CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP053571	Lactobacillus plantarum strain CNEI-KCA4 chromosome, complete genome	2 crisprs	csa3,DinG,cas3,DEDDh	1	1	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053571_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053571_1

2807132-2807357

Orphan

Consensus_repeat	Method
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	PILER-CR

2 spacers

csa3

The CRISPR arrays of NZ_CP053571_1

>merge|NZ_CP053571|1|2807132-2807357|PILER-CR
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTACCATTCAATGTTCCAAGCCCATTAGTAACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTACCATTCAACGTTCCTAGCCCATTAGTGACTTGCCCGGAACCATCAGCCAACTGACTGACACCACTGGCTAACGCCCCGGTCTTAC

>NZ_CP053571|1|1|2807132-2807357|PILER-CR
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	CATTCAATGTTCCAAGCCCATTAGTA
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	CATTCAACGTTCCTAGCCCATTAGTG
ACTTGCCCGGAACCATCAGCCAACTGACTGACACCACTGGCTAACGCCCCGGTCTTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053571.1\|WP_060684131.1\|2793854_2795027_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|224090
NZ_CP053571.1\|WP_003642166.1\|2789993_2790563_-\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP053571.1\|WP_011101965.1\|2810621_2811167_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP053571.1\|WP_024002907.1\|2809600_2810545_-\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|214889
NZ_CP053571.1\|WP_033617510.1\|2808120_2808675_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP053571.1\|WP_003644778.1\|2814629_2816252_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP053571.1\|WP_060684132.1\|2795016_2795883_-\|DUF3737-family-protein	unknown	unknown	gnl\|CDD\|378875
NZ_CP053571.1\|WP_052661592.1\|2817446_2819372_-\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NZ_CP053571.1\|WP_171785975.1\|2799438_2801190_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182732
NZ_CP053571.1\|WP_060684135.1\|2801459_2802854_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP053571.1\|WP_021356578.1\|2790659_2791343_+\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	unknown	unknown	gnl\|CDD\|162788
NZ_CP053571.1\|WP_003644859.1\|2816565_2817360_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319820
NZ_CP053571.1\|WP_033617504.1\|2803343_2803901_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053571.1\|WP_003644847.1\|2797651_2799439_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP053571.1\|WP_015825877.1\|2812033_2812864_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270702
NZ_CP053571.1\|WP_060684133.1\|2795985_2797014_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_CP053571.1\|WP_003642184.1\|2811429_2811957_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP053571.1\|WP_033608924.1\|2813331_2814537_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP053571.1\|WP_003642181.1\|2808773_2809103_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP053571.1\|WP_027821793.1\|2793112_2793706_-\|NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224996

Protein	Function_ID	Function_description	E-value
NZ_CP053571.1\|WP_060684131.1\|2793854_2795027_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|224090	COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism].	9.2573e-145
NZ_CP053571.1\|WP_011101965.1\|2810621_2811167_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.46296e-18
NZ_CP053571.1\|WP_024002907.1\|2809600_2810545_-\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|214889	smart00892, Endonuclease_NS, DNA/RNA non-specific endonuclease. A family of bacterial and eukaryotic endonucleases share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. An histidine has been shown to be essential for the activity of the Serratia marcescens nuclease. This residue is located in a conserved region which also contains an aspartic acid residue that could be implicated in the binding of the divalent ion.	6.05604e-24
NZ_CP053571.1\|WP_033617510.1\|2808120_2808675_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.68761e-08
NZ_CP053571.1\|WP_003644778.1\|2814629_2816252_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP053571.1\|WP_060684132.1\|2795016_2795883_-\|DUF3737-family-protein	gnl\|CDD\|378875	pfam12541, DUF3737, Protein of unknown function (DUF3737). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 281 and 297 amino acids in length.	5.59866e-179
NZ_CP053571.1\|WP_052661592.1\|2817446_2819372_-\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	2.34233e-122
NZ_CP053571.1\|WP_003642166.1\|2789993_2790563_-\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	2.57208e-83
NZ_CP053571.1\|WP_060684135.1\|2801459_2802854_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.66222e-56
NZ_CP053571.1\|WP_021356578.1\|2790659_2791343_+\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	gnl\|CDD\|162788	TIGR02254, hydrolase_haloacid_dehalogenase-like_family, noncanonical pyrimidine nucleotidase, YjjG family. This HAD superfamily includes including YjjG from E. coli and YfnB from B. subtilis. YjjG has been shown to act as a house-cleaning enzyme, cleaving nucleotides with non-canonical nucleotide bases. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).	6.30531e-49
NZ_CP053571.1\|WP_003644859.1\|2816565_2817360_-\|HAD-family-hydrolase	gnl\|CDD\|319820	cd07518, HAD_YbiV-Like, Escherichia coli YbiV sugar phosphatase/phosphotransferase and related proteins; belongs to the haloacid dehalogenase-like superfamily. Escherichia coli YbiV can act as both a sugar phosphatase and as a phosphotransferase. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.36012e-48
NZ_CP053571.1\|WP_003644847.1\|2797651_2799439_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	3.03372e-169
NZ_CP053571.1\|WP_015825877.1\|2812033_2812864_-\|phosphotransferase	gnl\|CDD\|270702	cd05153, HomoserineK_II, Type II Homoserine Kinase. This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a Protein Kinase fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine. The Type II homoserine kinase subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	3.51122e-07
NZ_CP053571.1\|WP_171785975.1\|2799438_2801190_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182732	PRK10789, PRK10789, SmdA family multidrug ABC transporter permease/ATP-binding protein.	0
NZ_CP053571.1\|WP_060684133.1\|2795985_2797014_-\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	2.65663e-135
NZ_CP053571.1\|WP_003642184.1\|2811429_2811957_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	3.41001e-30
NZ_CP053571.1\|WP_033608924.1\|2813331_2814537_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.00928e-09
NZ_CP053571.1\|WP_003642181.1\|2808773_2809103_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.32613e-13
NZ_CP053571.1\|WP_027821793.1\|2793112_2793706_-\|NAD(P)-binding-domain-containing-protein	gnl\|CDD\|224996	COG2085, COG2085, Predicted dinucleotide-binding enzymes [General function prediction only].	1.72029e-34

>NZ_CP053571.1|WP_033617504.1|2803343_2803901_+|hypothetical-protein
MNYTSQANIHKFTVSLVIILLSSILISTTITLKISANTTSSSQQAIDCIAQELADVSNSIRYDPQTGLATNLDVNALVSKYGSNNQNQLQHINEIMKYEYKRNLQFNQGKLNSIQTRSFWSCMKNQLLDMIGYQTFQALLRGGIQGLIQRKAWKAAAKLLIRYLGDGIGVGFIAAQLSWYAIRCA
>NZ_CP053571.1|WP_060684135.1|2801459_2802854_+|MFS-transporter
MSQPSTVTLKTKLAILSVGLLSFVGILVETSMNVTFPTLIKTMGVSLDTVQWLTTGYLLLTTIVMSTTAYVLKRFNPKPLFLFAALVCLLGGILCWLAPNFPILLTGRLLQAVATGISIPLMFQLIFTYVPRNQLGTYTGLASVIVSLAPALGPTYGGILTSVWSWRAIFVGIVPLLALLAILGAFNISGKALGVGDKKFDYLGAILLAITFTSLLFTFNNAGTHGWLSPNFGLWCLWSIVMIGAMVTYAIKGRRQLIDYSILKLPILRLRLFNYFGLQFINIGLSFVLPLFAQTVLGASAMTAGLMMLPGAIVGAITGPIAGRIYDKQGPTTLLTFSAIMASAALLLFWLTTDYFTVIIMAVIYALLRVGFNTGFGTAISDGSTRVPLPQKSDQNSMFSMMQQYAGSIGTSIMSAVIAGYEIHHPTVTGTIMGSKLDFLLLFVLAIAILISVLHVKRLEIGQN
>NZ_CP053571.1|WP_171785975.1|2799438_2801190_-|ATP-binding-cassette-domain-containing-protein
MSIFLKLGWYFRREWKLYLAGVLGLVLTAIIGIVPPRIIGDVVDGINQHSLTAHTLTVYLVIIGVAAVGQYLARYLWRNAIWGGAAGLERTLRERLFWHFMKMDATFYQQYRTGDLMAHATNDLTAVERVAGGGILQFADSIITGGTTLIAMMTLIDWRLTLIAVVPFPLLAVVSRYLGKKIHVAFRASQAAFSRLNNKAQESISGIKVIKALGQEKADVADFNQQIDQTIKINRHVNVLDSLFDPAITMIIALSYGATIILGGLYVTHGVITIGNLVSFVTYLGMMVWPMFAVGMLFNTMERGNASYDRVMELLNQQSAIIDAKRGIEQRPHGDIQYQIKQFNYPNDAGTSLSNVDFTLKAGQTLGIVGRVGAGKSTIMKLILREFDQYDGHITYGGHDIKQYALDSYLPALGYVPQDSFLFSNTIRENIRFADPTVSQAVVEAVAAKSDLSGQIASMTAGYDTQVGEEGISLSGGQRQRLAIARALLINPELLILDDALSAVDAETEAEILANLKAERADKTTIIAAHRLSSVMNADEIIVLDAGHVVERGTHAQLMTQHGWYQKMFTRQQLETKVEGAVQ
>NZ_CP053571.1|WP_003644847.1|2797651_2799439_-|ABC-transporter-ATP-binding-protein
MAARQSVWARSMPVKEQLTVIRRLLPYAKPFKWFFIAAIVFSGLISVVNIYLPRVLQTFIDHYLKTGHATVPVMWYFAGLYFFGMVVRALMQFVQNFSSTMGAEYMLENVRRQMFAKLHRMGMRYFDQVPGGSILSRLTNDTMSFSNFWALFNTLFTAFFAVISSFVAMYLTDAQIALWLLVFMPFLAVTIWYYQRYSSRVYRRMRERLSELNTKLSEAITGISVIQQFRQEHRINGEFDHTNDAYFKTRQAMIRTNSLLLSPLIDLFYALGTVMVLGIFGVRGLNGYVAAGVVYAFITYLNNFYNPMTSMMDNLSDFQDGVVAGSRVLRVMDDPTIAPAQHADPTAKITRGKIEFRHVTFAYDGQHPVLKDVSFVAEPGQTVALVGQTGSGKTSTINVLMRFYEFQSGEVLIDDRDIREYPAEELRQKMGLVLQEPFMFYGDINSNIRMFNDQISDEQVQAAARFVKADDFINDLPENYQSRVIERGASYSSGQRQLISFARTIVTDPKILILDEATANVDTETEEMIQTGLDRIQENRTTIAIAHRLSTIQNADLILVLNQGQIVERGSNDELLQQHGYYYDMIQLQNSAHVD
>NZ_CP053571.1|WP_060684133.1|2795985_2797014_-|aldo/keto-reductase
MQYRQLGTSDLKVSSIALGCMGFGAGTGTALNQRSWAVGQTQANQVLDRAISLGINFFDTAPVYQAGASERVLGQGLKKFQRDQLVLATKFTNRTTQEIENHVSGREHVLRSLDQSLQNLQTDYVDLYIYHIWDWLTPMAEIMAGLNEAVQAGKVRYIGISNAYSWQIAQINALAVRYGYPQFVSIQSHYNLVYREDERELFSYAHENDLATTPYSPLASGRLAHPFGTQTTRRQQDTFADTKYQATSEMDKPIIDRVEELAHQHHVSMAAINLAWLQQRVTAPIIGATKPHHLDAVAEAAGLALTASEIQYLETPYRPHDLEGVMALNRSRTNNWNQYSGQ
>NZ_CP053571.1|WP_060684132.1|2795016_2795883_-|DUF3737-family-protein
MKTITQQYLTGERALFKAHDLEIDNTTFADGESPLKESRNVTLKQPIFKWKYPLWYSQHVTVDQGLFETMSRSGIWYTKDITITNSTLQAPKLFRRASQVKLAHVHFSDAEETLWNCQDITLNDVQAAGDYFGMNSQNIRIDGFNLFGNYAFDGAKNVEIHHATLMTKDALWNCENVTVYDSQIIGEYLGWNSKNIRFVNCTIESDQGLCYMDNVKLENCTLLNTDLAFEYCRNIDADVVSTIDSVKNPLSGRIHAQAIGEIIMDDPEVDPHQTLISVDHESRAPHAV
>NZ_CP053571.1|WP_060684131.1|2793854_2795027_-|pyridoxal-phosphate-dependent-aminotransferase
MPFDFETVLNRRHTNAVKWDVADNELPMWVADMDFETAPVIKQALIKRAQFGVFGYEEVPTAYYEAVADWWATEHNFRPQIEWLMFCTGVVPAISSIVRKMTAAGDNVLVQAPVYNIFYHSIENNGRHTLSSDLVAHDAAYAIDWDDLTTKLADPLTTMMILCNPQNPIGIVWSRATLQRLGELCLKYHVLVVADEIHCDLTLNGHTYTPFSSLTAPVAHNSISCISPSKTFNVAALHAATLIIPDAHVRALVSRGINNDELAEPNSFAIPASIAAYTEGHDWVAALRTKLAANQRQVQTYLTAELPQVKLVEAQATYLLWLDVRQVTTDSAALAAFIRQRTGLFLSAGDVYRGDGNRFLRLNVACPTTTLTNGLARLKAGITAYQQIQA
>NZ_CP053571.1|WP_027821793.1|2793112_2793706_-|NAD(P)-binding-domain-containing-protein
MEIGIIGAGTVGTVLAKTFARGDHQIKLSRHSGAASLATRRAEFAANVAFVEVAEALQQPLVILAVPFEQAPAVLAQVADYKQRIVVDVTNQFTADFKKIKTAPLTGSEVIARAANNARVIKAFNTIPPEFMDGHVDGPGKRVLFYAGDDVAAKKEFAALVRPLNFRPVNLGKLRHGGSVMQVGGGLGNTHFVQIEE
>NZ_CP053571.1|WP_021356578.1|2790659_2791343_+|noncanonical-pyrimidine-nucleotidase,-YjjG-family
MQYAIFDLDNTILDFDRAEAANLAAVFQHHGVTDIRRAENEYQAYNETVWQQIEQGADRDSLLDQRFQVFLGTLGITVDGPAVQQEYDQLLAHSYQVIPGAHELLRTLTNAGLTLLVGTNGIKHTQLSRLAGAHMTPYFDHIFISESIGYAKPNPHFFNAIHDQYPDMNATNTVMIGDSLRSDIAGAATVQLPSIWYNPQHAHNDTTIAPTYTVDNFKQLQKLLLTA
>NZ_CP053571.1|WP_003642166.1|2789993_2790563_-|sugar-O-acetyltransferase
MEIDNDPAYQQMINGELYLESPILQQRRRDVRTKLMQYNQIADNDERNTKMKSLLRSAGDRFFVEPTFEFSYGVNIRIGNHFYANHGVTLCDEGLITIGNDCKFGPKVGLYTPAHPLDPTVRRTEAERTAPITIGNDVWIGGSAVILPGVTLGNNVIVGAGAVVTHSFPDNVIVVGNPARVLKQNAPQS
>NZ_CP053571.1|WP_033617510.1|2808120_2808675_-|TetR/AcrR-family-transcriptional-regulator
MVISIRTELDLQRAMYQLLEQRSISQITVEQICKQAFIHRSSFYRYYTDKFDLLRQMVMHTLDELLAAERTNTVGSAIMSTFIGAHTQVLRHLLVTNNEGDNTRSQQVINDCFVTVAETGADDRVFAMIRQSQHPDLTAYLVSGVVTSIVQWLNNGHRDGQAASTQAMIQGTLATVFSLEQHTV
>NZ_CP053571.1|WP_003642181.1|2808773_2809103_-|winged-helix-turn-helix-transcriptional-regulator
MVSSEEALQEFRETIPIFEVLADERRQQIMIELSQHAQGMTVGELTERMHISQPAVSHQLKTLKERHFVAVEHQGTRNYYRVTFDAPLTQVEHLIHTLKADLELKPYLH
>NZ_CP053571.1|WP_024002907.1|2809600_2810545_-|DNA/RNA-non-specific-endonuclease
MVKLMRRVGIAGLLSLSLLLGGCSLLTSGTDTTSSTTSQQSESSRNQTTSATGNTQQTYKQLAKMTYQSGSAAAIKVNSGKSTLAASQWKNSKIDYGNLDSLNRTTTDTAYLSKANLGRSEGRTAQTWSPTGWHNQPITVNGKRVYPQNRGHLIAYTLSFNLTSNGQYRAGEDGSLDNPKNLATQTAYSNQKTMQIYEDQVRTALEQGKKVIYRVTTVFRGNELMPRGYWSQAVSTDGSVNFNVYIWNVEPGVSFDYATGRGKADSTMQVAGADKVSSSQNTSASRSSQSTTTSKQVERELVKYGYKYVKKALN
>NZ_CP053571.1|WP_011101965.1|2810621_2811167_-|GNAT-family-N-acetyltransferase
MTATITIRPLQRAELTMLWQLGFSDPNAEWTRWNGPYFHDQLPTQTDFETIIGPRDWLIRPRNWVITRDGVIVGSVNWHFVDGSLKRWLEVGIIIYNQEHWGEHIGRTALTKWLTHLFQEETTLPHIGLTTWSGNMRMMQLAEAVGLKQEAWIPQVRYWQGQYYDSVKYGILRNDWQVQKD
>NZ_CP053571.1|WP_003642184.1|2811429_2811957_-|GNAT-family-N-acetyltransferase
MTQFETERLILRPMTAADHDALADMIFDPQVVAYLRYRRVQSPAAFEQLFTTHFLADTTTVFGIERRRDHQLIGFYEFHGSGATGELTYALSPAAWGHGYVAEAGNCLMHYGFETLNYETIEAHYASANPNSGRVMAKMGMQAAGELHTFTSDKGEVIHVMRYLLTKATWRQLSA
>NZ_CP053571.1|WP_015825877.1|2812033_2812864_-|phosphotransferase
MRTLHKTLTRLLQADLIPIAHVSFNEMYTGYSRRYDTVVFVKVFSPNHERKFRTEQQVTAQLTDRVLASFQLASREWVLVLRDWQLTPVPTTLTPALVYQMGQVVSRFHHAIQLPTTADLMPVLDFDGMAARVERLKTSPHYDALVSLLPYFLDHRTMIITALAPQPVMTLHGDMGTRNFRYHHGQLVLIDFERARHGYALEDCLKFFFEDLQQSATLIQAFWAGYGTDLQIPPLVTQWLLLQCSTGIFTYVNQITDPRFEAVGTAMLAQVTLPNH
>NZ_CP053571.1|WP_033608924.1|2813331_2814537_-|CPBP-family-intramembrane-metalloprotease
MTPETEQLLRRWYMGQLIVLFGAAFIQLFTFDGGVFFPVGGMQLLIWGLLAWWPAAEEDQAQWRRLRHVNYYVQTVLQFTLLPILLANLVAWLSQLSWLDEQGLIAVGMAYLMVAFVPVAVVVTKPIESVIGRIAVLITAIFSGVVSAQQTFLVLPNLQAPSVFEMVSDTGILGALGFVIAVGVLLRGWGLTGPSWRFNRQAQTSLVVGLIVVGTAFSLWNAFSAGGSWATTFTHWDFQLRSATWKMFLSGLEPGIAEEWLYRFAVLTLLLQAFRHRRHQLDLAVWLSGGLFGMWHITNVFAGQPLSATVEQIIFAATLGWFLASTYLYSGSILLPMVIHAAIDILSMMASGSQTMVKPDAFEWQTIGATVIIFVGITIYFLTGSRRQVIQAHVNQRLSVQ
>NZ_CP053571.1|WP_003644778.1|2814629_2816252_-|ATP-binding-cassette-domain-containing-protein
MLTVNNVSMQFSTRKLYEDVNLKFTPGNCYGVIGANGAGKSTFLKILEGKLQPTTGTVSMGPNERMSSLNQNHFAFEDEEVLATVIRGHEKLYEIMTEKDALYAKPDFSDEDGIRAAELEGEFAEMDGWNAESEADQLLQNLGIDESMQHLKMSELTEPQKVKVLLGQALFGSPDVLLLDEPTNGLDVQSISWLEDFLAGYEKTVIVVSHDRHFLNQVCTHMCDVDFGKITLFVGNYDFWMESSQLAAKLQANANAKKADQIKELQEFVARFSANASKSKQATSRKKQLEKITLDDIKPSSRKYPFIKFTPDREIGNDLVKVENVSKSIEGVKILDNISFTLRPNEKTALISRNDLATTTLMQIIAGSMAPDSGTVTWGQTTSRTYLPKDINEEYAGSELPIIDWLRQFASKEESDNTFLRGFLGKMLFSGSDVERPVNVLSGGEKVRGMLSKMMLSRANVLLLDDPTNHLDLESITALNDSLIDFKGAIVFTSHDHEFIQTIADHIVEVSAKGVVDRGDTTYDEYLAHEATQGRVQDLY
>NZ_CP053571.1|WP_003644859.1|2816565_2817360_-|HAD-family-hydrolase
MTIKLIATDMDGTFLNDHGDYDQERFANDYAALQQRGIQFVIASGHQAAELATTFSAYPEMWLIGGNGAELWQREAGLKAATFSPQATQQVLAALAPYPELQVALCGTQTVHVLAHANPQFVANMRDYYYQLETCADLTTVTDPVVKFDVICPAAMTEQLVYELTPKLAGIAVPASGGQGSMDLIQPGMHKGRALKQLGEQLGILPDEMLVFGDGTNDLEMFHYATHAVAMQNAPENVQANATAVTGTNVDDGVLDYIEQHILS
>NZ_CP053571.1|WP_052661592.1|2817446_2819372_-|DUF2207-domain-containing-protein
MPKKAVAVSRAPRPGEYDKLGLTIIGGGDGEMSKKRRLSWLSVLGLLAGFCWWFSLAMRAAADYDIDQYQVNVAIQRDGSANVTQAMTYQFDDDYHGVFNVQDLKGIQGAQLEGVTTQLNGGTTVTAAPSETGANNTYQLTQNADRMRVKLYRQVQEDDKLRVVYRYRLKGVVTNYADTAELNWKVIGSGWDVPLNNVKIVIQLPAKNVSALQAWTHGPLSGQTKVERAAGRVTMTLGHNPANQFVESHLLFPTTVTATNTRTNTAKRKATVQKQEAKLAQEANEKRRRNQLLRRVIFGAAVAGWLLVMIGYLWWLARHPAKPHQQPIPINHSFDVPPVTPAVAESLWAQRSPNTDALTAEILRAAANHEITIETVAGHRKPDVRLTQLKPVTNSFLAHCFDKIAVDGQFMLTDLKKYGKRDKAGRLGKWFSRWQTEVDQDVAVYQDETNYRLRNQWLMAAVVVSVMGMIATGAGLLVSPKVVTLMVIPAVVAAVAFWIGWIIQRRRIAINTDAGLELRNQINGLRRMLKDIGHFNTAQVGDLILWEQILPYAAAFGLANQVTKQLAIDFGTEALATGMLVYYPLFYANGGLDFDLSGAINDSFSGALDASGSASSASGGSGGFSGGSSGGFGGGSGGGAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053571_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053571_2

2985949-2986034

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053571_2

>merge|NZ_CP053571|2|2985949-2986034|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP053571|2|1|2985949-2986034|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053571.1\|WP_003642357.1\|2994171_2995008_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP053571.1\|WP_003642344.1\|2981413_2982451_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP053571.1\|WP_171786005.1\|2982599_2983166_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP053571.1\|WP_003643398.1\|2986051_2986651_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP053571.1\|WP_011102039.1\|2979335_2979701_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP053571.1\|WP_033608963.1\|2983385_2984339_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP053571.1\|WP_003643403.1\|2993406_2993913_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP053571.1\|WP_003642342.1\|2979833_2980562_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP053571.1\|WP_003642340.1\|2978767_2979052_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP053571.1\|WP_003642355.1\|2992643_2993390_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP053571.1\|WP_003643402.1\|2991456_2992350_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP053571.1\|WP_003643397.1\|2984455_2985934_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP053571.1\|WP_003642350.1\|2987937_2988732_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP053571.1\|WP_171786004.1\|2975899_2978482_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382
NZ_CP053571.1\|WP_171786003.1\|2974216_2975629_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP053571.1\|WP_003643400.1\|2988728_2989727_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP053571.1\|WP_060684166.1\|2980720_2981287_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP053571.1\|WP_046947578.1\|2986771_2987653_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP053571.1\|WP_060684168.1\|2989723_2990719_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP053571.1\|WP_003643401.1\|2990963_2991476_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100

Protein	Function_ID	Function_description	E-value
NZ_CP053571.1\|WP_003642357.1\|2994171_2995008_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.07613e-56
NZ_CP053571.1\|WP_003642344.1\|2981413_2982451_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP053571.1\|WP_171786005.1\|2982599_2983166_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.97144e-29
NZ_CP053571.1\|WP_003643398.1\|2986051_2986651_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP053571.1\|WP_011102039.1\|2979335_2979701_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP053571.1\|WP_033608963.1\|2983385_2984339_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	1.56092e-130
NZ_CP053571.1\|WP_003643403.1\|2993406_2993913_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.58107e-53
NZ_CP053571.1\|WP_003642342.1\|2979833_2980562_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP053571.1\|WP_003642340.1\|2978767_2979052_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP053571.1\|WP_003642355.1\|2992643_2993390_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP053571.1\|WP_003643402.1\|2991456_2992350_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.82369e-130
NZ_CP053571.1\|WP_003643397.1\|2984455_2985934_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.12844e-72
NZ_CP053571.1\|WP_003642350.1\|2987937_2988732_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP053571.1\|WP_171786004.1\|2975899_2978482_-\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	1.68222e-69
NZ_CP053571.1\|WP_171786003.1\|2974216_2975629_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP053571.1\|WP_003643400.1\|2988728_2989727_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP053571.1\|WP_060684166.1\|2980720_2981287_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.69216e-05
NZ_CP053571.1\|WP_046947578.1\|2986771_2987653_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.58356e-56
NZ_CP053571.1\|WP_060684168.1\|2989723_2990719_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	5.1043e-79
NZ_CP053571.1\|WP_003643401.1\|2990963_2991476_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08

>NZ_CP053571.1|WP_003643397.1|2984455_2985934_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALVLFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP053571.1|WP_033608963.1|2983385_2984339_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQAAGKVRHFGVSNFNPMQVEMLQAAISQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP053571.1|WP_171786005.1|2982599_2983166_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGLLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP053571.1|WP_003642344.1|2981413_2982451_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP053571.1|WP_060684166.1|2980720_2981287_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQTTMANGTLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQDQK
>NZ_CP053571.1|WP_003642342.1|2979833_2980562_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP053571.1|WP_011102039.1|2979335_2979701_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP053571.1|WP_003642340.1|2978767_2979052_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP053571.1|WP_171786004.1|2975899_2978482_-|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKLANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYYAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP053571.1|WP_171786003.1|2974216_2975629_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDLQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NZ_CP053571.1|WP_003643398.1|2986051_2986651_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP053571.1|WP_046947578.1|2986771_2987653_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSTVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP053571.1|WP_003642350.1|2987937_2988732_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP053571.1|WP_003643400.1|2988728_2989727_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP053571.1|WP_060684168.1|2989723_2990719_+|iron-ABC-transporter-permease
MSHNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRR
>NZ_CP053571.1|WP_003643401.1|2990963_2991476_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP053571.1|WP_003643402.1|2991456_2992350_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDKGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP053571.1|WP_003642355.1|2992643_2993390_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP053571.1|WP_003643403.1|2993406_2993913_-|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP053571.1|WP_003642357.1|2994171_2995008_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP053571_1	1.1\|2807190\|26\|NZ_CP053571\|PILER-CR	2807190-2807215	26	NZ_CP053571.1	2807106-2807131	0	1.0

1. spacer 1.1|2807190|26|NZ_CP053571|PILER-CR matches to position: 2807106-2807131, mismatch: 0, identity: 1.0

cattcaatgttccaagcccattagta	CRISPR spacer
cattcaatgttccaagcccattagta	Protospacer
**************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP053571_1	1.1\|2807190\|26\|NZ_CP053571\|PILER-CR	2807190-2807215	26	AP014283	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, * SEQUENCING IN PROGRESS *	15532-15557	4	0.846

1. spacer 1.1|2807190|26|NZ_CP053571|PILER-CR matches to AP014283 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.846

cattcaatgttccaagcccattagta	CRISPR spacer
cattaaatgttccatgcccattaaaa	Protospacer
**** ********* ********. *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

621999 : 704493

Bacillus_virus(20.0%)

protease,bacteriocin,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|621999_622563_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003641929.1\|622756_623425_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003641930.1\|623582_625088_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|625352_625721_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|625833_626343_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003641933.1\|626373_627570_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|627679_628150_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_171785729.1\|628168_628624_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|628727_629300_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_025015650.1\|629465_630386_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_024971424.1\|630522_631434_+	oxidoreductase	NA	NA	NA	NA
WP_003641939.1\|632323_632770_-	hypothetical protein	NA	NA	NA	NA
WP_003641940.1\|633007_634534_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|634534_635506_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|635583_636915_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|637380_638898_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|638912_640742_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|640756_641479_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_033607791.1\|647238_647514_+	hypothetical protein	NA	NA	NA	NA
WP_003641948.1\|647510_648428_+	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|648471_648735_+	hypothetical protein	NA	NA	NA	NA
WP_003641950.1\|648846_649125_+	hypothetical protein	NA	NA	NA	NA
WP_171785730.1\|649212_649398_+	hypothetical protein	NA	NA	NA	NA
WP_047672646.1\|649415_649802_+	hypothetical protein	NA	NA	NA	NA
WP_112297220.1\|650644_650791_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_047672648.1\|650867_651275_+	hypothetical protein	NA	NA	NA	NA
WP_003641957.1\|651816_651954_+	hypothetical protein	NA	NA	NA	NA
WP_011100991.1\|652545_652824_+	hypothetical protein	NA	NA	NA	NA
WP_015379760.1\|653150_653768_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_021356659.1\|653771_654926_-	MFS transporter	NA	NA	NA	NA
WP_047672651.1\|654929_655721_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|655791_656664_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|656823_657639_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_171785731.1\|658164_659541_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|659585_660770_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|661154_661358_+	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|661769_662438_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|662434_662608_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_087615202.1\|662638_662806_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|663667_663868_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|663995_664163_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_061871501.1\|664280_665480_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641977.1\|665510_666257_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641979.1\|667134_667281_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_171785653.1\|667345_667558_-	hypothetical protein	NA	NA	NA	NA
WP_021356664.1\|667471_668800_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_021356665.1\|668800_669544_+	response regulator transcription factor	NA	NA	NA	NA
WP_063204018.1\|669661_670405_+	response regulator transcription factor	NA	NA	NA	NA
WP_021356666.1\|670698_671472_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_021356667.1\|671570_671729_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|671753_671924_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_062688861.1\|674357_675734_+	HlyD family secretion protein	NA	NA	NA	NA
WP_062688864.1\|675823_676513_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721086.1\|676579_677248_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063731253.1\|677334_678015_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_057136860.1\|678108_678795_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063722041.1\|678910_679198_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003646479.1\|679209_679503_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_011101002.1\|679792_682102_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_057136862.1\|682360_683137_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|683575_684592_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|684999_685710_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|685782_687144_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|687150_687339_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|687328_687751_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|687973_689329_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|689346_690783_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003642003.1\|690903_691800_+	ROK family protein	NA	NA	NA	NA
WP_003642004.1\|691949_692696_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_171785732.1\|692808_693822_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642006.1\|694275_695409_+	hypothetical protein	NA	NA	NA	NA
WP_003643820.1\|695413_696208_+	hypothetical protein	NA	NA	NA	NA
WP_003642008.1\|696376_697294_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_171785733.1\|697339_698614_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|698606_699566_+	hypothetical protein	NA	NA	NA	NA
WP_003642011.1\|699587_700292_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|700291_701134_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_024971611.1\|701730_702120_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003643823.1\|702441_704493_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8

DBSCAN-SWA_2

829274 : 879312

Lactobacillus_phage(48.15%)

protease,tRNA,tail,portal,terminase,capsid,integrase

attL 824030:824044|attR 849973:849987

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
824030:824044	attL	NA	NA	NA	NA
WP_003640924.1\|829274_829967_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003643927.1\|830156_831488_-	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
WP_003640926.1\|831563_832247_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003640927.1\|832255_832552_-	N-acetyltransferase	NA	NA	NA	NA
WP_003640928.1\|832690_833227_+	dUTP diphosphatase	J9PV85	Bacillus_phage	2.4e-35	45.8
WP_003643928.1\|834105_835485_+	DNA repair protein RadA	NA	NA	NA	NA
WP_003640931.1\|835500_836676_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003640932.1\|837001_838492_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_024971787.1\|838769_840182_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	2.3e-45	30.0
WP_003640934.1\|840183_840594_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_003640935.1\|840565_841351_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_003640936.1\|841352_841898_+	NYN domain-containing protein	NA	NA	NA	NA
WP_003640938.1\|842404_843007_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003637768.1\|843068_843218_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003640939.1\|843229_843415_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003643932.1\|843519_844068_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_003640941.1\|844095_844983_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003640942.1\|845084_845510_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003640943.1\|845610_846300_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_003643933.1\|846498_847002_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003637775.1\|847063_847432_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_046947784.1\|847586_848789_-\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	3.8e-36	28.4
WP_171785747.1\|849261_850188_-	DUF5067 domain-containing protein	NA	NA	NA	NA
849973:849987	attR	NA	NA	NA	NA
WP_171785748.1\|850239_850671_-	hypothetical protein	O03904	Lactobacillus_phage	8.6e-76	95.1
WP_046947781.1\|850679_851078_-	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	4.0e-67	97.0
WP_063489236.1\|851244_851511_+	helix-turn-helix transcriptional regulator	O03906	Lactobacillus_phage	4.7e-40	97.7
WP_063489237.1\|851776_852178_-	DUF2513 domain-containing protein	A0A097PAT1	Streptococcus_pyogenes_phage	9.4e-08	30.7
WP_076635630.1\|852351_852561_-	hypothetical protein	NA	NA	NA	NA
WP_171785749.1\|853164_853347_+	hypothetical protein	NA	NA	NA	NA
WP_011101088.1\|853407_853962_+	hypothetical protein	O03909	Lactobacillus_phage	3.6e-98	100.0
WP_171785750.1\|853967_854255_+	DNA-binding protein	NA	NA	NA	NA
WP_024002536.1\|854757_855288_+	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	6.1e-55	59.2
WP_171785751.1\|855299_856265_+	hypothetical protein	A6M982	Geobacillus_virus	3.3e-59	51.5
WP_171785752.1\|856347_857277_+	DUF4373 domain-containing protein	A0A0P0HRQ2	Lactobacillus_phage	1.8e-57	43.0
WP_171785753.1\|857273_857561_+	hypothetical protein	NA	NA	NA	NA
WP_171785754.1\|857557_858076_+	hypothetical protein	O03915	Lactobacillus_phage	4.7e-36	52.0
WP_024971543.1\|858072_858447_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_171785755.1\|858449_858761_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	2.2e-49	92.2
WP_171785756.1\|858876_859857_+	DNA cytosine methyltransferase	A0A1I9KKE7	Lactobacillus_phage	3.4e-128	64.2
WP_076633972.1\|860080_860542_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	3.1e-39	56.3
WP_171785757.1\|861293_861917_+	hypothetical protein	NA	NA	NA	NA
WP_171785758.1\|862229_862730_+	hypothetical protein	D6PSW4	Lactobacillus_phage	4.7e-65	79.5
WP_171785759.1\|862744_862942_+	hypothetical protein	D6PSW6	Lactobacillus_phage	9.9e-11	65.3
WP_171785760.1\|863194_863464_+	DUF2829 domain-containing protein	A0A0K2FLC4	Brevibacillus_phage	1.1e-09	40.2
WP_171785761.1\|863504_864170_+	helix-turn-helix domain-containing protein	A0A1S5SAA7	Streptococcus_phage	1.6e-44	53.3
WP_171785762.1\|864150_865476_+\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	1.3e-138	55.7
WP_171785763.1\|865478_867074_+\|portal	phage portal protein	B5LPR1	Bacillus_virus	5.3e-86	38.0
WP_171785764.1\|867066_868152_+	hypothetical protein	A0A059T7W2	Listeria_phage	1.8e-37	30.2
WP_171785765.1\|868215_868818_+	hypothetical protein	NA	NA	NA	NA
WP_171785766.1\|868831_869779_+\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	6.1e-90	59.9
WP_171785767.1\|870138_870543_+	hypothetical protein	A5GYM1	Lactococcus_phage	8.8e-06	26.9
WP_171785768.1\|870543_870933_+	hypothetical protein	NA	NA	NA	NA
WP_171785769.1\|870929_871331_+	hypothetical protein	NA	NA	NA	NA
WP_047673698.1\|871330_871756_+	hypothetical protein	NA	NA	NA	NA
WP_063486493.1\|871773_872391_+	hypothetical protein	NA	NA	NA	NA
WP_064972011.1\|872509_873028_+	hypothetical protein	NA	NA	NA	NA
WP_171785770.1\|873024_873666_+	hypothetical protein	U3PFU8	Lactobacillus_phage	3.3e-07	28.9
WP_171785771.1\|873681_879312_+\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	8.2e-25	26.5

DBSCAN-SWA_3

1357279 : 1363462

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643247.1\|1357279_1358149_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	1.3e-99	60.5
WP_003643248.1\|1358152_1358734_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.5e-38	45.1
WP_003643249.1\|1358743_1359772_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	4.9e-69	42.1
WP_003643250.1\|1359842_1360709_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.5e-34	36.8
WP_003643251.1\|1360722_1360938_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_003643252.1\|1360994_1361942_+	glycosyltransferase	A0A2L1GG98	Phaseolus_vulgaris_alphaendornavirus	1.1e-09	33.3
WP_003643253.1\|1361944_1362640_+	acyltransferase	NA	NA	NA	NA
WP_003643254.1\|1362658_1363462_+	LicD family protein	A0A1V0SAS8	Catovirus	1.2e-06	40.7

DBSCAN-SWA_4

1496972 : 1565721

Lactobacillus_phage(80.0%)

protease,holin,head,tRNA,tail,portal,terminase,capsid,integrase

attL 1502682:1502698|attR 1544119:1544135

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645251.1\|1496972_1497659_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643149.1\|1498330_1498807_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003643148.1\|1498923_1499436_-	hypothetical protein	NA	NA	NA	NA
WP_003643147.1\|1499550_1499838_+	hypothetical protein	NA	NA	NA	NA
WP_060683879.1\|1499902_1502170_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.1e-118	31.5
1502682:1502698	attL	NA	NA	NA	NA
WP_171785837.1\|1502814_1503951_-\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	2.2e-211	98.4
WP_033613717.1\|1504191_1504506_-	hypothetical protein	E9LUS3	Lactobacillus_phage	4.2e-48	96.2
WP_033613719.1\|1504498_1504912_-	hypothetical protein	E9LUS4	Lactobacillus_phage	4.3e-72	98.5
WP_128536997.1\|1505091_1505286_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	3.3e-11	60.3
WP_171785838.1\|1505607_1506849_-	ribonuclease H-like domain-containing protein	A0A0A7RWA3	Clostridium_phage	2.6e-24	35.3
WP_003641360.1\|1506909_1507299_-	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_171785839.1\|1507329_1507656_-	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	9.0e-17	44.1
WP_171785840.1\|1507913_1508129_+	hypothetical protein	NA	NA	NA	NA
WP_171785841.1\|1508211_1508949_+	ORF6C domain-containing protein	A0A1P8BM06	Lactococcus_phage	1.3e-50	45.6
WP_171785842.1\|1509117_1509351_-	hypothetical protein	NA	NA	NA	NA
WP_171785843.1\|1509445_1509775_+	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	5.8e-48	81.7
WP_171785844.1\|1509863_1510103_+	tagatose-bisphosphate aldolase	E9LUT6	Lactobacillus_phage	1.0e-33	82.4
WP_171785845.1\|1510114_1510279_+	hypothetical protein	E9LUT8	Lactobacillus_phage	1.9e-15	80.8
WP_171785846.1\|1510281_1510428_+	hypothetical protein	E9LUT9	Lactobacillus_phage	8.0e-18	95.7
WP_072566891.1\|1510427_1511288_+	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	4.2e-37	34.0
WP_171785847.1\|1511287_1511914_+	ERF family protein	D7RWM8	Brochothrix_phage	1.0e-13	38.2
WP_171785848.1\|1511910_1512372_+	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	1.1e-39	71.8
WP_171785849.1\|1512386_1513079_+	hypothetical protein	E9LUU3	Lactobacillus_phage	3.6e-116	87.4
WP_171785850.1\|1513120_1513957_+	helix-turn-helix domain-containing protein	U5U793	Lactobacillus_phage	1.4e-37	41.4
WP_171785851.1\|1513960_1514263_+	hypothetical protein	E9LUN7	Lactobacillus_phage	5.9e-47	95.0
WP_171785852.1\|1514265_1514577_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	5.9e-50	93.2
WP_171785853.1\|1514580_1514739_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	8.1e-16	88.2
WP_171786061.1\|1514751_1514793_+	hypothetical protein	NA	NA	NA	NA
WP_171785854.1\|1514795_1515188_+	hypothetical protein	C1KFE9	Lactobacillus_virus	8.2e-33	59.7
WP_171785855.1\|1515546_1515972_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	1.6e-66	86.5
WP_122036804.1\|1516399_1517017_+	DUF4145 domain-containing protein	Q20DE2	Lactobacillus_phage	7.8e-54	49.0
WP_122036803.1\|1517088_1517292_+	hypothetical protein	NA	NA	NA	NA
WP_122036802.1\|1517338_1517518_+	hypothetical protein	E9LUP6	Lactobacillus_phage	8.6e-14	71.2
WP_171786062.1\|1517528_1517999_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	6.1e-83	93.6
WP_033608389.1\|1518219_1518681_+\|terminase	phage terminase small subunit P27 family	A0A286QRF4	Streptococcus_phage	6.5e-45	58.2
WP_122036924.1\|1518667_1520575_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	9.8e-180	49.7
WP_033608390.1\|1520564_1520759_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	2.0e-24	92.2
WP_033608391.1\|1520761_1521958_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.5e-205	89.7
WP_171785856.1\|1521935_1522709_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	2.0e-123	91.1
WP_114619779.1\|1522708_1523941_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.9e-200	87.7
WP_016058329.1\|1524013_1524352_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
WP_021732004.1\|1524335_1524698_+\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	1.5e-65	99.2
WP_021732003.1\|1524687_1525128_+	hypothetical protein	E9LUQ6	Lactobacillus_phage	3.2e-78	97.9
WP_022638398.1\|1525124_1525508_+	DUF806 family protein	E9LUQ7	Lactobacillus_phage	1.0e-64	96.9
WP_021732001.1\|1525508_1526147_+\|tail	major tail protein	E9LUQ8	Lactobacillus_phage	3.7e-107	92.9
WP_016058334.1\|1526347_1526731_+	hypothetical protein	E9LUQ9	Lactobacillus_phage	3.9e-64	100.0
WP_016058335.1\|1526727_1526919_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_171785857.1\|1526931_1531866_+	tape measure protein	E9LUR1	Lactobacillus_phage	0.0e+00	83.0
WP_171785858.1\|1531937_1533716_+\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	3.5e-304	92.5
WP_171785859.1\|1533781_1536196_+	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	93.2
WP_171785860.1\|1536212_1538435_+\|tail	phage tail protein	A0A2K9V5E9	Lactobacillus_phage	6.8e-124	46.8
WP_171785861.1\|1538427_1538679_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.2e-29	97.2
WP_171785862.1\|1538682_1538844_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	1.2e-17	94.3
WP_003644510.1\|1542594_1542858_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_171785863.1\|1542869_1543400_+\|holin	holin	E9LUS0	Lactobacillus_phage	1.8e-38	94.7
WP_033608566.1\|1544456_1544882_-	lipoprotein	NA	NA	NA	NA
1544119:1544135	attR	NA	NA	NA	NA
WP_003643143.1\|1545046_1546060_-	hypothetical protein	NA	NA	NA	NA
WP_003643142.1\|1546165_1546687_+	GtrA family protein	NA	NA	NA	NA
WP_003645248.1\|1546786_1547146_-	YisL family protein	NA	NA	NA	NA
WP_060683880.1\|1547218_1549075_-	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_060683881.1\|1549088_1551395_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_060683882.1\|1552283_1553921_+	sulfotransferase family protein	NA	NA	NA	NA
WP_013355451.1\|1553898_1555074_+	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	2.9e-49	31.9
WP_003645243.1\|1555076_1555700_+	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	4.8e-27	40.6
WP_171785864.1\|1555689_1556646_+	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_171785865.1\|1556867_1558607_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_060684322.1\|1559112_1560888_+	SLC13 family permease	NA	NA	NA	NA
WP_003643131.1\|1561162_1562554_+	MATE family efflux transporter	NA	NA	NA	NA
WP_003643130.1\|1562680_1562926_+	hypothetical protein	NA	NA	NA	NA
WP_060683885.1\|1563314_1563761_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643128.1\|1564032_1565721_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.2e-75	32.9

DBSCAN-SWA_5

1584861 : 1599021

Lactobacillus_phage(90.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101397.1\|1584861_1586100_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	4.2e-216	97.2
WP_015825455.1\|1586190_1587162_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4
WP_171785866.1\|1587347_1588295_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.7e-177	99.7
WP_003643097.1\|1588638_1589253_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_171785867.1\|1589255_1591694_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.3
WP_003643095.1\|1591781_1592342_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643094.1\|1592412_1592853_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_052098033.1\|1593197_1593665_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	6.1e-83	99.4
WP_060683890.1\|1593639_1593879_+	DUF11 domain-containing protein	A0A2P0ZL95	Lactobacillus_phage	1.8e-35	100.0
WP_154573519.1\|1593845_1594613_+	hypothetical protein	NA	NA	NA	NA
WP_024971408.1\|1594667_1594925_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_060683892.1\|1596747_1599021_-	HAD-IC family P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	3.8e-37	23.5

DBSCAN-SWA_6

2434864 : 2442263

uncultured_Caudovirales_phage(50.0%)

head,tail,portal,terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021356366.1\|2434864_2435134_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_171785928.1\|2435543_2437085_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	1.8e-43	25.4
WP_171785929.1\|2437081_2438182_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	7.2e-50	33.4
WP_080392743.1\|2438182_2438383_-	hypothetical protein	NA	NA	NA	NA
WP_171785930.1\|2438336_2440040_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.9e-122	40.7
WP_016511396.1\|2440036_2440510_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_171785931.1\|2441539_2441929_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.0e-19	45.6
WP_171785932.1\|2441921_2442263_-\|head	phage head closure protein	NA	NA	NA	NA

DBSCAN-SWA_7

2640997 : 2649508

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2640997_2641576_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_015380733.1\|2641568_2642594_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-59	41.0
WP_003642591.1\|2642590_2644045_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_021356102.1\|2644029_2646249_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.1
WP_011101895.1\|2646241_2646922_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2646921_2647176_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2647177_2647909_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_046811071.1\|2647911_2649042_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2649025_2649508_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

DBSCAN-SWA_8

3251979 : 3312571

Lactobacillus_phage(14.29%)

integrase,holin,transposase

attL 3245260:3245277|attR 3319533:3319550

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3245260:3245277	attL	NA	NA	NA	NA
WP_163621679.1\|3251979_3252870_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	1.3e-155	98.6
WP_016374491.1\|3253001_3253127_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	1.4e-15	92.7
WP_163621677.1\|3255149_3255782_+	recombinase family protein	A0A1B0VBM1	Salmonella_phage	1.4e-13	30.6
WP_020923858.1\|3255868_3256771_+	YitT family protein	M1Q1P6	Streptococcus_phage	8.2e-52	40.3
WP_163621676.1\|3257281_3257428_+	hypothetical protein	NA	NA	NA	NA
WP_071665541.1\|3258203_3258989_+	ParA family protein	Q7M293	Enterobacteria_phage	3.1e-07	26.8
WP_072535820.1\|3259039_3259243_+	hypothetical protein	NA	NA	NA	NA
WP_163621675.1\|3259906_3261013_+	replication initiator protein A	NA	NA	NA	NA
WP_003646131.1\|3261271_3261553_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_163621674.1\|3261542_3262049_+	hypothetical protein	NA	NA	NA	NA
WP_163621673.1\|3262038_3262317_-	hypothetical protein	NA	NA	NA	NA
WP_003555660.1\|3262339_3262567_-	hypothetical protein	NA	NA	NA	NA
WP_171786044.1\|3262819_3264883_+	MobA/MobL family protein	NA	NA	NA	NA
WP_003679901.1\|3265951_3266167_+	hypothetical protein	NA	NA	NA	NA
WP_163621683.1\|3266170_3266647_+	hypothetical protein	NA	NA	NA	NA
WP_163621682.1\|3268329_3270195_+	PRD domain-containing protein	NA	NA	NA	NA
WP_163621681.1\|3270184_3271051_+	ketose-bisphosphate aldolase	NA	NA	NA	NA
WP_171786045.1\|3271090_3273034_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_171786046.1\|3273867_3274839_-	S41 family peptidase	NA	NA	NA	NA
WP_163621630.1\|3275129_3275867_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016378676.1\|3276072_3276177_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_171785655.1\|3276924_3277275_+	hypothetical protein	NA	NA	NA	NA
WP_016511100.1\|3277782_3278046_+	hypothetical protein	NA	NA	NA	NA
WP_097037849.1\|3278160_3279933_+	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_086439174.1\|3279981_3282063_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.7e-28	24.7
WP_072535529.1\|3282081_3282681_+	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_163621631.1\|3282897_3285582_+	DUF4118 domain-containing protein	NA	NA	NA	NA
WP_163621632.1\|3285571_3286273_+	response regulator	W8CYM9	Bacillus_phage	4.8e-23	29.3
WP_097037818.1\|3286438_3288475_+	KUP/HAK/KT family potassium transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	4.7e-63	33.6
WP_171786047.1\|3288858_3289296_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_171786048.1\|3289673_3290243_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	1.6e-32	44.6
WP_171786049.1\|3290337_3292158_-	MFS transporter	NA	NA	NA	NA
WP_171786050.1\|3292322_3292898_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_021356719.1\|3293728_3294271_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_056971947.1\|3294352_3294547_-	hypothetical protein	NA	NA	NA	NA
WP_171786067.1\|3294566_3296336_-	oleate hydratase	NA	NA	NA	NA
WP_020090529.1\|3296662_3296839_-	hypothetical protein	NA	NA	NA	NA
WP_010579558.1\|3296838_3297057_-	hypothetical protein	NA	NA	NA	NA
WP_171786068.1\|3298107_3298338_+	SH3 domain-containing protein	NA	NA	NA	NA
WP_171786069.1\|3298511_3298967_+	L,D-transpeptidase	NA	NA	NA	NA
WP_050676721.1\|3299538_3300012_+	hypothetical protein	NA	NA	NA	NA
WP_063485711.1\|3300722_3301100_+	YxeA family protein	NA	NA	NA	NA
WP_004906477.1\|3301268_3301865_-	helix-turn-helix transcriptional regulator	A0A0B5CYL9	Listeria_phage	5.9e-06	45.1
WP_171786051.1\|3302101_3302461_-	hypothetical protein	NA	NA	NA	NA
WP_012660357.1\|3302473_3303061_-\|integrase	site-specific integrase	E2ELN7	Clostridium_phage	5.0e-18	32.6
WP_003586674.1\|3303137_3303416_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_027822196.1\|3303415_3303772_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_027821369.1\|3303892_3304333_-	hypothetical protein	NA	NA	NA	NA
WP_017260783.1\|3304534_3304747_-	DUF3923 family protein	NA	NA	NA	NA
WP_050676713.1\|3304757_3305300_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_022638775.1\|3305505_3306270_-	helix-turn-helix transcriptional regulator	Q0H244	Geobacillus_phage	3.4e-06	32.6
WP_080263505.1\|3306609_3306891_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_171786070.1\|3307311_3308181_+	glucosaminidase domain-containing protein	A0A249Y0X5	Enterococcus_phage	1.1e-34	47.6
WP_171786052.1\|3309156_3309660_+	DUF536 domain-containing protein	NA	NA	NA	NA
WP_171786053.1\|3311415_3311628_-	hypothetical protein	NA	NA	NA	NA
WP_171786054.1\|3311983_3312571_-\|integrase	site-specific integrase	A0A141E0P1	Streptococcus_phage	6.6e-18	34.6
3319533:3319550	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP053571

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection