP_025713387.1\|2482760_2483468_+\|head,protease	HK97 family phage prohead protease	Q6JIM8	Burkholderia_virus	2.2e-68	63.5
WP_042920261.1\|2483477_2484698_+\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	3.7e-140	64.0
WP_065905097.1\|2484743_2484998_+	hypothetical protein	NA	NA	NA	NA
WP_032734570.1\|2485003_2485336_+\|head,tail	phage gp6-like head-tail connector protein	Q6JIM5	Burkholderia_virus	8.8e-12	31.6
WP_072071528.1\|2485348_2485687_+\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	1.2e-37	67.0
WP_065905095.1\|2485683_2486133_+	HK97 gp10 family phage protein	Q9MCS9	Enterobacteria_phage	1.8e-63	83.2
WP_102024220.1\|2486129_2486477_+	DUF3168 domain-containing protein	A0A220NRP0	Escherichia_phage	8.9e-31	61.9
WP_065905087.1\|2486533_2487238_+	immunoglobulin domain-containing protein	K7PHL2	Enterobacterial_phage	3.6e-79	66.9
WP_032737709.1\|2487268_2487673_+\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	5.0e-33	57.7
WP_032409576.1\|2487684_2487981_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	2.5e-26	63.9
WP_016530182.1\|2488054_2488288_+	hypothetical protein	K7PH16	Enterobacteria_phage	1.9e-08	47.2
WP_102024221.1\|2488349_2491739_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.4e-301	57.2
WP_023302605.1\|2491759_2492233_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.2e-54	61.4
WP_023302606.1\|2492219_2492696_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	5.3e-50	64.6
WP_102024222.1\|2492708_2493089_+	nitrite transporter	A0A286S2A6	Klebsiella_phage	1.1e-58	81.7
WP_102024223.1\|2493085_2496163_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	61.5
WP_102024224.1\|2496241_2498581_+	SGNH/GDSL hydrolase family protein	A0A286S1P0	Klebsiella_phage	4.0e-50	77.1
WP_101837573.1\|2499047_2500112_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.1e-14	32.2
WP_102024225.1\|2500460_2501153_+	EAL domain-containing protein	NA	NA	NA	NA
WP_102024226.1\|2501158_2501482_+	hypothetical protein	NA	NA	NA	NA
WP_102024227.1\|2502265_2502688_+	hypothetical protein	K7P834	Enterobacteria_phage	4.7e-26	45.3
WP_065905081.1\|2503237_2503657_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	8.5e-36	58.3
WP_065905080.1\|2503658_2504924_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	6.7e-209	83.6
WP_032409434.1\|2504974_2505238_-	hypothetical protein	NA	NA	NA	NA
WP_077269194.1\|2506814_2507789_-	DUF4760 domain-containing protein	A0A1B5FPC5	Escherichia_phage	4.7e-69	51.5
WP_047718742.1\|2508490_2510251_-	DUF3413 domain-containing protein	NA	NA	NA	NA
WP_004195346.1\|2510269_2510497_-	YejL family protein	NA	NA	NA	NA
WP_004144267.1\|2510683_2511691_+	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	2.4e-84	49.8
WP_002912986.1\|2511710_2512472_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_004144265.1\|2512554_2513151_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_004175054.1\|2513169_2514456_-	serine hydrolase	NA	NA	NA	NA
WP_002912983.1\|2514560_2515448_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002912979.1\|2515506_2515791_-	50S ribosomal protein L25	NA	NA	NA	NA
WP_004144263.1\|2515927_2517685_-	DEAD/DEAH box helicase	M4Q3N1	Vibrio_phage	6.4e-101	41.8
WP_049001443.1\|2517832_2518552_+	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
WP_002912975.1\|2518548_2519745_+	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	2.6e-21	24.2
WP_002912974.1\|2520076_2520421_+	hypothetical protein	NA	NA	NA	NA
WP_172676866.1\|2520424_2522014_-	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	3.5e-21	32.8
WP_088497974.1\|2522015_2523041_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_004200501.1\|2523040_2524135_-	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_023282861.1\|2524144_2525950_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019704989.1\|2526018_2527581_-	cyclic di-GMP phosphodiesterase	NA	NA	NA	NA
WP_002912967.1\|2527769_2528339_-	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	A0A1V0DZX6	Clostridioides_phage	3.1e-12	38.0
WP_002912965.1\|2528765_2529479_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_040222271.1\|2529516_2530494_-	GTP-binding protein	NA	NA	NA	NA
WP_004211510.1\|2530614_2532081_-	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	4.2e-45	31.2
WP_032447752.1\|2532288_2533479_+	mannonate dehydratase	NA	NA	NA	NA
WP_002912951.1\|2533549_2534122_-	elongation factor P-like protein YeiP	NA	NA	NA	NA
WP_004175066.1\|2534269_2534524_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_004151122.1\|2534563_2535745_-	sugar efflux transporter SetB	NA	NA	NA	NA
WP_002912947.1\|2536081_2537212_+	fused PTS fructose transporter subunit IIA/HPr protein	NA	NA	NA	NA
WP_002912941.1\|2537212_2538151_+	1-phosphofructokinase	NA	NA	NA	NA
WP_002912937.1\|2539911_2540766_-	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	1.5e-23	33.2
WP_064146006.1\|2540838_2541888_-	YeiH family protein	NA	NA	NA	NA
WP_088497973.1\|2542153_2543020_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002912929.1\|2543198_2544668_+	amino acid permease	NA	NA	NA	NA
WP_172676867.1\|2544807_2546170_+\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	1.2e-73	51.1

DBSCAN-SWA_3

3720460 : 3731348

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088498186.1\|3720460_3723568_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.5
WP_004176258.1\|3723622_3724888_+	MFS transporter	NA	NA	NA	NA
WP_001620097.1\|3724918_3726007_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_088498187.1\|3726093_3726354_-	hypothetical protein	A0A077SK33	Escherichia_phage	1.2e-40	97.7
WP_001620095.1\|3726651_3727512_+	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_002210513.1\|3727532_3728294_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_002903955.1\|3728555_3729458_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
WP_088498188.1\|3729469_3730735_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	8.6e-233	99.3
WP_002210516.1\|3730727_3731348_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0

DBSCAN-SWA_4

3897368 : 3933654

Escherichia_phage(28.57%)

plate,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002902422.1\|3897368_3898304_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.5e-138	93.0
WP_088498085.1\|3898349_3899723_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.2e-51	32.0
WP_102024176.1\|3900248_3901208_-	zinc transporter ZntB	NA	NA	NA	NA
WP_020316476.1\|3901510_3902254_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.0e-16	30.5
WP_020324627.1\|3902216_3903335_+	oxidoreductase	NA	NA	NA	NA
WP_004176404.1\|3903571_3903766_+	hypothetical protein	NA	NA	NA	NA
WP_002902411.1\|3903878_3904625_-	hypothetical protein	NA	NA	NA	NA
WP_004892563.1\|3904915_3905584_-	ABC transporter permease	NA	NA	NA	NA
WP_020324636.1\|3905576_3906590_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-29	39.1
WP_002902393.1\|3906598_3907405_-	methionine-binding protein	NA	NA	NA	NA
WP_088498086.1\|3908844_3909879_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_004179582.1\|3909967_3910516_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020324628.1\|3910572_3911484_-	NmrA/HSCARG family protein	NA	NA	NA	NA
WP_020324664.1\|3911476_3912346_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_076978328.1\|3913042_3913357_+	hypothetical protein	NA	NA	NA	NA
WP_029498283.1\|3913376_3914282_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002902287.1\|3914421_3915351_+	aromatic alcohol reductase	NA	NA	NA	NA
WP_004179576.1\|3915376_3915583_+	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_004151595.1\|3915633_3916512_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004151596.1\|3916670_3917426_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_032419042.1\|3917430_3918024_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_032419043.1\|3918097_3918811_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_004212340.1\|3918877_3919372_-	hypothetical protein	NA	NA	NA	NA
WP_004176418.1\|3920017_3921103_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_020324625.1\|3921066_3922821_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_088498087.1\|3922900_3924493_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_088498088.1\|3924492_3927948_-	type VI secretion protein VasK	NA	NA	NA	NA
WP_004225014.1\|3928551_3929520_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-172	91.3
WP_014907718.1\|3931484_3932555_-	TIGR02594 family protein	B5SP49	Lactococcus_phage	2.5e-07	33.3
WP_086074293.1\|3932541_3933336_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.9e-07	30.4
WP_015874727.1\|3933386_3933578_-\|transposase	transposase	NA	NA	NA	NA
WP_015874726.1\|3933549_3933654_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

3953064 : 3998380

Klebsiella_phage(43.75%)

tail,integrase,holin,terminase

attL 3958192:3958206|attR 4004715:4004729

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102024232.1\|3953064_3956046_-	SGNH/GDSL hydrolase family protein	A0A286S1P0	Klebsiella_phage	1.3e-40	63.4
WP_099451500.1\|3956123_3959192_-	kinase	A0A286S259	Klebsiella_phage	0.0e+00	96.7
3958192:3958206	attL	NA	NA	NA	NA
WP_032438539.1\|3959188_3959569_-	hypothetical protein	A0A286S2A6	Klebsiella_phage	8.2e-70	96.0
WP_087652717.1\|3959578_3960061_-	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	7.6e-81	93.8
WP_004190622.1\|3960241_3960706_-	hypothetical protein	A0A286S298	Klebsiella_phage	3.0e-58	68.4
WP_102024233.1\|3960705_3964308_-\|tail	phage tail length tape measure family protein	K7PMB9	Enterobacterial_phage	7.2e-83	30.7
WP_125255118.1\|3964419_3964941_-	hypothetical protein	NA	NA	NA	NA
WP_004217333.1\|3964989_3965346_-	hypothetical protein	A0A1V0E5P9	Salmonella_phage	1.1e-44	75.0
WP_141828078.1\|3965422_3965629_-	hypothetical protein	NA	NA	NA	NA
WP_023341360.1\|3965766_3966249_-	hypothetical protein	NA	NA	NA	NA
WP_100117009.1\|3966303_3967476_-	Ig domain-containing protein	A0A0D4DBN5	Acinetobacter_phage	5.5e-24	27.0
WP_004190640.1\|3967499_3967892_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_102024234.1\|3967888_3968440_-	hypothetical protein	G8C7Q1	Escherichia_phage	7.8e-29	39.9
WP_004217344.1\|3968441_3968825_-	hypothetical protein	A0A0S2SYG4	Pseudomonas_phage	7.1e-21	45.2
WP_023286294.1\|3968811_3969045_-	hypothetical protein	A0A2H4J0Y9	uncultured_Caudovirales_phage	7.6e-10	47.1
WP_023286293.1\|3969054_3969309_-	hypothetical protein	J9Q7U0	Salmonella_phage	5.2e-20	51.2
WP_102024235.1\|3969310_3969706_-	protein singed	A0A0S2SYB7	Pseudomonas_phage	1.9e-13	44.2
WP_159195361.1\|3969746_3970019_-	Ig-like domain-containing protein	NA	NA	NA	NA
WP_073557854.1\|3970027_3970981_-	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	1.9e-131	74.0
WP_102024236.1\|3970991_3971777_-	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	1.9e-65	63.0
WP_172676888.1\|3971890_3972067_-	hypothetical protein	NA	NA	NA	NA
WP_073557855.1\|3972307_3973420_-	hypothetical protein	I6PD76	Cronobacter_phage	2.5e-111	55.3
WP_102030380.1\|3973403_3974804_-	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	1.1e-127	53.7
WP_102024250.1\|3974803_3976111_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.3e-148	58.7
WP_032438547.1\|3976088_3977093_-\|terminase	terminase small subunit	Q5QF76	Pseudomonas_virus	2.3e-34	43.5
WP_004218558.1\|3977955_3978201_-	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	4.6e-34	96.3
WP_004190672.1\|3979157_3979433_-	hypothetical protein	A0A286N2Q8	Klebsiella_phage	2.2e-08	72.5
WP_004190674.1\|3979429_3979774_-	hypothetical protein	A0A286N2Q7	Klebsiella_phage	2.0e-38	80.7
WP_004184488.1\|3979770_3980310_-	glycoside hydrolase family 108 protein	A0A286N2Q6	Klebsiella_phage	2.3e-102	100.0
WP_031281240.1\|3980306_3980606_-\|holin	phage holin family protein	A0A286N2Q5	Klebsiella_phage	1.9e-45	98.0
WP_031280381.1\|3981219_3981666_+	hypothetical protein	NA	NA	NA	NA
WP_004184721.1\|3981571_3981829_-	hypothetical protein	A0A286N2Q3	Klebsiella_phage	1.3e-42	100.0
WP_064156004.1\|3981982_3982765_-	antitermination protein	F1C595	Cronobacter_phage	1.5e-113	78.7
WP_049109620.1\|3982761_3983238_-	hypothetical protein	A0A286N2Q1	Klebsiella_phage	1.1e-68	77.8
WP_049109615.1\|3983319_3983688_-	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	3.6e-38	60.3
WP_023328640.1\|3983674_3985054_-	AAA family ATPase	Q8W640	Enterobacteria_phage	8.1e-160	64.7
WP_049109614.1\|3985050_3985929_-	ATP-binding protein	Q8W641	Enterobacteria_phage	1.9e-85	63.9
WP_049109612.1\|3985940_3986771_-	helix-turn-helix domain-containing protein	A5LH71	Enterobacteria_phage	8.5e-80	66.2
WP_032430925.1\|3986767_3986956_-	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_074187737.1\|3987031_3987259_-	helix-turn-helix domain-containing protein	A0A0N7C1T6	Escherichia_phage	2.0e-15	60.0
WP_023328643.1\|3987383_3988091_+	helix-turn-helix transcriptional regulator	G8C7U1	Escherichia_phage	1.5e-53	49.8
WP_102024164.1\|3988249_3988558_+	hypothetical protein	A0A286S1T9	Klebsiella_phage	1.9e-21	55.3
WP_019705435.1\|3988547_3988742_+	hypothetical protein	A0A286S1P8	Klebsiella_phage	4.5e-08	50.0
WP_019705436.1\|3988912_3989137_+	hypothetical protein	NA	NA	NA	NA
WP_064156006.1\|3989137_3989470_+	hypothetical protein	A0A286S1Q6	Klebsiella_phage	1.6e-50	97.3
WP_040186816.1\|3989495_3989750_+	hypothetical protein	A0A286SGR4	Klebsiella_phage	1.4e-36	89.3
WP_141097430.1\|3989721_3989940_+	hypothetical protein	A0A286S1P6	Klebsiella_phage	2.5e-31	97.2
WP_004152156.1\|3989936_3990362_+	hypothetical protein	A0A286S1S2	Klebsiella_phage	3.5e-53	77.9
WP_009309071.1\|3990358_3990553_+	hypothetical protein	NA	NA	NA	NA
WP_023304718.1\|3990549_3991377_+	hypothetical protein	Q8W654	Enterobacteria_phage	9.3e-111	84.0
WP_032430926.1\|3991481_3992000_+	hypothetical protein	A0A286S1S7	Klebsiella_phage	5.5e-93	97.1
WP_032428838.1\|3992005_3992731_+	Rha family transcriptional regulator	A0A286S260	Klebsiella_phage	3.4e-109	85.0
WP_032441508.1\|3992720_3992945_+	hypothetical protein	A0A286S2B3	Klebsiella_phage	4.8e-30	93.2
WP_064156008.1\|3992941_3993343_+	hypothetical protein	NA	NA	NA	NA
WP_004198245.1\|3993415_3993562_+	hypothetical protein	A0A1B5FPC2	Escherichia_phage	2.9e-15	70.8
WP_077255525.1\|3993521_3993764_+	AlpA family transcriptional regulator	A0A0M4RTZ2	Salmonella_phage	2.2e-20	73.8
WP_102024165.1\|3993744_3994926_-\|integrase	site-specific integrase	A0A0M4QX09	Salmonella_phage	1.8e-200	83.7
WP_016197745.1\|3995122_3995671_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_004183778.1\|3995869_3997402_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	8.8e-22	30.0
WP_004176437.1\|3997618_3998380_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-21	32.5
4004715:4004729	attR	NA	NA	NA	NA

DBSCAN-SWA_6

4453223 : 4462687

Brazilian_cedratvirus(16.67%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004209699.1\|4453223_4454945_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.5e-14	34.3
WP_002898014.1\|4454989_4455691_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_001040187.1\|4456044_4456263_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_002896522.1\|4456383_4458663_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
WP_002896520.1\|4458693_4459011_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
WP_002896516.1\|4459336_4459558_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
WP_004150848.1\|4459634_4461575_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	1.9e-37	40.5
WP_002896440.1\|4461571_4462687_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7

DBSCAN-SWA_7

4946607 : 4953466

Moraxella_phage(16.67%)

integrase,tRNA

attL 4945234:4945249|attR 4960768:4960783

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4945234:4945249	attL	NA	NA	NA	NA
WP_004202342.1\|4946607_4947417_-	antA/AntB antirepressor family protein	A0A0R6PJV6	Moraxella_phage	3.1e-26	42.4
WP_004202341.1\|4947430_4947865_-	hypothetical protein	A0A1W6JPH9	Morganella_phage	2.9e-31	57.9
WP_022064554.1\|4947864_4948062_-	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	6.6e-07	43.4
WP_022064553.1\|4948289_4949015_-	hypothetical protein	NA	NA	NA	NA
WP_004202336.1\|4949158_4950373_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	4.7e-127	53.4
WP_004143017.1\|4950954_4951821_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.3e-30	34.8
WP_004143016.1\|4951822_4952035_+	ribosome-associated protein YbcJ	NA	NA	NA	NA
WP_004143010.1\|4952080_4953466_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.5e-46	35.4
4960768:4960783	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP052037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13776 : 70265

Bacillus_phage(21.43%)

transposase,integrase

attL 55084:55143|attR 69265:70321

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_077250518.1\|13776_16734_-\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	2.3e-50	22.8
WP_004210218.1\|17387_18401_+	NAD(P)-dependent alcohol dehydrogenase	M1PHA2	Moumouvirus	5.8e-06	26.0
WP_029884700.1\|18606_19602_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	3.1e-20	28.7
WP_004215186.1\|19937_20885_-	DMT family transporter	NA	NA	NA	NA
WP_004215188.1\|21000_21462_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_004225020.1\|21480_21663_-	hypothetical protein	NA	NA	NA	NA
WP_004215173.1\|21746_22649_+	hypothetical protein	NA	NA	NA	NA
WP_004215174.1\|22650_24876_+	exclusion suppressor FxsA	NA	NA	NA	NA
WP_004225022.1\|24924_25824_-	nucleotide-binding protein	NA	NA	NA	NA
WP_004213078.1\|25813_26104_-	hypothetical protein	NA	NA	NA	NA
WP_004213077.1\|26455_26662_+	hypothetical protein	NA	NA	NA	NA
WP_004213076.1\|26651_26945_-	hypothetical protein	NA	NA	NA	NA
WP_004213075.1\|26960_28094_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_004213073.1\|28701_28932_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_004213072.1\|28928_29372_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_004213934.1\|32163_33084_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_011251327.1\|33132_33624_-	DM13 domain-containing protein	NA	NA	NA	NA
WP_004213932.1\|33686_33962_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_172676908.1\|34045_34600_-	DUF417 family protein	A0A1B2IE60	Erwinia_phage	2.1e-05	49.0
WP_004213924.1\|35368_37570_-	ferric aerobactin receptor IutA	NA	NA	NA	NA
WP_004213923.1\|37651_38929_-	NADPH-dependent L-lysine N(6)-monooxygenase	NA	NA	NA	NA
WP_004213922.1\|38932_40666_-	aerobactin synthase IucC	NA	NA	NA	NA
WP_004213921.1\|40665_41613_-	N(6)-hydroxylysine O-acetyltransferase	NA	NA	NA	NA
WP_004213920.1\|41613_43338_-	aerobactin synthase IucA	NA	NA	NA	NA
WP_023302795.1\|43494_44694_+	MFS transporter	NA	NA	NA	NA
WP_004213918.1\|45391_45586_+	hypothetical protein	NA	NA	NA	NA
WP_004145290.1\|46446_46956_+	peptide deformylase	E3SLL2	Synechococcus_phage	8.8e-19	41.9
WP_004902159.1\|48058_48445_-	hypothetical protein	NA	NA	NA	NA
WP_004902162.1\|48542_49742_+	GTP-binding protein	NA	NA	NA	NA
WP_004902166.1\|51606_52611_-	iron ABC transporter permease	NA	NA	NA	NA
WP_004213250.1\|52610_53567_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004213252.1\|53588_54416_-	ABC transporter ATP-binding protein	M1HV27	Acanthocystis_turfacea_Chlorella_virus	2.2e-11	28.4
55084:55143	attL	NA	NA	NA	NA
WP_004225014.1\|55115_56084_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-172	91.3
WP_077250517.1\|56198_56357_-	hypothetical protein	A0A0U2RK18	Escherichia_phage	2.2e-05	69.7
WP_004213558.1\|56669_57599_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	5.6e-72	52.4
WP_004213560.1\|57743_58523_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	6.0e-51	89.4
WP_004213562.1\|58519_59341_-	hypothetical protein	NA	NA	NA	NA
WP_004213565.1\|60264_61239_-	sensor domain-containing diguanylate cyclase	NA	NA	NA	NA
WP_023302803.1\|61875_62784_+	HNH endonuclease	NA	NA	NA	NA
WP_004213569.1\|63170_63521_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	3.2e-20	53.3
WP_023302802.1\|63664_64096_-	silver-binding protein SilE	NA	NA	NA	NA
WP_000555737.1\|64346_65822_-	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.0e-27	30.1
WP_004213574.1\|65814_66495_-	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	1.3e-30	35.7
WP_004213577.1\|66684_68070_+	Cu(+)/Ag(+) efflux RND transporter outer membrane channel SilC	NA	NA	NA	NA
WP_004213578.1\|68098_68461_+	cation efflux system protein CusF	NA	NA	NA	NA
WP_004225014.1\|69296_70265_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-172	91.3
69265:70321	attR	NA	NA	NA	NA

DBSCAN-SWA_2

90353 : 169571

Salmonella_phage(19.05%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004213592.1\|90353_93323_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.3
WP_004213594.1\|93364_93859_+	hypothetical protein	NA	NA	NA	NA
WP_004213596.1\|93919_94123_+	hemolysin expression modulator Hha	NA	NA	NA	NA
WP_004213598.1\|94136_94367_+	hypothetical protein	NA	NA	NA	NA
WP_004213599.1\|94561_94828_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_004098919.1\|94815_95298_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004214536.1\|97511_98534_-	porphobilinogen synthase	NA	NA	NA	NA
WP_011154555.1\|98597_99944_-	dihydroorotase	NA	NA	NA	NA
WP_004214538.1\|99940_100792_-	M14 family metallocarboxypeptidase	NA	NA	NA	NA
WP_011251272.1\|100784_101786_-	TGS domain-containing protein	A0A2K9L6B6	Tupanvirus	9.7e-54	41.5
WP_004214540.1\|102215_103040_+	DUF1460 domain-containing protein	NA	NA	NA	NA
WP_004214541.1\|103056_103986_-	hypothetical protein	A0A140B3P3	Vibrio_phage	1.5e-11	25.2
WP_004214543.1\|104052_104613_-	carbonate dehydratase	NA	NA	NA	NA
WP_004214545.1\|104602_105538_-	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_004214547.1\|105601_106024_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_014599314.1\|106094_107294_-	GTP-binding protein	NA	NA	NA	NA
WP_011251268.1\|107391_107844_+	transcriptional repressor	NA	NA	NA	NA
WP_004212832.1\|109375_110506_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_004225014.1\|111903_112872_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-172	91.3
WP_004212796.1\|113024_113423_-	H-NS histone family protein	NA	NA	NA	NA
WP_004212794.1\|113759_114254_-	thermonuclease family protein	A0A0R6PHV6	Moraxella_phage	5.9e-20	38.6
WP_004026354.1\|117976_118447_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_004026357.1\|118443_118887_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_004213643.1\|119588_119810_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	3.6e-17	63.5
WP_004213642.1\|119954_120110_-	hypothetical protein	NA	NA	NA	NA
WP_004213640.1\|120184_122311_-	TonB-dependent receptor family protein	NA	NA	NA	NA
WP_004213635.1\|123347_123869_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_011154590.1\|124092_124299_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	2.7e-11	52.2
WP_004213628.1\|124755_125988_+	phosphoadenosine phosphosulfate reductase	A0A068F1U8	Mycobacterium_phage	6.3e-63	34.0
WP_004213626.1\|125972_126617_+	ParB N-terminal domain-containing protein	A0A0F7L444	uncultured_marine_virus	5.6e-55	53.7
WP_074160420.1\|126723_126951_+\|transposase	transposase	NA	NA	NA	NA
WP_004213623.1\|126966_128082_+	salmochelin biosynthesis C-glycosyltransferase IroB	NA	NA	NA	NA
WP_029884226.1\|128224_131869_+	salmochelin/enterobactin export ABC transporter IroC	W8CYL7	Bacillus_phage	3.2e-46	29.7
WP_004902400.1\|131973_133203_+	esterase family protein	NA	NA	NA	NA
WP_004213617.1\|133662_135837_+	siderophore salmochelin receptor IroN	A0A0P0I887	Acinetobacter_phage	2.8e-05	30.6
WP_004213615.1\|135898_136120_+	hypothetical protein	NA	NA	NA	NA
WP_004213613.1\|136262_137165_-	DMT family transporter	NA	NA	NA	NA
WP_004213611.1\|137237_137789_-	response regulator transcription factor	NA	NA	NA	NA
WP_023302796.1\|139341_139995_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004902370.1\|142610_143177_-	type I-E CRISPR-associated protein Cas6/Cse3/CasE	NA	NA	NA	NA
WP_004902367.1\|143179_143710_-	hypothetical protein	NA	NA	NA	NA
WP_004902363.1\|144033_144447_-	hypothetical protein	NA	NA	NA	NA
WP_004902361.1\|144531_145020_-	hypothetical protein	NA	NA	NA	NA
WP_004026379.1\|145071_145482_-	hypothetical protein	NA	NA	NA	NA
WP_004225014.1\|145713_146682_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-172	91.3
WP_004902355.1\|146699_148391_-	hypothetical protein	NA	NA	NA	NA
WP_011251294.1\|148579_148825_+	molecular chaperone DnaJ	NA	NA	NA	NA
WP_011251296.1\|149348_150215_+	ParA family protein	NA	NA	NA	NA
WP_004902347.1\|150214_151246_+	ParB/RepB/Spo0J family partition protein	S5WII0	Leptospira_phage	2.9e-08	26.1
WP_088498386.1\|151245_151683_+	hypothetical protein	NA	NA	NA	NA
WP_004902338.1\|151679_152003_+	hypothetical protein	NA	NA	NA	NA
WP_004214667.1\|154029_154812_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	3.0e-135	96.1
WP_004211835.1\|157562_158099_+	hypothetical protein	NA	NA	NA	NA
WP_004211839.1\|160418_161429_-	replication initiation protein	J9Q7H0	Salmonella_phage	1.1e-86	53.5
WP_004211841.1\|162158_163325_+	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	2.0e-223	97.4
WP_004117790.1\|163324_164296_+	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	7.0e-150	86.9
WP_004215130.1\|165923_166364_+	IS66 family insertion sequence hypothetical protein	Q6H9S5	Enterobacteria_phage	4.4e-19	53.8
WP_004189161.1\|166360_166711_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	5.2e-39	63.8
WP_004902302.1\|166741_168334_+\|transposase	IS66-like element ISKox1 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.2e-176	61.8
WP_004213807.1\|168602_169571_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	7.3e-14	28.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP052036

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP052037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection