CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP053316	Bacillus circulans strain GN03 plasmid unnamed, complete sequence	0 crisprs	csa3,RT	0	0	0	0
NZ_CP053315	Bacillus circulans strain GN03 chromosome, complete genome	1 crisprs	RT,WYL,DinG,csa3,DEDDh,cas3	0	1	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053315_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053315_1

2407731-2407917

Orphan

Consensus_repeat	Method
ANNGATAAAGAAATAAAAA	CRT

4 spacers

The CRISPR arrays of NZ_CP053315_1

>merge|NZ_CP053315|1|2407731-2407917|CRT
AAAGACAAAGAAATAAAGGATTTAAAATCAAAAGTTTCCAGCAGAGATAAAGAAATAAAAAAACAAAAGGGTAATGTAGCTTCTAAGGATAAAGAAATAAAAAGTTTAAAATCAACTATATCAAGTAAAGATAAAGAAATAAAAAGCCAAAAAGATAAGGTAGCATCTCGTGATAAAGAAATTAAAA

>NZ_CP053315|1|1|2407731-2407917|CRT
AAAGACAAAGAAATAAAGG	ATTTAAAATCAAAAGTTTCCAGC
AGAGATAAAGAAATAAAAA	AACAAAAGGGTAATGTAGCTTCT
AAGGATAAAGAAATAAAAA	GTTTAAAATCAACTATATCAAGT
AAAGATAAAGAAATAAAAA	GCCAAAAAGATAAGGTAGCATCT
CGTGATAAAGAAATTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053315.1\|WP_095328480.1\|2415522_2415744_+\|WYL-domain-containing-protein	unknown	unknown	gnl\|CDD\|379100
NZ_CP053315.1\|WP_163188480.1\|2403533_2404802_+\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP053315.1\|WP_161798419.1\|2410729_2410885_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053315.1\|WP_016204997.1\|2404913_2405333_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133380
NZ_CP053315.1\|WP_095328481.1\|2416149_2416461_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371387
NZ_CP053315.1\|WP_095328477.1\|2412119_2412650_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP053315.1\|WP_171509604.1\|2408972_2409617_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224548
NZ_CP053315.1\|WP_141231315.1\|2408596_2408764_-\|IS3-family-transposase	unknown	unknown	unknown
NZ_CP053315.1\|WP_095328472.1\|2406808_2407036_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP053315.1\|WP_163188593.1\|2413259_2413400_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053315.1\|WP_095328469.1\|2402237_2403533_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP053315.1\|WP_095328465.1\|2396144_2397248_+\|quinolinate-synthase-NadA	unknown	unknown	gnl\|CDD\|236489
NZ_CP053315.1\|WP_123257618.1\|2405366_2406704_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP053315.1\|WP_095328478.1\|2413499_2414090_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053315.1\|WP_171509605.1\|2411360_2411972_+\|undecaprenyl-diphosphatase	unknown	unknown	gnl\|CDD\|239480
NZ_CP053315.1\|WP_095328468.1\|2401127_2402081_+\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP053315.1\|WP_123259119.1\|2399340_2400297_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP053315.1\|WP_123257626.1\|2414769_2415321_-\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|153097
NZ_CP053315.1\|WP_123257617.1\|2397450_2398914_+\|sigma-70-region-4-domain-containing-protein	unknown	unknown	gnl\|CDD\|369791
NZ_CP053315.1\|WP_031538267.1\|2400324_2400564_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001

Protein	Function_ID	Function_description	E-value
NZ_CP053315.1\|WP_095328480.1\|2415522_2415744_+\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	1.80489e-07
NZ_CP053315.1\|WP_163188480.1\|2403533_2404802_+\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP053315.1\|WP_016204997.1\|2404913_2405333_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	2.05043e-23
NZ_CP053315.1\|WP_095328481.1\|2416149_2416461_+\|hypothetical-protein	gnl\|CDD\|371387	pfam11122, Spore-coat_CotD, Inner spore coat protein D. This family is conserved in the Enterobacteriaceae family. CotD is an inner spore coat protein that is expressed in the middle phase of mother cell gene expression. Along with CotD, CotH, CotS and CotT it is assumed to assemble into the loose skeleton of the matrix, between the shells of SpoIVA and CotE. Coat proteins do not share much sequence similarity between species, but this does not imply they do not share secondary, tertiary, or quaternary features.	1.5559e-13
NZ_CP053315.1\|WP_095328477.1\|2412119_2412650_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.59753e-42
NZ_CP053315.1\|WP_171509604.1\|2408972_2409617_-\|hypothetical-protein	gnl\|CDD\|224548	COG1633, COG1633, Uncharacterized conserved protein [Function unknown].	3.47813e-29
NZ_CP053315.1\|WP_123259119.1\|2399340_2400297_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.21428e-164
NZ_CP053315.1\|WP_095328472.1\|2406808_2407036_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.55345e-15
NZ_CP053315.1\|WP_095328469.1\|2402237_2403533_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP053315.1\|WP_095328465.1\|2396144_2397248_+\|quinolinate-synthase-NadA	gnl\|CDD\|236489	PRK09375, PRK09375, quinolinate synthase NadA.	2.9459e-152
NZ_CP053315.1\|WP_123257618.1\|2405366_2406704_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP053315.1\|WP_171509605.1\|2411360_2411972_+\|undecaprenyl-diphosphatase	gnl\|CDD\|239480	cd03385, PAP2_BcrC_like, PAP2_like proteins, BcrC_like subfamily. Several members of this family have been annotated as bacitracin transport permeases, as it was suspected that they form the permease component of an ABC transporter system. It was shown, however, that BcrC from Bacillus subtilis posesses undecaprenyl pyrophosphate (UPP) phospatase activity, and it is hypothesized that it competes with bacitracin for UPP, increasing the cell's resistance to bacitracin.	2.8629e-45
NZ_CP053315.1\|WP_095328468.1\|2401127_2402081_+\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	7.41737e-161
NZ_CP053315.1\|WP_123257626.1\|2414769_2415321_-\|ferritin-like-domain-containing-protein	gnl\|CDD\|153097	cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins. Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterioferritin, ferritin, rubrerythrin, aromatic and alkene monooxygenase hydroxylases (AAMH), ribonucleotide reductase R2 (RNRR2), acyl-ACP-desaturases (Acyl_ACP_Desat), manganese (Mn) catalases, demethoxyubiquinone hydroxylases (DMQH), DNA protecting proteins (DPS), and ubiquinol oxidases (AOX), and the aerobic cyclase system, Fe-containing subunit (ACSF).	7.83678e-25
NZ_CP053315.1\|WP_123257617.1\|2397450_2398914_+\|sigma-70-region-4-domain-containing-protein	gnl\|CDD\|369791	pfam08281, Sigma70_r4_2, Sigma-70, region 4. Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif.	9.49728e-05
NZ_CP053315.1\|WP_031538267.1\|2400324_2400564_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.54793e-37

>NZ_CP053315.1|WP_095328472.1|2406808_2407036_-|tyrosine-type-recombinase/integrase
MLRRAELPQIPIHALRDTHAVLLLEAGATIEYIQKRLGHKNYQVTVDTYSHISKKIEENSLSKFESHMNNVLGKI
>NZ_CP053315.1|WP_123257618.1|2405366_2406704_+|type-I-glutamate--ammonia-ligase
MAKNYTKEDIKRFASESDVKFIRLQFTDILGTIKNVEIPISQLDKALDNKMMFDGSSIEGFVRIEESDMYLYPDLNTWVVFPWTAEKGKVARLICDIYNPDGTPFGGDPRNNLKRVLKEMEDLGFTDFNLGPEPEFFLFKLDEKGAPSLELNDNGGYFDLAPTDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYADAITACDQIQTFKLVVKTIARKHGLHATFMPKPLFGVNGSGMHCNLSLFKNGENVFYDPKGELELSETALQFIAGIGKHATSFTAITNPTVNSYKRLVPGYEAPCYVAWSARNRSPLMRIPASRGLSTRVEVRSVDPAANPYLAMAALLKAGLDGIENQMTPPAPVDRNIYIMSKEERIAEGIVDLPSTLAQALDELKQNETMIDALGEHIFDHFVEAKEIEWDMFRVQVHPWERDQYMEMY
>NZ_CP053315.1|WP_016204997.1|2404913_2405333_+|MerR-family-transcriptional-regulator
MSGSQIRRSMPLFPISIVMQLTELSARQIRYYEEHELVAPARSDGNRRLFSLSDIDKLLEIKDLIDQGVNLAGIKQIFSVQEKQVLTDEVKKEAEKARRELSDEDLRKLLRKELLNAGRFNDTHRPSMRQGDMSRYFQK
>NZ_CP053315.1|WP_163188480.1|2403533_2404802_+|methionine-gamma-lyase-family-protein
MYKQLTYGTQLETLVMEVEEQIKEVHQSIDKRIDSNQFRVLASFQNHKVSESHFIPSTGYGYDDIGRDTLESIYAEVFGGEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGIRGEGTGSLREFNIGYNSVNLLPDGQPDYEKIAASIHANTKMIGIQRSKGYATRPSFSIKEIEKMIAFVKEIKSDVVVFVDNCYGEFVEDLEPCHVGADLMAGSLIKNPGGGIAKTGGYIVGKEEFVKACSYRMTSPGIGAEAGASLYSLQEMYQGFFLAPHVVGQSLKGAIFTAAMLEKLGMNSSPSWNAKRTDLIQSVQFDDKDKMIAFCQAIQYASPINSHVTAYPNYMPGYEDDVIMAAGTFIQGASIELTADGPIRPPYVAYVQGGLTYSHVKIAICIAINQLLEQKLITI
>NZ_CP053315.1|WP_095328469.1|2402237_2403533_+|GTPase-HflX
MERRFTYLKETKIEKEKVILVGCETQNDAARFAYSMEELANLTKTANGEVVATLTQMRERIHPSTYIGKGKVEELEMLAEELEADLIIFNDELSPSQVRNVSKNLDARIIDRTQLILDIFASRARSKEGKLQVELAQLQYLLPRLGGQGLQLSRLGAGIGTRGPGETKLESDRRHIRRRIDDIKTQLSVIVEHRDRYRERRKKNRAFQIALVGYTNAGKSTLFNRLSEADSFEEDILFATLDPMTRKIILPSGFSALITDTVGFIQDLPTTLVAAFRSTLEEVREADLLLHVVDSSNEEYYQHEETVHKLLEDLEIPAIPHLTVYNKKDLVHPKFVPTSKTESILISAFDKEDREQLKQTIEQMMMENMEYYETTVESNNGKLLSQLKNETVLRSLIFDEETQNYLCKGYAFKEHAILNYKKSIEKEEWEK
>NZ_CP053315.1|WP_095328468.1|2401127_2402081_+|stage-V-sporulation-protein-K
MEHPIRMKNNGQISVVINSQKKKVLPKEKPEAESIPRNVPSEHEALREIEAELGSLVGMDEMKKMIKEIYAWIYVNKKREESGLKTGKQALHMMFKGNPGTGKTTVARLIGKLFQKMNVLSKGHLIEAERADLVGEYIGHTAQKTRDLVKKAMGGILFIDEAYSLGRGGEKDFGKEAIDTLVKHMEDKQHDFILILAGYSREMDFFLSLNPGLHSRFPLVIDFPDYTTDQLMEIADRMLKEREYALSHEAEKKLKEHLSYVRNVQHPKSFSNGRYIRNIIEKSIRAQAMRLLLESNYDKYELMTLRSNDLMLNSHEK
>NZ_CP053315.1|WP_031538267.1|2400324_2400564_+|RNA-chaperone-Hfq
MKQSVNIQDQFLNQLRKDGTNVTVFLLNGFQIRGFIKGFDNFTVLFESEGKQQLVYKHAISTFAPQKNVQIDLEGTQVQ
>NZ_CP053315.1|WP_123259119.1|2399340_2400297_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MKEKVVVLIGPTAVGKTNLSIELAKKYNGEIISGDSMQIYKGMDIATAKISPEEMQGVPHHLIDIVEPDESFSVAQFQELVRKKITEITARGKLPFIVGGTGLYIQAVLYDYQFQETASDQAFRMKLEEMAQREGSLRIHDRLKEIDPEAAAAIHHHNVRRVIRALEVFHVTGRKMSEIQKEQKQEPLYDTALIGLTMDREILYERINKRVDQMLENGLLEEVEHFYHQGIRDCQSIQAIGYKEIYKYYDGLLSLHESIEELKQNSRRYAKRQLTWFRNKMDVQWYDMTETVKTNDITKKIQEISSYLEGMLEIKSNT
>NZ_CP053315.1|WP_123257617.1|2397450_2398914_+|sigma-70-region-4-domain-containing-protein
MEYTLNRRHRQWKKQIQAYINEWYLLAFLLTGDRVTAEQLLNMAVEQVKDKWSYRHFERLWAKPVIKEYIKFSRNNECNDKYLDFSTLLNRIGLLEGNARVAFLLKYYYGFSYKKIARNLHISERKAKIIIYDALLLWTNNGKLIPIEQVEAAINKDINLAKNFLLDSFRFEKKNQYIETRLKGKRKALFLIFTIVVLFAGGSINQKTLGKTRVSLGPDVYKIYKEGGVFQLGREIQQKGYTDIYAYPEEENNILYVQFSTAESLENKEEVTMFIESYLKERDLDYEIRYEEMNQVIEAEQTDEQTAENKQLEMEQEIYELLTSNTYYYMQNYVSDSSGESREILLSESIPKEEETMIKEEIKNIMTKFDSEWNFSFGKVDAEVVEMEKAMWNIVPALLEAYMFGGDKYKVYDVYPTYEDEQLKFDIYTELAFTTDEDRAKNIETAKELKRSIQFFFQHEDIQKLFNHAPYVIKIYGNNRKEVEFDI
>NZ_CP053315.1|WP_095328465.1|2396144_2397248_+|quinolinate-synthase-NadA
MNLLEGLQASNTIPEKYLAMSNAELEERVVSVKNRLGKKLFIPGHHYQKDEVIQFSDATGDSLKLAQVAAENTEAEFIVFCGVHFMAETADILTTEKQKVYLPDMRAGCSMADMADIYQTNRAWIKLQELFGDTIIPLTYVNSTAAIKAFVGENGGATVTSSNAEKMVSWAFTKKERLLFLPDQHLGRNTAYNLGVPLEQMAIWDPAKNELVYEGVIEDIKVILWKGHCSVHENFTVKNVEQVRKQYPYMKIIVHPECSREVVAAADLAGSTNYIIDVIENAESGSAFAIGTEMNLVNRIMKEHPDKEIISLNPYMCACLTMNRIDLPHLVWCLESIEDNFERNRINVEEPIASNAKIALDRMLELS
>NZ_CP053315.1|WP_141231315.1|2408596_2408764_-|IS3-family-transposase
MNTEVLRFPFYLIIDNIKDVKSEVDRVIVEYNHYRYPWGLNKMTPVQYRDHLIAA
>NZ_CP053315.1|WP_171509604.1|2408972_2409617_-|hypothetical-protein
MYPEVITGLDGPIYHGTTFFQAGPWNQPLHCQDNKCYVHYSHGVINLKYPPYHSTTYPYPQFLGSYVPGVPGFTTLFHAHSRNNIYSFIEKAIDGEYSAISCYQHLINLAPSKEIKERITEIRNDEMRHFRTFSNLYTQLTGKNHQPKMIENCPKQFNAGIDFAFKDEQETVDFYLETASKTDNLKIKEAFIRAAHDEQNHAVWFLYFLNKRVS
>NZ_CP053315.1|WP_161798419.1|2410729_2410885_+|hypothetical-protein
MELKTTGRNKYDMIMELIALHVKQADFFGDDVRPEEIEELFKKYSEIVNRI
>NZ_CP053315.1|WP_171509605.1|2411360_2411972_+|undecaprenyl-diphosphatase
MIFSEVNIHLFRYINDLGKQYTFLNIPMILIAEYMVYFLAIATLLLWFSSKKKNRMMVLCAMVSFLFAEIGGKIAGILHSNYQPFEELLNVNKLIEKTVDNSFPSDHTILFFSICLSFYLFKRGIWLFWVILALIVGISRIWVGVHYPMDVFVGAFIATMSSILVYLILPKLKLTNQFLAYYEDLEQRLTRKVFSKNKGSKDI
>NZ_CP053315.1|WP_095328477.1|2412119_2412650_-|GNAT-family-N-acetyltransferase
MITELHTTRLLLRKMRDSDSTSLFPIWSDPEVTKFMNIDSFTEESQAKEMIFFLDELAKEDKAIRYAIIERESNQIIGSCGFNFIDFDNAKAEIGYELSKLHWGQGYAKEAISCLIQSAFTDLNLNRIEAKIEPDNFNSIRLIEKLSFTYEGTLRKAEKAKNRFIDLKLYSLLASD
>NZ_CP053315.1|WP_163188593.1|2413259_2413400_+|hypothetical-protein
MPFTIFGFDLTVTILNIPFNAEYSITIGKEHKGKHHHDHHHLPVKA
>NZ_CP053315.1|WP_095328478.1|2413499_2414090_-|hypothetical-protein
MIKLFRKRWMLFDQIVKTYKPFVTVDYGVISVSPNDIIGLSTPVNQVKNSDKMKELRNSLEQKGWHDECPVDLHLYRLPNGKYTVATDGNHRTYLANQLEIPKIKAMVSLLIPETYIPENIKAKIEEYEQKEKTYRFEAEKLSKSLQSLGEKRKKAKDEFAYKNFCKLIDDMYSKRQYMLLGFARFLNFVPNETAD
>NZ_CP053315.1|WP_123257626.1|2414769_2415321_-|ferritin-like-domain-containing-protein
MNLAIPHRLEGYPFSSHSQWSQLSNSPHQKYFTPFNLPSYSYSLYRQPNQTSIRKNHLLSQITKAINGEYAAISCYHTLKNIAPSKKEQTVITEIRKDEIRHYNTFSNLYTQLTGKKHTPIMKEKCPTNYRKGIDAAFLDEQETVDMYLEIAYNTTNHQVKEAFLRAAHDEQNHAVWFLYFMK
>NZ_CP053315.1|WP_095328480.1|2415522_2415744_+|WYL-domain-containing-protein
MVKQLEKAWKEKRPIEIIYVKKDNTVSQRTILVYGVTDIYIMAYCLKKKQPRIFKLGSILAASFVKKRHPLYA
>NZ_CP053315.1|WP_095328481.1|2416149_2416461_+|hypothetical-protein
MGRHNNNVGGSGNNKHCNKCSNRVSPVEDIIHPTKTVVRTTTNERRIRNIHPTEIINVNRTVVRNENFFPVTERQVNETVVEDFDCGADINNSNNCRPRRRFF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP053315_1	1.2\|2407792\|23\|NZ_CP053315\|CRT	2407792-2407814	23	MT074137	Bacteroides phage DAC16, complete genome	132092-132114	2	0.913
NZ_CP053315_1	1.2\|2407792\|23\|NZ_CP053315\|CRT	2407792-2407814	23	MT074142	Bacteroides phage DAC23, complete genome	134123-134145	2	0.913
NZ_CP053315_1	1.2\|2407792\|23\|NZ_CP053315\|CRT	2407792-2407814	23	MT074141	Bacteroides phage DAC22, complete genome	134567-134589	2	0.913
NZ_CP053315_1	1.2\|2407792\|23\|NZ_CP053315\|CRT	2407792-2407814	23	MT074139	Bacteroides phage DAC19, complete genome	134204-134226	2	0.913
NZ_CP053315_1	1.2\|2407792\|23\|NZ_CP053315\|CRT	2407792-2407814	23	MT074140	Bacteroides phage DAC20, complete genome	134203-134225	2	0.913

1. spacer 1.2|2407792|23|NZ_CP053315|CRT matches to MT074137 (Bacteroides phage DAC16, complete genome) position: , mismatch: 2, identity: 0.913

aacaaaagggtaatgtagcttct	CRISPR spacer
aacaaaaaggtaaagtagcttct	Protospacer
*******.***** *********

2. spacer 1.2|2407792|23|NZ_CP053315|CRT matches to MT074142 (Bacteroides phage DAC23, complete genome) position: , mismatch: 2, identity: 0.913

aacaaaagggtaatgtagcttct	CRISPR spacer
aacaaaaaggtaaagtagcttct	Protospacer
*******.***** *********

3. spacer 1.2|2407792|23|NZ_CP053315|CRT matches to MT074141 (Bacteroides phage DAC22, complete genome) position: , mismatch: 2, identity: 0.913

aacaaaagggtaatgtagcttct	CRISPR spacer
aacaaaaaggtaaagtagcttct	Protospacer
*******.***** *********

4. spacer 1.2|2407792|23|NZ_CP053315|CRT matches to MT074139 (Bacteroides phage DAC19, complete genome) position: , mismatch: 2, identity: 0.913

aacaaaagggtaatgtagcttct	CRISPR spacer
aacaaaaaggtaaagtagcttct	Protospacer
*******.***** *********

5. spacer 1.2|2407792|23|NZ_CP053315|CRT matches to MT074140 (Bacteroides phage DAC20, complete genome) position: , mismatch: 2, identity: 0.913

aacaaaagggtaatgtagcttct	CRISPR spacer
aacaaaaaggtaaagtagcttct	Protospacer
*******.***** *********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

591385 : 601349

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_123260021.1\|591385_592678_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.0e-19	24.9
WP_095333454.1\|592814_593534_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	8.3e-47	43.9
WP_163187586.1\|593526_593781_+	phosphoribosylformylglycinamidine synthase subunit PurS	A0A0E3FKD5	Synechococcus_phage	4.2e-06	34.6
WP_163187588.1\|593777_594464_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_171509281.1\|594447_596664_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.5e-163	41.8
WP_163187592.1\|596648_598061_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.2e-49	31.2
WP_123260020.1\|598140_599172_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FZ01	Synechococcus_phage	1.5e-62	42.7
WP_095333445.1\|599188_599770_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.9e-25	37.7
WP_095333442.1\|599813_601349_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.4e-74	50.0

DBSCAN-SWA_2

1693174 : 1699296

Bacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095334038.1\|1693174_1693387_-	helix-turn-helix domain-containing protein	A0A1Z1LZP5	Bacillus_phage	1.0e-05	32.9
WP_095334037.1\|1693627_1694512_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_095334035.1\|1694735_1695395_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	7.8e-68	57.3
WP_095334033.1\|1695399_1695882_+	6-carboxytetrahydropterin synthase QueD	J9PV91	Bacillus_phage	7.7e-65	75.5
WP_095334031.1\|1695874_1696603_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	3.7e-55	46.2
WP_163186655.1\|1696635_1697199_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	1.6e-45	53.4
WP_123259677.1\|1697244_1698636_-	L-cystine transporter	NA	NA	NA	NA
WP_095334026.1\|1698816_1699296_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	4.2e-23	38.4

DBSCAN-SWA_3

3217155 : 3292211

110

uncultured_Caudovirales_phage(31.75%)

coat,tail,terminase,head,holin,capsid,protease,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_123257924.1\|3217155_3217401_+\|coat	spore coat protein	NA	NA	NA	NA
WP_047941163.1\|3217612_3217900_-	hypothetical protein	NA	NA	NA	NA
WP_061798489.1\|3217899_3218199_-	DUF2089 family protein	NA	NA	NA	NA
WP_163186003.1\|3219651_3220764_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_163186000.1\|3220756_3221455_-	response regulator	W8CYM9	Bacillus_phage	2.9e-36	37.7
WP_163185997.1\|3221730_3224283_-	vitamin B12-dependent ribonucleotide reductase	A0A0K2CP92	Brevibacillus_phage	3.4e-188	44.8
WP_095332791.1\|3224837_3225674_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_095332790.1\|3225876_3226260_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_095332789.1\|3226356_3227814_-	aminomethyl-transferring glycine dehydrogenase subunit GcvPB	M4QFZ1	Prochlorococcus_phage	8.8e-88	41.0
WP_163185994.1\|3227806_3229153_-	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	E3SN07	Prochlorococcus_phage	6.5e-61	38.0
WP_163185991.1\|3229210_3230311_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_095332783.1\|3230890_3232603_+	DEAD/DEAH box helicase	A0A2H4J643	uncultured_Caudovirales_phage	3.2e-57	29.5
WP_095332781.1\|3232571_3233378_+	hypothetical protein	NA	NA	NA	NA
WP_095332779.1\|3233442_3233631_-	YqzE family protein	NA	NA	NA	NA
WP_163185988.1\|3233685_3234066_-	hypothetical protein	NA	NA	NA	NA
WP_163186091.1\|3234072_3234477_-	ComGF family competence protein	NA	NA	NA	NA
WP_163185985.1\|3234512_3234836_-	hypothetical protein	NA	NA	NA	NA
WP_163185982.1\|3234819_3235257_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_095332771.1\|3235253_3235568_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_171509713.1\|3235580_3236633_-	type II secretion system F family protein	NA	NA	NA	NA
WP_171509714.1\|3237271_3237478_-	hypothetical protein	NA	NA	NA	NA
WP_171509715.1\|3237477_3238110_-	replication-relaxation family protein	U5PWC5	Bacillus_virus	1.7e-27	38.9
WP_171509716.1\|3238045_3239266_-	hypothetical protein	A0A0S2SXW5	Bacillus_phage	1.6e-95	47.0
WP_171509717.1\|3239351_3239612_-	hypothetical protein	NA	NA	NA	NA
WP_171509718.1\|3239764_3239968_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_171509719.1\|3240068_3241067_+	hypothetical protein	NA	NA	NA	NA
WP_171509720.1\|3241097_3241358_-	YolD-like family protein	A0A2I7SCS8	Paenibacillus_phage	3.9e-15	48.7
WP_171509721.1\|3241360_3241579_-	hypothetical protein	A0A1L2JZ89	Aeribacillus_phage	2.1e-09	47.9
WP_171509722.1\|3241688_3242018_+	YolD-like family protein	A0A2H4JAP8	uncultured_Caudovirales_phage	3.1e-25	50.0
WP_171509723.1\|3242022_3242388_+	hypothetical protein	A0A2H4J238	uncultured_Caudovirales_phage	2.5e-31	57.3
WP_171509724.1\|3242350_3242491_-	hypothetical protein	NA	NA	NA	NA
WP_171509725.1\|3242589_3243009_-	hypothetical protein	NA	NA	NA	NA
WP_171509726.1\|3243013_3243475_-	SocA family protein	I6R0L8	Salmonella_phage	6.5e-29	43.3
WP_171509727.1\|3243704_3244457_-	glucosaminidase domain-containing protein	A0A249Y0X5	Enterococcus_phage	1.1e-33	51.4
WP_171509728.1\|3244469_3244769_-\|holin	holin	A0A0U4JE55	Bacillus_phage	2.6e-18	52.9
WP_171509729.1\|3244782_3245154_-	hypothetical protein	A0A2H4J540	uncultured_Caudovirales_phage	9.5e-23	61.0
WP_171509730.1\|3245220_3245469_-	hypothetical protein	A0A2H4J229	uncultured_Caudovirales_phage	5.8e-16	63.1
WP_171509731.1\|3245468_3247451_-\|tail	phage tail protein	A0A2H4J3N3	uncultured_Caudovirales_phage	1.3e-211	71.2
WP_171509732.1\|3247482_3249159_-	hypothetical protein	A0A2H4J709	uncultured_Caudovirales_phage	7.1e-17	46.7
WP_171509733.1\|3249170_3249971_-\|tail	phage tail family protein	A0A2H4J9D8	uncultured_Caudovirales_phage	9.9e-118	77.5
WP_171509734.1\|3249960_3252783_-	hypothetical protein	A0A2H4J228	uncultured_Caudovirales_phage	1.5e-189	56.0
WP_171509735.1\|3252842_3253853_-	GIY-YIG nuclease family protein	A0A1D6Z2A9	Staphylococcus_phage	2.4e-15	41.0
WP_171509736.1\|3253952_3254087_+	toxin-antitoxin system protein	NA	NA	NA	NA
WP_171509737.1\|3254324_3254669_-	hypothetical protein	A0A2H4J224	uncultured_Caudovirales_phage	8.2e-45	74.6
WP_171509738.1\|3254678_3255260_-\|tail	phage tail protein	A0A2H4J534	uncultured_Caudovirales_phage	6.2e-77	73.3
WP_171509739.1\|3255261_3255579_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	1.6e-31	61.5
WP_171509740.1\|3255575_3255935_-	HK97 gp10 family phage protein	A0A2H4JAN0	uncultured_Caudovirales_phage	3.0e-42	73.1
WP_171509741.1\|3255927_3256269_-\|head	phage head closure protein	NA	NA	NA	NA
WP_171509742.1\|3256249_3256549_-	hypothetical protein	A0A0S2SXS0	Bacillus_phage	1.6e-20	52.1
WP_171509743.1\|3256541_3256718_-	hypothetical protein	A0A0S2SXV2	Bacillus_phage	3.4e-15	70.2
WP_171509744.1\|3256739_3257924_-\|capsid	phage major capsid protein	A0A0S2SXJ6	Bacillus_phage	8.6e-150	80.2
WP_171509745.1\|3257916_3258486_-\|head,protease	HK97 family phage prohead protease	A0A0S2SXJ4	Bacillus_phage	3.1e-89	86.2
WP_171509746.1\|3258516_3258822_-	hypothetical protein	A0A142F184	Bacillus_phage	3.9e-38	72.2
WP_171509747.1\|3258811_3260005_-\|portal	phage portal protein	A0A1S5S8H6	Streptococcus_phage	8.4e-129	56.4
WP_171509748.1\|3260005_3261781_-\|terminase	terminase large subunit	C5J959	Streptococcus_phage	1.2e-211	63.3
WP_171509749.1\|3261780_3262143_-\|terminase	P27 family phage terminase small subunit	Q0H265	Geobacillus_phage	3.9e-13	35.0
WP_171509750.1\|3262228_3262540_-	HNH endonuclease	A0A0S2SXR6	Bacillus_phage	3.1e-27	61.6
WP_171509751.1\|3262536_3262761_-	hypothetical protein	NA	NA	NA	NA
WP_171509752.1\|3262761_3263205_-	hypothetical protein	NA	NA	NA	NA
WP_171510330.1\|3263259_3263787_-	SLATT domain-containing protein	NA	NA	NA	NA
WP_171509753.1\|3263916_3264561_-	hypothetical protein	NA	NA	NA	NA
WP_171509754.1\|3265328_3265547_-	hypothetical protein	NA	NA	NA	NA
WP_171510331.1\|3265549_3265999_-	transcriptional regulator	A0A0S2SXN1	Bacillus_phage	8.2e-53	73.6
WP_171509755.1\|3266078_3266225_-	hypothetical protein	NA	NA	NA	NA
WP_171509756.1\|3266350_3266653_-	hypothetical protein	A0A142F1R8	Bacillus_phage	2.8e-33	68.7
WP_171509757.1\|3266802_3267096_-	hypothetical protein	L7TJ47	Halovirus	1.1e-16	48.0
WP_171509758.1\|3267108_3267957_-	hypothetical protein	A0A0Y0AFC6	Bacillus_phage	1.6e-73	50.5
WP_171509759.1\|3268017_3268707_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_171509760.1\|3268708_3268852_-	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	6.2e-07	61.9
WP_144581605.1\|3268854_3269070_-	hypothetical protein	NA	NA	NA	NA
WP_171509761.1\|3269032_3269485_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	5.3e-52	69.9
WP_171509762.1\|3269481_3269691_-	hypothetical protein	NA	NA	NA	NA
WP_171509763.1\|3269687_3269957_-	hypothetical protein	NA	NA	NA	NA
WP_171509764.1\|3269946_3270123_-	hypothetical protein	NA	NA	NA	NA
WP_171509765.1\|3270115_3270973_-	ATP-binding protein	A6XMI1	Bacillus_virus	2.5e-66	49.6
WP_171509766.1\|3270869_3271703_-	replication protein	W8EKA2	Geobacillus_phage	2.1e-22	28.7
WP_171509767.1\|3271714_3271885_-	hypothetical protein	NA	NA	NA	NA
WP_164463660.1\|3273804_3273957_-	hypothetical protein	A0A1C8E9A0	Bacillus_phage	8.1e-13	65.3
WP_171509768.1\|3273953_3274196_-	hypothetical protein	NA	NA	NA	NA
WP_171509769.1\|3274198_3274480_-	hypothetical protein	NA	NA	NA	NA
WP_171509770.1\|3274609_3275068_-	hypothetical protein	A0A1B1P7V7	Bacillus_phage	6.1e-11	34.2
WP_171509771.1\|3275167_3275446_-	hypothetical protein	A0A222Z5X2	Bacillus_phage	9.3e-31	67.8
WP_171509772.1\|3275664_3275880_+	hypothetical protein	NA	NA	NA	NA
WP_171509773.1\|3275885_3276137_-	hypothetical protein	NA	NA	NA	NA
WP_171510332.1\|3276150_3276603_-	ORF6C domain-containing protein	A0A288WFT2	Bacillus_phage	1.2e-11	33.3
WP_171509774.1\|3277103_3277346_-	helix-turn-helix transcriptional regulator	A0A1B2APZ4	Phage_Wrath	5.4e-19	65.3
WP_171509775.1\|3277503_3278136_+	helix-turn-helix domain-containing protein	A0A1B2APZ3	Phage_Wrath	1.4e-77	66.7
WP_171509776.1\|3278202_3279609_+	recombinase family protein	A0A1L2JY12	Aeribacillus_phage	9.9e-113	48.5
WP_171509714.1\|3279667_3279874_-	hypothetical protein	NA	NA	NA	NA
WP_171509715.1\|3279873_3280506_-	replication-relaxation family protein	U5PWC5	Bacillus_virus	1.7e-27	38.9
WP_171509716.1\|3280441_3281662_-	hypothetical protein	A0A0S2SXW5	Bacillus_phage	1.6e-95	47.0
WP_171509717.1\|3281747_3282008_-	hypothetical protein	NA	NA	NA	NA
WP_171509718.1\|3282160_3282364_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_171509777.1\|3282464_3283025_+	hypothetical protein	NA	NA	NA	NA
WP_171509778.1\|3282984_3283464_+	hypothetical protein	NA	NA	NA	NA
WP_171509720.1\|3283494_3283755_-	YolD-like family protein	A0A2I7SCS8	Paenibacillus_phage	3.9e-15	48.7
WP_171509721.1\|3283757_3283976_-	hypothetical protein	A0A1L2JZ89	Aeribacillus_phage	2.1e-09	47.9
WP_171509722.1\|3284085_3284415_+	YolD-like family protein	A0A2H4JAP8	uncultured_Caudovirales_phage	3.1e-25	50.0
WP_171509723.1\|3284419_3284785_+	hypothetical protein	A0A2H4J238	uncultured_Caudovirales_phage	2.5e-31	57.3
WP_171509724.1\|3284747_3284888_-	hypothetical protein	NA	NA	NA	NA
WP_171509725.1\|3284986_3285406_-	hypothetical protein	NA	NA	NA	NA
WP_171509779.1\|3285410_3285716_-	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	6.6e-14	39.0
WP_171509727.1\|3286105_3286858_-	glucosaminidase domain-containing protein	A0A249Y0X5	Enterococcus_phage	1.1e-33	51.4
WP_171509728.1\|3286870_3287170_-\|holin	holin	A0A0U4JE55	Bacillus_phage	2.6e-18	52.9
WP_171509780.1\|3287183_3287522_-	hypothetical protein	A0A2H4J540	uncultured_Caudovirales_phage	3.1e-20	62.5
WP_171509781.1\|3287871_3288174_-	hypothetical protein	A0A2H4J3N3	uncultured_Caudovirales_phage	1.6e-28	75.3
WP_171509782.1\|3288229_3289708_-\|tail	phage tail protein	A0A2H4J3N3	uncultured_Caudovirales_phage	4.9e-163	72.8
WP_171509783.1\|3290896_3291166_-	hypothetical protein	NA	NA	NA	NA
WP_171509784.1\|3291291_3291570_-	hypothetical protein	A0A2H4J709	uncultured_Caudovirales_phage	2.3e-13	45.3
WP_171509785.1\|3292001_3292211_-	hypothetical protein	A0A2H4J9D8	uncultured_Caudovirales_phage	1.4e-18	72.1

DBSCAN-SWA_4

3295835 : 3301116

Bacillus_phage(66.67%)

head,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_171509790.1\|3295835_3296279_-	GIY-YIG nuclease family protein	A0A1D6Z2A9	Staphylococcus_phage	1.2e-16	44.6
WP_171509740.1\|3298004_3298364_-	HK97 gp10 family phage protein	A0A2H4JAN0	uncultured_Caudovirales_phage	3.0e-42	73.1
WP_171509741.1\|3298356_3298698_-\|head	phage head closure protein	NA	NA	NA	NA
WP_171509742.1\|3298678_3298978_-	hypothetical protein	A0A0S2SXS0	Bacillus_phage	1.6e-20	52.1
WP_171509743.1\|3298970_3299147_-	hypothetical protein	A0A0S2SXV2	Bacillus_phage	3.4e-15	70.2
WP_171510333.1\|3300347_3300848_-\|head,protease	HK97 family phage prohead protease	A0A0S2SXJ4	Bacillus_phage	5.7e-79	86.0
WP_171509791.1\|3300948_3301116_-	hypothetical protein	A0A142F184	Bacillus_phage	2.0e-17	70.9

DBSCAN-SWA_5

3308809 : 3325182

Bacillus_phage(43.75%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_171509756.1\|3308809_3309112_-	hypothetical protein	A0A142F1R8	Bacillus_phage	2.8e-33	68.7
WP_171509758.1\|3309568_3310417_-	hypothetical protein	A0A0Y0AFC6	Bacillus_phage	1.6e-73	50.5
WP_171509759.1\|3310477_3311167_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_171509760.1\|3311168_3311312_-	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	6.2e-07	61.9
WP_144581605.1\|3311314_3311530_-	hypothetical protein	NA	NA	NA	NA
WP_171509761.1\|3311492_3311945_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	5.3e-52	69.9
WP_171509762.1\|3311941_3312151_-	hypothetical protein	NA	NA	NA	NA
WP_171509763.1\|3312147_3312417_-	hypothetical protein	NA	NA	NA	NA
WP_171509764.1\|3312406_3312583_-	hypothetical protein	NA	NA	NA	NA
WP_171509765.1\|3312575_3313433_-	ATP-binding protein	A6XMI1	Bacillus_virus	2.5e-66	49.6
WP_171509766.1\|3313329_3314163_-	replication protein	W8EKA2	Geobacillus_phage	2.1e-22	28.7
WP_171509767.1\|3314174_3314345_-	hypothetical protein	NA	NA	NA	NA
WP_171510334.1\|3314337_3315078_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A2P1JU03	Anoxybacillus_phage	1.3e-100	69.8
WP_171509797.1\|3315094_3315982_-	hypothetical protein	A0A290GJN8	Caldibacillus_phage	1.5e-114	69.9
WP_171509798.1\|3315982_3316156_-	hypothetical protein	NA	NA	NA	NA
WP_164463660.1\|3316260_3316413_-	hypothetical protein	A0A1C8E9A0	Bacillus_phage	8.1e-13	65.3
WP_171509768.1\|3316409_3316652_-	hypothetical protein	NA	NA	NA	NA
WP_171509769.1\|3316654_3316936_-	hypothetical protein	NA	NA	NA	NA
WP_171509770.1\|3317065_3317524_-	hypothetical protein	A0A1B1P7V7	Bacillus_phage	6.1e-11	34.2
WP_171509771.1\|3317623_3317902_-	hypothetical protein	A0A222Z5X2	Bacillus_phage	9.3e-31	67.8
WP_171509799.1\|3318095_3318335_+	hypothetical protein	NA	NA	NA	NA
WP_171509773.1\|3318340_3318592_-	hypothetical protein	NA	NA	NA	NA
WP_171510332.1\|3318605_3319058_-	ORF6C domain-containing protein	A0A288WFT2	Bacillus_phage	1.2e-11	33.3
WP_123257977.1\|3319545_3319800_-	helix-turn-helix transcriptional regulator	A0A1B2APZ4	Phage_Wrath	5.7e-19	65.3
WP_171509775.1\|3319957_3320590_+	helix-turn-helix domain-containing protein	A0A1B2APZ3	Phage_Wrath	1.4e-77	66.7
WP_171509776.1\|3320656_3322063_+	recombinase family protein	A0A1L2JY12	Aeribacillus_phage	9.9e-113	48.5
WP_095332765.1\|3323161_3324094_-	cation transporter	NA	NA	NA	NA
WP_095332763.1\|3324135_3325182_-	NAD(P)-binding domain-containing protein	A0A2H4J2Q2	uncultured_Caudovirales_phage	2.1e-14	33.1

DBSCAN-SWA_6

4168323 : 4214131

Streptococcus_phage(25.0%)

integrase,transposase

attL 4183114:4183129|attR 4193463:4193478

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_171509938.1\|4168323_4169085_-\|transposase	transposase	NA	NA	NA	NA
WP_171509939.1\|4169292_4169628_-	flagellar protein FliT	NA	NA	NA	NA
WP_171509940.1\|4169627_4170029_-	flagellar export chaperone FliS	NA	NA	NA	NA
WP_171509941.1\|4170049_4171582_-	flagellar hook-associated protein 2	NA	NA	NA	NA
WP_171509942.1\|4171597_4171948_-	flagellar protein FlaG	NA	NA	NA	NA
WP_171509943.1\|4172091_4172331_-	hypothetical protein	NA	NA	NA	NA
WP_171510348.1\|4172419_4173748_-	flagellin	NA	NA	NA	NA
WP_107932656.1\|4174007_4174781_-	hypothetical protein	NA	NA	NA	NA
WP_171509944.1\|4174797_4175655_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	8.1e-17	30.6
WP_171509945.1\|4175796_4178373_-	hypothetical protein	A0A2H4J8K1	uncultured_Caudovirales_phage	6.0e-55	37.4
WP_107919933.1\|4178472_4178949_-	hypothetical protein	NA	NA	NA	NA
WP_107919932.1\|4179547_4180462_-\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	8.7e-09	24.7
WP_107919931.1\|4180665_4180968_-	hypothetical protein	NA	NA	NA	NA
WP_107919930.1\|4181159_4182062_-	SEC-C domain-containing protein	NA	NA	NA	NA
WP_107919929.1\|4182061_4182571_-	hypothetical protein	NA	NA	NA	NA
4183114:4183129	attL	NA	NA	NA	NA
WP_171510349.1\|4183179_4184817_-	hypothetical protein	NA	NA	NA	NA
WP_171509946.1\|4185076_4185850_-	hypothetical protein	NA	NA	NA	NA
WP_171509947.1\|4185863_4186721_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	2.1e-17	31.2
WP_171509948.1\|4186862_4189442_-	hypothetical protein	A0A2H4J8K1	uncultured_Caudovirales_phage	2.2e-57	38.8
WP_171509949.1\|4189537_4190014_-	hypothetical protein	NA	NA	NA	NA
WP_171510350.1\|4190623_4191496_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	4.4e-18	28.5
WP_171510351.1\|4191788_4192091_-	hypothetical protein	NA	NA	NA	NA
WP_171509950.1\|4192291_4193059_-	hypothetical protein	NA	NA	NA	NA
WP_171509951.1\|4193521_4195192_-	flagellin	NA	NA	NA	NA
4193463:4193478	attR	NA	NA	NA	NA
WP_171509952.1\|4195369_4195591_-	carbon storage regulator CsrA	H2BD56	Pseudomonas_phage	6.7e-08	49.0
WP_171510352.1\|4195595_4196054_-	flagellar assembly protein FliW	NA	NA	NA	NA
WP_171509953.1\|4196058_4196646_-	hypothetical protein	NA	NA	NA	NA
WP_171509954.1\|4196740_4197631_-	flagellar hook-associated protein FlgL	NA	NA	NA	NA
WP_171509955.1\|4197642_4199190_-	flagellar hook-associated protein FlgK	NA	NA	NA	NA
WP_171509956.1\|4199203_4199698_-	flagellar protein FlgN	NA	NA	NA	NA
WP_171509957.1\|4199724_4199991_-	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
WP_171509958.1\|4200189_4200588_-	hypothetical protein	NA	NA	NA	NA
WP_171510353.1\|4201291_4202698_-	DEAD/DEAH box helicase	A0A1X9I5S6	Streptococcus_phage	7.5e-68	36.4
WP_163186419.1\|4202790_4203810_-	NERD domain-containing protein	NA	NA	NA	NA
WP_095334304.1\|4204182_4205022_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	3.0e-16	35.7
WP_095334303.1\|4205339_4206026_-	response regulator transcription factor	NA	NA	NA	NA
WP_095334302.1\|4206196_4207336_-	sensor histidine kinase	NA	NA	NA	NA
WP_123258253.1\|4207881_4208514_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	2.6e-36	42.8
WP_171509959.1\|4208644_4209748_+	LCP family protein	A0A1X9I5X1	Streptococcus_phage	1.2e-23	32.0
WP_171509960.1\|4210019_4212389_+	SpoIID/LytB domain-containing protein	Q2XU88	Pseudomonas_phage	2.4e-18	29.1
WP_171509407.1\|4212625_4214131_+\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

4626718 : 4637028

Enterobacteria_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061801336.1\|4626718_4628008_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	2.0e-43	32.5
WP_171509579.1\|4628007_4628766_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	3.6e-53	43.8
WP_101729734.1\|4628868_4629195_+	hypothetical protein	NA	NA	NA	NA
WP_171510085.1\|4630240_4631407_-	nucleotide sugar dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	1.0e-110	54.4
WP_171510086.1\|4631458_4632823_-	cupin domain-containing protein	A0A1V0SH58	Hokovirus	1.0e-45	30.0
WP_171510087.1\|4632884_4633904_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.8e-79	47.3
WP_171510088.1\|4633905_4634760_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	2.2e-38	37.9
WP_171510089.1\|4634756_4635323_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.1e-41	46.2
WP_171510090.1\|4635344_4636223_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	8.7e-107	66.7
WP_171510091.1\|4636263_4637028_-	SGNH/GDSL hydrolase family protein	A0A2H4J9Z4	uncultured_Caudovirales_phage	1.4e-20	33.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage