CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP053187	Turicibacter sanguinis strain MOL361 chromosome, complete genome	2 crisprs	csa3,cas3HD,WYL,DEDDh,cas3,DinG	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053187_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053187_1

119465-119578

Orphan

Consensus_repeat	Method
AAATATACCACAAAAGTGTAGTATTGTCATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053187_1

>merge|NZ_CP053187|1|119465-119578|CRISPRCasFinder
AAATATACCACAAAAGTGTAGTATTGTCATTCAAAATATACTATAATTTCTCAAAAAATTCTTAAATTATAGAGAAAATAACAAAATATACCACAATAGTGTAGTATTGTCATT

>NZ_CP053187|1|1|119465-119578|CRISPRCasFinder
AAATATACCACAAAAGTGTAGTATTGTCATT	CAAAATATACTATAATTTCTCAAAAAATTCTTAAATTATAGAGAAAATAACA
AAATATACCACAATAGTGTAGTATTGTCATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053187.1\|WP_006785782.1\|124096_124813_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP053187.1\|WP_006785775.1\|116319_116688_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053187.1\|WP_006785783.1\|124911_125610_-\|N-acetylmannosamine-6-phosphate-2-epimerase	unknown	unknown	gnl\|CDD\|234907
NZ_CP053187.1\|WP_006785768.1\|109429_110269_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP053187.1\|WP_009606273.1\|126668_127676_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP053187.1\|WP_132943025.1\|117420_118365_+\|pectin-methylesterase	unknown	unknown	gnl\|CDD\|227022
NZ_CP053187.1\|WP_055164393.1\|119904_120849_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP053187.1\|WP_006785771.1\|112196_112397_-\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP053187.1\|WP_006785772.1\|112579_113752_-\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223194
NZ_CP053187.1\|WP_132943027.1\|114060_114819_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053187.1\|WP_006785780.1\|122956_123409_+\|YhcH/YjgK/YiaL-family-protein	unknown	unknown	gnl\|CDD\|377217
NZ_CP053187.1\|WP_132942791.1\|121736_122576_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053187.1\|WP_132942792.1\|123437_124082_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|365914
NZ_CP053187.1\|WP_006785770.1\|111796_112078_-\|rhodanese-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|238089
NZ_CP053187.1\|WP_132942793.1\|125644_126679_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226967
NZ_CP053187.1\|WP_132942790.1\|121352_121724_-\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|377953
NZ_CP053187.1\|WP_132943024.1\|119642_119849_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|197775
NZ_CP053187.1\|WP_132943026.1\|110261_111599_-\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293742
NZ_CP053187.1\|WP_006785774.1\|115121_116303_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP053187.1\|WP_006785776.1\|116768_117245_-\|dual-specificity-protein-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|227653

Protein	Function_ID	Function_description	E-value
NZ_CP053187.1\|WP_006785782.1\|124096_124813_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	3.75584e-81
NZ_CP053187.1\|WP_132943024.1\|119642_119849_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	1.46139e-07
NZ_CP053187.1\|WP_006785768.1\|109429_110269_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	3.43458e-30
NZ_CP053187.1\|WP_009606273.1\|126668_127676_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.51518e-165
NZ_CP053187.1\|WP_132943025.1\|117420_118365_+\|pectin-methylesterase	gnl\|CDD\|227022	COG4677, PemB, Pectin methylesterase [Carbohydrate transport and metabolism].	5.06727e-67
NZ_CP053187.1\|WP_055164393.1\|119904_120849_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.56719e-116
NZ_CP053187.1\|WP_006785771.1\|112196_112397_-\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	1.96636e-33
NZ_CP053187.1\|WP_006785772.1\|112579_113752_-\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|223194	COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair].	2.49297e-155
NZ_CP053187.1\|WP_006785780.1\|122956_123409_+\|YhcH/YjgK/YiaL-family-protein	gnl\|CDD\|377217	pfam04074, DUF386, Domain of unknown function (DUF386). This family consists of conserved hypothetical proteins, typically about 150 amino acids in length, with no known function.	1.97272e-43
NZ_CP053187.1\|WP_132942792.1\|123437_124082_-\|peptidylprolyl-isomerase	gnl\|CDD\|365914	pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD. The peptidyl-prolyl cis-trans isomerases, also known as cyclophilins, share this domain of about 109 amino acids. Cyclophilins have been found in all organisms studied so far and catalyze peptidyl-prolyl isomerisation during which the peptide bond preceding proline (the peptidyl-prolyl bond) is stabilized in the cis conformation. Mammalian cyclophilin A (CypA) is a major cellular target for the immunosuppressive drug cyclosporin A (CsA). Other roles for cyclophilins may include chaperone and cell signalling function.	4.49939e-55
NZ_CP053187.1\|WP_006785770.1\|111796_112078_-\|rhodanese-like-domain-containing-protein	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	4.99818e-15
NZ_CP053187.1\|WP_132942793.1\|125644_126679_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226967	COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism].	5.84675e-136
NZ_CP053187.1\|WP_132942790.1\|121352_121724_-\|PH-domain-containing-protein	gnl\|CDD\|377953	pfam08000, bPH_1, Bacterial PH domain. This family contains many bacterial hypothetical proteins. The structures of Structure 3hsa and Structure 3dcx show similarities to the PH or pleckstrin homology domain. First evidence of PH-like domains in bacteria suggests role in cell envelope stress response.	5.82762e-41
NZ_CP053187.1\|WP_006785783.1\|124911_125610_-\|N-acetylmannosamine-6-phosphate-2-epimerase	gnl\|CDD\|234907	PRK01130, PRK01130, putative N-acetylmannosamine-6-phosphate 2-epimerase.	1.00311e-118
NZ_CP053187.1\|WP_132943026.1\|110261_111599_-\|alkaline-phosphatase-family-protein	gnl\|CDD\|293742	cd16018, Enpp, Ectonucleotide pyrophosphatase/phosphodiesterase, also called autotaxin. Ecto-nucleotide pyrophosphatases/phosphodiesterases (ENPPs) hydrolyze 5'-phosphodiester bonds in nucleotides and their derivatives, resulting in the release of 5'-nucleotide monophosphates. ENPPs have multiple physiological roles, including nucleotide recycling, modulation of purinergic receptor signaling, regulation of extracellular pyrophosphate levels, stimulation of cell motility, and possible roles in regulation of insulin receptor (IR) signaling and activity of ecto-kinases. The eukaryotic ENPP family contains at least five members that have different tissue distribution and physiological roles.	2.67793e-60
NZ_CP053187.1\|WP_006785774.1\|115121_116303_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.68887e-44
NZ_CP053187.1\|WP_006785776.1\|116768_117245_-\|dual-specificity-protein-phosphatase-family-protein	gnl\|CDD\|227653	COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only].	6.32389e-07

>NZ_CP053187.1|WP_132943025.1|117420_118365_+|pectin-methylesterase
MIRVALDGTGDFFTIQEAVDSISDSKPETIYIKKGVYEEKLVIEKPHLTFIGEEAKETIITFSDYAKKQWNEDEIYQTFRTYTALIGANHLCFSNLTFKNEAGKGSEVGQALALYVDGDCIQFHDCYFLAHQDTLFTGPLPPAPIKPGSFVGPREHAKREVGRQYFNNCYIQGDIDFIFGSATAYFEKCTLFSNALNGHSYITAASTQKEEPYGYVFESCQLLSNATPHTVFLGRPWREYAHVAFLNCYMGHHIHPLGWDDWGKLSSHDTVQFVEYNSYGPGATPHQRASYAKVIDHPTYYTRERVLKGWNPKC
>NZ_CP053187.1|WP_006785776.1|116768_117245_-|dual-specificity-protein-phosphatase-family-protein
MEIKIMSQQEAQDWSYDQWMGVALLVSIVGTNTEPPNFYHNPRIVEKISLAFDDITEVADSQTLLSEAQCHQIKDFVLDHAEEVESIVIHCLAGVSRGAAIAFAICRLLGMDDMWIWTSNCYKPNSYCVEKLNRVLNLGLTEEEIDARHALITLEKVS
>NZ_CP053187.1|WP_006785775.1|116319_116688_-|hypothetical-protein
MEAQKRFNLSLVTAVLNLIAGVVYLLVKLVIPQIELTGGLSEPAKGFSGFMLLVFSCFALGLLVLNLITMAYLNREGKKVKGAVIGAIGHTFSFFAIGAFYGIPSFVLCLISSLLLFKPKKY
>NZ_CP053187.1|WP_006785774.1|115121_116303_+|MFS-transporter
MEQQSLRKFLIFNLLIMTVFNFAHPVTPRLINELGLPSYMFGLFFAMMSLGSYIFSPIWGSLSDYKGRKRFLMLGVLGYGTVQLGFGLSQTAGVISIFRILGGILSVSYVAVIMASISDLSTKENRAKSLAYLAATTAMGAALGSNIGGWIGASNYKYTFIAQFIACILLTIALGLFTKETIETKKEGKASIATNHLKLSQKSIDFKSTLGSLIITVAFMNITTTSYNSTIGYFVESDLKLPTQLNGLVLSIAPICAILVNFLISPKLAAKYDELKTLMVVIALTAFSLFMWAFSSNLIIVGLFLIIFFIVLPLAQPIYQSMISKHAKDNAGEIMGIQNSARSLGMIVGSLLAGFLYDYGSKLPFLVGSFTAFIALIVLIKEYKTKQKDISKS
>NZ_CP053187.1|WP_132943027.1|114060_114819_-|hypothetical-protein
MSTRKRKYYRNWYQEWKLEEELEEGKQLYEKPRIDPTQYKANHDLSRQYAGNRQNHKSSNQHLNLSLSNDGMGADVLRGILVGLPLVIVLVTILYASGVIPQEKLLGLFGVNSVSPITTYLTEYDELMSMHNEVNQQLTSHLKLNDFSDSYKQELQTIQQNIEIKTTGISEGADESFSNLNRLLSYKLASLNQMVELVVANESMTSEVSDYYSQFVTDQNQVGTQITSELTSLLDQQNIKYVKQVNGTIEIK
>NZ_CP053187.1|WP_006785772.1|112579_113752_-|class-I-SAM-dependent-RNA-methyltransferase
MDYQLIATTTFGIEAVTARELKRLGYEDLKLENGKVHFEGDEMDIAITNTWLRTAERVLIKVAEFEATTFEDLFNQTEAIDWSQYIPVNGKMHVVGKSVKSTLHSVPDCQSIVKKAVVKSMQRAYNQDWFTEDGPVYKIEVALLKDVVTLTIDTSGAGLHKRGYREFAGEAPLKETLAAALVYLSRWKPERLLVDPFCGSGTILIEAALIGNNIAPGLNRQFVCEDWPSMDPEIFEQVRDSARKAIKNNSLRMFGYDIDGQVLRTARQNAEKAGVAKAIEFHQLDFHKFSSNYKYAYMITNPPYGERIGEEDEVFKLNKKLGIMKRKLDTWDFNILTSFSKFEKAFGREADKNRKLYNGRILTRYYQYFDNNLKQKYGAVVSETAVSTEE
>NZ_CP053187.1|WP_006785771.1|112196_112397_-|cold-shock-protein
MATGTVKWFNADKGYGFITVDNGDEVFAHFSEIQSDGFKTLEEGQKVEFEITQGNRGPQASHIVKL
>NZ_CP053187.1|WP_006785770.1|111796_112078_-|rhodanese-like-domain-containing-protein
MKHIHIKDLKPQLNEINLIDIREALEFKTLPKLAQARHIPMQELVREPHQYLSKTECYYLICRSGARTEQVTAYLNSLGYDVINVLGGMLEYR
>NZ_CP053187.1|WP_132943026.1|110261_111599_-|alkaline-phosphatase-family-protein
MCFDLGQVFKKTAYTGNEIAKHVIMISLDGVYEADFDNLMQRPVFLELINRGAYSNQVTTVYPTLTYPIHTSIVTGTTPDKHGIYHNHQLQVGVPIKNQTWYWYQDEVKVPSLFDKLAQHQFVTASILWPVTGRGNITYNIPEIIALAGENQATKLLESGTPMYLVKSYLKYGKILGDGTQPKLDQFSTAVAVDTIKSKKPNLLAIHLISVDHFRHDFGVESIESVKAFNVYEQSVMEIVEAVKEAGYYDDTVFVVTSDHGQMDVHQNVYLNNVLKRAGYITETEDGLNYKAYVQSLGLGAYVYIKDHDSVIKKEVMTLLRSVMQDPTYGIETIYTVNDLKRLHASSDVDIAIEAKAGYQFKDDLTSKDVKSNFTKGNHGYSPLKAGYKTIVMISGVGIKNQFEMGNISVMDIAPTIASILGLDFYDCDGRVLNEIFEEGEKENE
>NZ_CP053187.1|WP_006785768.1|109429_110269_-|phosphatase-PAP2-family-protein
MSELDIIRMIQSIHNEVLDQVVQFITMLGESAVILSVILCIYWGYNKKFGEYIGYSYFTSCLLNNWIKNIFKAERPIGKEGIRSLRTQTATGYSFPSGHTQGASSTYFAIGIFLKKRSIRWGSLLLILLVAISRLYLGVHYPRDVIVGLLLGIIVATITYYLYERTENKQFLYLATLIVFIPGIFMTSIDFSKSLGTFIGFALGTTIEKRYIQFQENTTLVIKILRCLIGILVILSLKHVFKEILGEIRNATFIIYSSISFIGFGIYPLFFKGKGQEKK
>NZ_CP053187.1|WP_132943024.1|119642_119849_+|helix-turn-helix-domain-containing-protein
MSFNSFLSKYKITGYALSRMTGLSQSTIAAWTSGVRDPMGMSLKNALKICKALNIDLNTLHKELNQKN
>NZ_CP053187.1|WP_055164393.1|119904_120849_-|IS30-family-transposase
MSYKHLNTFERTRIEVLSKMGYSTRQIAQQLNRHHSTIARELKRNTQKTYQAELAEELAGQRRLSCRCPEKKSEQVIQTIQHYLKLTWSPEQISNTVLKGVLSFKTIYRWIYDETILLGDLSCLRQKGKRRKPRETRGRFNIGTSIHQRPKEVKRRETFGHWELDTVVSSRGKSKGCLATFVERQTRFYVAIKIENRSATEMYRAISELYKLFPKDTFKTYTVDRGKEFACYSKVEADLKVPVYFADAYSSWQRGSNENANGLLREFFPKKTDLARVSDEEINEALCLINHRPRKCLGWKTSFELFHEKLSHLY
>NZ_CP053187.1|WP_132942790.1|121352_121724_-|PH-domain-containing-protein
MSFMQNLSGNSVEIHPDKVDEKFKRILTSDEEIKFAFKSFRDYIVLTNKRLILSDVQGVTGSKVEYVNIPYHKISCFSLEAAGTVDLDVDFKILVSGYGVIEKTIARGVNVTEVSKILAAYIC
>NZ_CP053187.1|WP_132942791.1|121736_122576_-|hypothetical-protein
MDDLNRAYQVLGVNASMSLEEIEAIYDELVLKYKKEAKCNMYYRQKLQEWEEAYDCIMECRLDELDERAEEMDRIYPSLSGASNHLVKEIKIGMIVGVAVLIMLGIVVVEQMYFTKQTSIQGTENLISDVISSDLNSELFYLANHFTLNLGKFKSTDEWDWGYYENGPTWTVVVVLEVTEATDLGALINLNNFRLNSDYPTISIPEDVYLDSDVNHIHYLGAYSEIVPKSQKFGIVFNVDAFYEGEERFIYYHHPDGRVQTVGSLYFEQETRGIYVDNF
>NZ_CP053187.1|WP_006785780.1|122956_123409_+|YhcH/YjgK/YiaL-family-protein
MIIGKLKDLPRYKGLNQNLDTAIDFISNHDLSTLPLGKTEIDGNDVFINRFDYYGEELSNCLLEGHQNYLDIHLVLSGCEYLGYADVSDLNIKTTYDEKTDFIEFEGTPLINCPCYPETFVIVFPEDIHMPKLKINHELVQKAVCKVKLS
>NZ_CP053187.1|WP_132942792.1|123437_124082_-|peptidylprolyl-isomerase
MKKIKYLAGIIMCAMTLIVMGCSKVELPDEIIYPEVETPEQLPIVTMVIKDYGTIEAQLYPQIAPNTVYNFISLIEKGFYDGLTIHRVDKGFVLQGGDPTGIGSGGPGYQIVGEFAANGIGNDLKHTEGVLSMARSNDMDSAGSQFFIMLGEFPHLDGSYAAFGKVISGMDVAHALESLTVAPDGRPVDKEVIIEFMTVNTFGIDYPEPEVISE
>NZ_CP053187.1|WP_006785782.1|124096_124813_-|GntR-family-transcriptional-regulator
MSLPRYREIARELKEQIQVGHYKEHQTIPSEPELAKLYDVSRMTARQAINELVYEGVLYRVKGKGTFVNHQKYEKSIHGLTSFSEDMIQKGFKPSSRLISQTVRLANEIVASKLQIKEGQEVIELKRVRMADEEPMAVEIVYLPVQIIKSLPDDIGAISLYDYIEKELGLLIDYSIQEIEAISLEAPISTYLEVEAGAPCLLICLQSYLKSGQIFEYVESYYRADRYKFIQPAYRKGI
>NZ_CP053187.1|WP_006785783.1|124911_125610_-|N-acetylmannosamine-6-phosphate-2-epimerase
MTKDFILEKLKGNLIVSCQALEGEPLYQEDYSVMPLMARAAKRGGACAIRTNSVRDVALIKEETNLPIIGIIKKQYEGFEQYITVTMDEVDQLVGAGADIVALDCTLRDRVDGRSVKEFIQAIKDKYPELLLMADISTYEEGVYAYESGVDFVGTTLSGYTSYSMPSGGPDYELVEKLAQTIKVPVIAEGKIHYPEQAAKMLEIGAFSVVVGGAITRPLEITKRFVDALHQD
>NZ_CP053187.1|WP_132942793.1|125644_126679_-|ATP-binding-cassette-domain-containing-protein
MENNQEVLLELKGVKTYFPIKSGLFKKKEQYVQAVNGIDLTIYRGETIGLVGESGCGKTTLGKSILQLVRPTAGEMLYQFQEEGQKDLRKLTAEEMDLARQKMQIVFQDPHSSLNPAFTIYQSLSDPLKKFGVKSKKERRQIIGDLLEAVNMRRDYMDRYPNEFSGGQRQRIGIARALSINPELIVCDESVSALDVSIQAQVLNLLKQLKKERNLTYIFITHDLSVVEYISDRIAVMYLGKIVELAKTDQIFSHTLHPYTQALLSAIPVANLDKKTERIVLEGDVPSPVNPPSGCHFHGRCKDCMEKCKTVIPELKRYLIDGEEHFVACHLVADKMSQDVEEVI
>NZ_CP053187.1|WP_009606273.1|126668_127676_-|ABC-transporter-ATP-binding-protein
MQNEAVVTVNNLNTYFYTNQRCNKVINGVSFEIKKGKTLCIVGESGCGKSVTSSSIMQLLPKLARIEAGEIIYHSHQGDIRIDQLKRNGKEMRALRGQEISMIFQDPMTALNPVYTVGFQIMENILAHEKISKKEARERTLQLLKKMGIPFPEKRIDEYPHQFSGGMRQRAMIAMAMSCNPKVLIADEPTTALDVTIQAQIFELMNQLKKDHETAILLITHDMGVVSELADDVAVMYMGNIIECGSVDEILRTPAHPYTKALLKSIPILGKGSHQDLQPIKGSTPDPFDRPTGCQFAPRCEFSCEKCNQMPGETMVDGTHMVRCFKYKEVMNSGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053187_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053187_2

1540777-1540931

Orphan

Consensus_repeat	Method
GCTAAAAAAGCAGCTCGTGGTGCTGAAGAGTTAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053187_2

>merge|NZ_CP053187|2|1540777-1540931|CRISPRCasFinder
GCTAAAAAAGTGGCAAATAAAGCTGAAGATTTAGCTGAAGATTTAAAATATGGAGCTAAAAAAGCAGCTCGTGGTGCTGAAGAGTTAGCGGAAGATATGGCTCACGGTATTTCAAAAGGTGCTAAAAAAGCAGCTCGTGGTGCTGAAGAGTTAGC

>NZ_CP053187|2|2|1540777-1540931|CRISPRCasFinder
GCTAAAAAAGTGGCAAATAAAGCTGAAGATTTAGC	TGAAGATTTAAAATATGGAGCTAAAAAAGCAGCTCGTGGTGCTGAAGAGTTAGCGGAAGATATGGCTCACGGTATTTCAAAAGGT
GCTAAAAAAGCAGCTCGTGGTGCTGAAGAGTTAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053187.1\|WP_006784198.1\|1547043_1547685_+\|pentapeptide-repeat-containing-protein	unknown	unknown	gnl\|CDD\|372644
NZ_CP053187.1\|WP_006784202.1\|1541841_1542423_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379534
NZ_CP053187.1\|WP_009606359.1\|1551101_1552484_-\|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase	unknown	unknown	gnl\|CDD\|223841
NZ_CP053187.1\|WP_006784199.1\|1546714_1547029_+\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP053187.1\|WP_132942540.1\|1538523_1539348_-\|AraC-family-ligand-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380391
NZ_CP053187.1\|WP_006784193.1\|1552662_1553718_-\|YheC/YheD-family-protein	unknown	unknown	gnl\|CDD\|373047
NZ_CP053187.1\|WP_006783741.1\|1537277_1537733_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|200361
NZ_CP053187.1\|WP_006783738.1\|1533983_1534769_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP053187.1\|WP_006783736.1\|1532046_1532997_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|274706
NZ_CP053187.1\|WP_006783739.1\|1534781_1536071_+\|oxalate:formate-antiporter	unknown	unknown	gnl\|CDD\|365905
NZ_CP053187.1\|WP_006784200.1\|1543345_1546600_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224117
NZ_CP053187.1\|WP_006783737.1\|1532999_1533980_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP053187.1\|WP_006783740.1\|1536057_1537263_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|365905
NZ_CP053187.1\|WP_006783735.1\|1531271_1532021_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|349759
NZ_CP053187.1\|WP_006783744.1\|1539759_1540704_+\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|133427
NZ_CP053187.1\|WP_009606368.1\|1547708_1548218_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|225695
NZ_CP053187.1\|WP_132942539.1\|1548471_1550238_+\|RNA-helicase	unknown	unknown	gnl\|CDD\|350671
NZ_CP053187.1\|WP_006784201.1\|1542647_1543352_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP053187.1\|WP_006784195.1\|1550453_1550729_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053187.1\|WP_006783742.1\|1537875_1538502_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225239

Protein	Function_ID	Function_description	E-value
NZ_CP053187.1\|WP_006784198.1\|1547043_1547685_+\|pentapeptide-repeat-containing-protein	gnl\|CDD\|372644	pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies).	7.15183e-11
NZ_CP053187.1\|WP_006784202.1\|1541841_1542423_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379534	pfam14278, TetR_C_8, Transcriptional regulator C-terminal region. This domain is a tetracycline repressor, domain 2, or C-terminus.	7.28656e-16
NZ_CP053187.1\|WP_009606359.1\|1551101_1552484_-\|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase	gnl\|CDD\|223841	COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane].	9.03257e-81
NZ_CP053187.1\|WP_006784199.1\|1546714_1547029_+\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	1.10386e-14
NZ_CP053187.1\|WP_132942540.1\|1538523_1539348_-\|AraC-family-ligand-binding-domain-containing-protein	gnl\|CDD\|380391	cd06986, cupin_MmsR-like_N, AraC/XylS family transcriptional regulators similar to MmsR, N-terminal cupin domain. This family contains bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included is MmsR, a bacterial transcriptional regulator thought to positively regulate the expression of the mmsAB operon. The mmsAB operon contains two structural genes involved in valine metabolism: mmsA which encodes methylmalonate-semialdehyde dehydrogenase, and mmsB which encodes 3-hydroxyisobutyrate dehydrogenase. The cupin domain of members of this subfamily does not contain a metal binding site.	6.07654e-40
NZ_CP053187.1\|WP_006784193.1\|1552662_1553718_-\|YheC/YheD-family-protein	gnl\|CDD\|373047	pfam14398, ATPgrasp_YheCD, YheC/D like ATP-grasp. A member of the ATP-grasp fold predicted to be involved in the modification/biosynthesis of spore-wall and capsular proteins.	3.86455e-72
NZ_CP053187.1\|WP_006783741.1\|1537277_1537733_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|200361	TIGR04110, hypothetical_protein_VSWAT3_12502, heme utilization protein HutZ. Members of this family are heme utilization proteins, typically designated HutZ. They are members of the PPOX family (pfam01243) and, except for the lack of an N-terminal extension, are closely related to one form of heme oxidase (1.14.99.3), HugZ (TIGR04109). Members typically are found in a three-gene operon with radical SAM enzyme HutW and a protein of unknown function, HutX.	3.75791e-32
NZ_CP053187.1\|WP_006783738.1\|1533983_1534769_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	9.19205e-120
NZ_CP053187.1\|WP_006783736.1\|1532046_1532997_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|274706	TIGR03659, heme_ABC_transporter_heme-binding_protein_isdE, heme ABC transporter, heme-binding protein isdE. This family of ABC substrate-binding proteins is observed primarily in close proximity with proteins localized to the cell wall and bearing the NEAT (NEAr Transporter, pfam05031) heme-binding domain. IsdE has been shown to bind heme and is involved in the process of scavenging heme for the purpose of obtaining iron.	1.652e-77
NZ_CP053187.1\|WP_006783739.1\|1534781_1536071_+\|oxalate:formate-antiporter	gnl\|CDD\|365905	pfam00148, Oxidored_nitro, Nitrogenase component 1 type Oxidoreductase.	3.90763e-50
NZ_CP053187.1\|WP_006784200.1\|1543345_1546600_+\|ABC-transporter-permease	gnl\|CDD\|224117	COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning].	1.62563e-17
NZ_CP053187.1\|WP_006783737.1\|1532999_1533980_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.31547e-86
NZ_CP053187.1\|WP_006783740.1\|1536057_1537263_+\|oxidoreductase	gnl\|CDD\|365905	pfam00148, Oxidored_nitro, Nitrogenase component 1 type Oxidoreductase.	4.93705e-66
NZ_CP053187.1\|WP_006783735.1\|1531271_1532021_+\|AAA-family-ATPase	gnl\|CDD\|349759	cd02040, NifH, nitrogenase component II NifH. NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.	1.18856e-146
NZ_CP053187.1\|WP_006783744.1\|1539759_1540704_+\|L-lactate-dehydrogenase	gnl\|CDD\|133427	cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP053187.1\|WP_009606368.1\|1547708_1548218_-\|N-acetyltransferase	gnl\|CDD\|225695	COG3153, COG3153, Predicted acetyltransferase [General function prediction only].	4.10315e-42
NZ_CP053187.1\|WP_132942539.1\|1548471_1550238_+\|RNA-helicase	gnl\|CDD\|350671	cd17913, DEXQc_Suv3, DEXQ-box helicase domain of Suv3. Suppressor of var1 3-like protein (Suv3) is a DNA/RNA unwinding enzyme belonging to the class of DexH-box helicases. It localizes predominantly in the mitochondria, where it forms an RNA-degrading complex called mitochondrial degradosome (mtEXO) with exonuclease PNP (polynucleotide phosphorylase), that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. Suv3 plays a role in the RNA surveillance system in mitochondria; it regulates the stability of mature mRNAs, the removal of aberrantly formed mRNAs and the rapid degradation of non coding processing intermediates. It also confers salinity and drought stress tolerance by maintaining both photosynthesis and antioxidant machinery, probably via an increase in plant hormone levels such as gibberellic acid (GA3), the cytokinin zeatin (Z), and indole-3-acetic acid (IAA). Suv3 is a member of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	1.03602e-80
NZ_CP053187.1\|WP_006784201.1\|1542647_1543352_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	2.04265e-105
NZ_CP053187.1\|WP_006783742.1\|1537875_1538502_+\|hypothetical-protein	gnl\|CDD\|225239	COG2364, COG2364, Predicted membrane protein [Function unknown].	5.55415e-26

>NZ_CP053187.1|WP_006783744.1|1539759_1540704_+|L-lactate-dehydrogenase
MKSGVRRVVLVGTGFVGMSFAYSIINQGGIEELVLIDVNHDKAEGEAMDLSHGIAFAPDKTEIWAGTYADCGTADIVVVTAGVNQQPGETRLALVERNAKIMRDVVKNVMKSGFNGILLIASNPVDVLTYVAWQESGLSRHRVIGTGTTLDTARLRHEIGKYLNVDPRNVHGYIVGEHGDTETPLWSHTTVGVKPLLDIIQDDPQYKFEDLEQIYVNVRDAAYHIIDRKRATYYGIGMCTTRIVKAILNDENCVLPVSAYLNGQYGIKDIFTGVPAIINRNGVREVYNLNITKEERDQLHKSVDILRETLQTVL
>NZ_CP053187.1|WP_132942540.1|1538523_1539348_-|AraC-family-ligand-binding-domain-containing-protein
MEQFSLTIDPQPYRDLAFCYCGMHECEPGHSYGPAIRPTFLLHFVLKGKGAYYLNDQKYEIKKDQCFLIRPNELTFYQADQEDPWAYIWVGFDGQMAKKYLEHAGFIDNRLVLNVHDCETLKSYVAEMLNCNKSTHANELKYQGLLYLLLSKLSESSHIQTKQPSLQEDNHYVSKAIEFIENNYFNYIKVSDISHYLCLNRTYLTSLFQKHLGMSPQNFLIQFRMTKAADLLLQTDLSVANISHSCGYSDPLAFSKAFKKANGISPSEYRHLNH
>NZ_CP053187.1|WP_006783742.1|1537875_1538502_+|hypothetical-protein
MKRNKRDYVLYLIGIMMLTLGVSLTVQSDLGAGSIDSINFALAHRLNINLSIVIFVMALLAIAISTCIRCERPKFTTLITAFFMAIGTEFWVFVVSPIVPETLMQKIVVFSIAVILVCTGLALYLKPKLPAHPNDDITVSISEVSNLKIGTAKLMMDAICMIIALLLQGPIGGGTIILTLFVGPGVNLATYLLEKLPFINDLQPYHIQ
>NZ_CP053187.1|WP_006783741.1|1537277_1537733_+|pyridoxamine-5'-phosphate-oxidase-family-protein
METLLNQKSLMISSLNENKMPEISYAPFMMKDQKIYIYISKAAAHYHNLVQNPQCSVMLIEDEAACKTVFARERVSFECIASKVESSKELLELFGGRQGAQMMMVLKTLDFDFFELVPLKGRLVKGFGQAFNISLNNSEFQLTQVTSIGHK
>NZ_CP053187.1|WP_006783740.1|1536057_1537263_+|oxidoreductase
MQLCKYYPVANDRMGSIWTLCSIKDTCIIEFGPAGTTHYAVEGIGSLNAGEGSRIYSTHMDQSDVTFGKYDRLEKAILEVDENIKPRYIFVMASSISSIIGADIESVCSDLQSQVQSKLIAITTGGLKHQYHIGVEQTLELLVKKLVGDYPRDVNKYNILGCTIDKYNYASDVEEMKRMMKLFFNKEVQTVFTCETTVEEIEQASRASLNIVMRKEALKAAKWMKKTYGIPYIYHHVYGLQNTIDFIEAVNKIDGYEVNREYLNAEVEAVKKHLFSLKRKFLFYKETKECAIFGDYDTVLGFDAILKELGLATDRLEVLYQTEVEADWISGRPELERIKYLKSKELFMICGDGPSLEMEHQAKLELQVSNPNLNQVLIYPYTPYMGFRGMLFVIEKILNIK
>NZ_CP053187.1|WP_006783739.1|1534781_1536071_+|oxalate:formate-antiporter
MYTLESLNRLSEIKTDQDIKSLSHAIFPGTHCPLFGVALTASYVKNMTMIVIGTSECTYYTKNFAYHRQKGKDSVYSLVLDDKEVVFGAVAQVERAVKEIIEIEHPDAVMLVTTCVPELIGEDYSSIPYTLEEEVGIPIFVVNTEHFKCNSHIPGMSRALKSLSHAMEKVEVQEGVNIIGHRQDKVEETELVQLLKKYDVQIQTVIPSSCTIAEIKKAPTAKLNIVTDMIGLDLAKEMKRKFNIEYLYFDKHLNVETISKNYEELSKILEIDFSRDLKQVKARYEQLAMKCYSLLKGKKLIYGNTPMMALEMVDFLSDLGLEPVFVQLRELYEQDSPYKESLLDKGYNPYISRIANIAPLRELYDTIGADLYVGHESPMLLKQKGMMQMTFDAHAQKIGYELPIGVMQDMIKLMTEDSKPMGGGKHAAM
>NZ_CP053187.1|WP_006783738.1|1533983_1534769_+|ABC-transporter-ATP-binding-protein
MIEAKNLTAGYEDKIIIKDLNLKIEKGQVVSIIGPNGCGKSTLLKTLSRMIKPMGGAVLLENNELSKLKNKFISQKICLLSQHNLAPTDLTVEQLVYFGRLPHKKWFECKTTEDQELVEWAIEQTGLAHYKHKPIGSLSGGERQRAYIAQALCQTPDVLLLDEPTTYLDISHQLELMELVREINEKFKITIVMVLHELNQASRYSDRLVIMKQGRIVSDGTPVETINQEMIKHVYQIECDIDNDPISNKPRIHPIQTIKTA
>NZ_CP053187.1|WP_006783737.1|1532999_1533980_+|iron-ABC-transporter-permease
MRIDKKYIIIILSFITLLSLIFVFSTVGSVNLSLGEILSALKNNDNKVVTTIVYKMRLPRNILATLVGANLAVSGILLQSVMKNPLADPGITGVSSGASVAAIVILLTAPQLASILPVAAFIGGCVACALVFMMAWKNGLKPERVVLAGVAVNTILGGFISLLSTLYSDKIQSAILWLNGSLATKTWQDVHMLVWYSVIGLILSLFLIRSANVLQLGEESATNLGFNVNRTRLIISLVAVFLAATSTAVVGIISFVGLIVPHISRMLMGSDHKYTIPFSMVLGGIVLLIADTLARTVGGSIEIPVGVIMSIVGGPFFLYLLRKRGN
>NZ_CP053187.1|WP_006783736.1|1532046_1532997_+|ABC-transporter-substrate-binding-protein
MKFKHLLSMILVSTTLLVGCQSSKGTEVEEQIPVVDETSSSTKQEEETTDVEKEVEEIKVVAATVSATQVLAELNAEVLGVPATSQTLPDGYQDLPQVGQAMNPDLEIVASLNPDLFIMDASFKSSVEESLTEYGLNTFFFETGTYTAFLNSIKELGNAINRQDEATTLLNQLKQAEEVALANKTEQAPTVAIIFGAGDNFMLATESSYLGDLAKTLGAINIASEIDTNIESAYIQFSLEQILAQNPDYVLRFAHGNIEETSKMFDEAFDKNEAYQQLDAVADGKVYDLDSTIFNVSANLKVTEAITKLGEILYGN
>NZ_CP053187.1|WP_006783735.1|1531271_1532021_+|AAA-family-ATPase
MRKIAIYGKGGIGKSTTTSNLSAALSTLGYKVMQIGCDPKADSTKNLMNGKFIPTVLEVMNQKGDDTKLEDIVFEGYNGVLCVEAGGPTPGVGCAGRGIIAAFEKLEELKAFEFYQPDIVIYDVLGDVVCGGFSMPIRNGYAEEVYIVTSGEMMSMYAASNISTAINQFKNRGYARLKGLILNAKNVENEVELVEKLATEIDSQIFHYIPRDKDVQLSENDGKTVIEKIKESQMANVYLELATKLTQAI
>NZ_CP053187.1|WP_006784202.1|1541841_1542423_-|TetR/AcrR-family-transcriptional-regulator
MKPKLEDRRVRRTKKLLKESFIELMSEKQIKDITVKDLTEHADLNRGTFYLHYLDIYDLLNQLEDEVIENVSMMIQDFNFRNSNQSTYLLLEQLFEYIYDNKHILKTFLQSHSQGHFFNKIQLLIKTIGLDTLKNLYQESDSIEYTLFLSFVSNGVIGVTEQWISDGMTLTPKEMALLIDNIINHGAKILIQK
>NZ_CP053187.1|WP_006784201.1|1542647_1543352_+|ABC-transporter-ATP-binding-protein
MAGYIEFKDVKKVYKMGEVEIEALSGVDFSINKGEFVIVAGASGAGKSTVLNILGGMDHASSGKILVDGNEINNYSNKELITYRRHDIGFVFQFYNLVQNLTAVENVELATQICENPLNVQEVLEAVGLGHRKNNFPAQMSGGEQQRVAIARALAKNPKLLLCDEPTGALDYNTGKAILKLLQDTCRKMGMTVVMITHNLAIAPMGDKIIHVRNGKVAKIEINENPMPVEGIEW
>NZ_CP053187.1|WP_006784200.1|1543345_1546600_+|ABC-transporter-permease
MVRMSKSLTKDTFRDIKKSLGRFMSILMISALGVAFFVGIKSAPLAMQKTVDQYYDDYNFMDLRLISTLGFTDQDVEAVKGLNDVSGVFPTFTQDVLTKYQDNELVIRLHALPIDNLNSNNPDYINQVKLVEGRLPEKSGEAVVEKSKYLGSIELGSKIQLQSGTDDPLSDTLKTTEYTIVGIVETPYYLSADKGTSNIGSGNISSFMMIPQSDFKSDIYTEMYVSLSNTKALDTFSDQYKDTVSHVVDEIEVLSETQTKHRYDEVMEEAQSELDKNRIEYEGQKAEALAELEDAASQIETAKQDLVNGKAQLASNKAEFESTIQSAEEQIAQGEAQLTQAEDELNRAYNDFLAQKESAQSQIAAAEAQLKSGEEQVAQLDAYKNQLQASLQNPDLTDEQRVAIEAQLAPILQSYESALQTLNAGRAELEKNKQALIDGENQILAGKRTIQASKQELAEQKAKLETEKSNAYAQFKTAEDEIEKGEAELIKAEADYENGKAEAEEQFKEAEEKLQEAQDQINDMTYPEWYVLDRDSHYSYVDYKNAASSIEAISQIFPIFFFLVAALVCLTTMTRMVDEQRLNIGTLKALGYSKVKIASKFLVYAALASMTGAILGTIIGFNVFPNVVIDAYGMMYTLPDTILVFSWPLVIIATLIAVGVTTLSAFFAVNAELKETPSILMRPKAPKEGKRILLERLPFIWNRLNFIAKVTVRNLFRYKKRFFMTVFGIAGCTALLVTGFGVKDSIRTIVDTQFGEIFKYNMTMKLNKDISLSDEKALVTELQNDPRIQGVLSIHSENGKLSDDDVTKDVNVFVPHSVADLDPFVSLRNRVTQEKVELPEYGVVLSEKVGKQLGVKVGDNVTIENADGKKAEAKVEGIVENYLFHYVYLSPTYYEELFNETPTFESILGVANDDTLELEEAVSSDYMNQAGVSGISWNSSIGSNFDNMIQNLNYVVLLMIISAGALAFVVLYNLTNVNISERMREIATIKVLGFYDKEVSAYIYRENIILTLIGTVVGLGLGILLHRYIMLTVELDNMMFGRQIAPLSFIYSAGLTILFAFVVNFAMYYKLKKIEMVESLKSVD
>NZ_CP053187.1|WP_006784199.1|1546714_1547029_+|thioredoxin-family-protein
MNKDLLLQQLSTHQMMLLYFKGSQCSACLALLPKVEKLIEQYPEIEMRIIDVNKDAEISSHFGVYSVPATILFIEGKEYIKEAGIFSIHTLNEKINRLYEMIYK
>NZ_CP053187.1|WP_006784198.1|1547043_1547685_+|pentapeptide-repeat-containing-protein
MEKIEKPKRTGKLNHNLTFTECLAEDYYIHGMQFENEEISYLSIERLSLNQCHFKNVVFLECEFDHIDLTDTIFENCDLSNIKMPDGIIHRCIFQNCRLTGSDFSNCGIQQTLFKENSGRYINFSFSTFKKVNLLSNQFSHGSFNECQFNKVAFEENQLEIAEFIHTSLNGLDFSNCKIDGIVIPMENLKGLSVSPEQALQLATLLGLKIKHL
>NZ_CP053187.1|WP_009606368.1|1547708_1548218_-|N-acetyltransferase
MNLIIRTEHEKEFNQIYDFVRIAFETAQVSDGNEQNFVNELRASENYIPELALVALVDGNIIGHIMLTKYIVQDLNQNHDVLLLAPLSVDLNYRGQGIGSKLVMKSFELARKMGYTAVVLVGDPAYYQRFGFKSSVDFGINCHEIPAQYIQACELVEGSLDNVFGTLTF
>NZ_CP053187.1|WP_132942539.1|1548471_1550238_+|RNA-helicase
MKKNRREIRDLKQLKEQLFGIKQVVHHTKIGNLWNHEAAVRKKLKVLTEMDGQSLKGYHQVYKEYRDLLDEISVRLLEDYNDKNNTSFEFDEIVQSHLPEYLSSGILTALVSSHIPNLMADSFKTHFPKNPKDEYQEARNLKRKIYLHLGQTNTGKTHRAIERLKQSQKGVYLAPLRILALEIYERLNKEGVPCTLLTGEEEVIIPEANHQSSTVEKVNLDQTYDVAVIDEIQMIGDYQRGSSWTRALLGLRCSEIHVCGALNAKEILLEMIKDCGDEFEVIEYERLMPLVIEKEPFNHQDTQEGDAFILFSKRKVLQLAKQYKEMGINASVIYGDLPPEVRKMQYYDFVHKKNLILVSTDAIGMGVNLPIRRIVFMNLCKFDGEEERFLTSQEVKQIAGRAGRIGIYEVGYVAGYGRSYSFLKEKIEMEDDPIEQAVIGPSEVLLQIEGLPLKEKLALWSTMPVETLYYRKMDIRDYILVLDKVRRYKLDEYVEWKLMKLPIDVHNDEVLSTLLFFIESYFVQKVGEVPRPHLGEVNLSNLETYYQEVNLYYSFCKSFNIEFDVEWVYDERLRISELINDLLIKGRY
>NZ_CP053187.1|WP_006784195.1|1550453_1550729_-|hypothetical-protein
MFNDILIKPNNNELHVYSYFDREFICSVKLNDKIQIECYDDIVFLSGELKQNTITNQLHLVDRNGFVCPIEFGTVYKKLWLIEDESMFNKF
>NZ_CP053187.1|WP_009606359.1|1551101_1552484_-|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase
MKKLSIGTIRKVIHGSLVKGNDNLMISSVVTQAKQVESSNTLLFLLNPRTFDWRFIKKYLPCAIVTDRPIGHCPFGNNCTIIKVNKIKESYYDFIDFYRNQFDIPVIAVTGTCGKTTTKDMTRHILKHFYKTEGTVKSTNGESKHLSYLMKLNDSVEAAVYETAVAAPGYIKKSSRYFKPQIGIITNIGIDHLDQCKTLEGYIKAKGEMVKAVGEKGTLILNADDDNIKKISLEDFKGKIIYYGVGENADYQASNIEFVPKGMSYILTVNNKRYKVFIPGYGVHQVYNSMAAIAAAYEVGISYRDSIKLLPSFKHLNSHFEVMKGLNQCQLIVDTWNINPTSLEASIKTMCEIAKNRKKIALVGSIDALGKNSRQLHQKVGDMICQYDLDVLITIGSQARYIALQCRRNGFKGKVYSFSSTEGVRRLLNQIVDKDTTLLTKCSMHDPAVINFVNNLKLKK
>NZ_CP053187.1|WP_006784193.1|1552662_1553718_-|YheC/YheD-family-protein
MILIGYLSHRKNPRTVKQAYYFAVAAQKENAEFLFFSPKGIDIANRKINGYILVKNQWKKVERRFPDVIFNHGNPGKMAHSQDKIDVLKQEIPFTSHSIGSKMTVYYRLKEAKTFSEYLIPSITVYSPKDVLNALNKYKKIVFKPNDGHKGIGVTFIDKLPKGYSVKVDHQKFIYNEAQLMRFVKQRIRGKKHLIQPCINSKTRYGVPFDLRLHVQKDGNGEWKVALIYARVARNNSFVTNLSSGGSRVPIEKFLRQQYPKEYSAMKKRLERFALDLARHMDEIQQQVHSETLDELGIDIGIDQNKHFWIYEVNWRPGLPHALFGKVGAERTMIQYTIYLAKQHKSHLNNR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1338105 : 1397880

Bacillus_phage(23.53%)

transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006783509.1\|1338105_1338555_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_009606162.1\|1338554_1339244_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_006783507.1\|1339251_1339683_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_009606168.1\|1339697_1340717_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-68	42.4
WP_006783505.1\|1340893_1341070_-	hypothetical protein	NA	NA	NA	NA
WP_055165751.1\|1341165_1343073_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.7e-57	32.3
WP_006783503.1\|1343313_1343973_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_006783502.1\|1344304_1344928_+	ECF transporter S component	NA	NA	NA	NA
WP_006783501.1\|1344928_1346140_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	9.3e-43	33.2
WP_006783500.1\|1346133_1346904_+	type III pantothenate kinase	NA	NA	NA	NA
WP_009606167.1\|1347130_1347418_+	co-chaperone GroES	A0A221S4A5	uncultured_virus	6.5e-11	37.6
WP_006783498.1\|1347464_1349081_+	chaperonin GroEL	A0A240F779	uncultured_virus	1.2e-151	52.4
WP_006783497.1\|1349182_1349533_+	holo-ACP synthase	NA	NA	NA	NA
WP_006783496.1\|1349568_1349769_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_006783495.1\|1349901_1350900_+	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_006783494.1\|1350937_1351264_-	hypothetical protein	NA	NA	NA	NA
WP_006783493.1\|1351398_1352079_+	response regulator transcription factor	NA	NA	NA	NA
WP_006783492.1\|1352081_1353482_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.4e-27	31.7
WP_006783491.1\|1353637_1354795_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_039930604.1\|1355063_1356827_+	N-acetylmuramoyl-L-alanine amidase	S5M9Y4	Brevibacillus_phage	6.4e-16	28.6
WP_132942951.1\|1357124_1358270_+	glycosyltransferase	NA	NA	NA	NA
WP_132942952.1\|1358250_1359069_+	RecX family transcriptional regulator	NA	NA	NA	NA
WP_006783487.1\|1359114_1359822_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_009606160.1\|1360212_1360839_+	ECF transporter S component	NA	NA	NA	NA
WP_132942955.1\|1360954_1362100_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_170837667.1\|1362273_1363911_+	alpha-glucosidase	NA	NA	NA	NA
WP_129821681.1\|1364246_1365668_+	M23 family metallopeptidase	A0A0K2CNY2	Brevibacillus_phage	3.3e-15	36.6
WP_006783482.1\|1365917_1367186_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_006783481.1\|1367268_1368738_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_006783480.1\|1368792_1369743_+	glycosyltransferase family 2 protein	F1C5B0	Cronobacter_phage	4.9e-71	44.5
WP_006783479.1\|1369809_1370991_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_039930598.1\|1371507_1372701_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.2e-156	72.6
WP_039930589.1\|1372823_1373714_+	YegS/Rv2252/BmrU family lipid kinase	A0A1V0SBJ0	Catovirus	3.7e-12	27.9
WP_132942954.1\|1373873_1377086_+	glucosaminidase domain-containing protein	NA	NA	NA	NA
WP_006784913.1\|1377102_1378236_+	glycosyltransferase	NA	NA	NA	NA
WP_006784914.1\|1378229_1379198_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_006784915.1\|1379207_1380224_+	glycosyltransferase	A0A1V0SAH6	Catovirus	4.2e-12	40.0
WP_006784916.1\|1380239_1381739_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
WP_055164393.1\|1381856_1382801_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.3e-79	48.7
WP_006785037.1\|1382971_1384975_+	hypothetical protein	NA	NA	NA	NA
WP_006785036.1\|1384992_1385856_+	glycosyl transferase family 14	NA	NA	NA	NA
WP_006785035.1\|1385859_1386468_+	DUF1919 domain-containing protein	NA	NA	NA	NA
WP_006785034.1\|1386674_1387358_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_040764027.1\|1387361_1387736_+	DUF2304 domain-containing protein	NA	NA	NA	NA
WP_155225984.1\|1387732_1388752_+	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	1.3e-42	33.1
WP_170837668.1\|1388788_1389202_+	acyltransferase family protein	NA	NA	NA	NA
WP_132943041.1\|1389264_1390402_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	8.1e-89	61.1
WP_006783301.1\|1391328_1391514_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_132942558.1\|1393530_1393782_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_132942557.1\|1394089_1394323_-\|transposase	transposase	NA	NA	NA	NA
WP_006785170.1\|1396809_1397235_+\|transposase	transposase	A0A1B1P7S0	Bacillus_phage	4.0e-25	45.0
WP_157753422.1\|1397295_1397880_+\|transposase	transposase	A0A1B1P7S0	Bacillus_phage	1.4e-49	52.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP053187

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection