CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP053627	Xylella taiwanensis strain PLS229 chromosome, complete genome	1 crisprs	DEDDh,csa3,Cas9_archaeal,cas3,cas5,cas8c,cas7,cas1,DinG	0	0	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053627_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053627_1

1330165-1330265

Orphan

Consensus_repeat	Method
TCGGCGTGGCAATTGCCAGCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053627_1

>merge|NZ_CP053627|1|1330165-1330265|CRISPRCasFinder
TCGGCGTGGCAATTGCCAGCACCACGCCGACGATGTCCTGATATGGACGATATTTCAAACCTTCCCAGTACGACACGATCGGCGTGGCAATTGCCAGCACC

>NZ_CP053627|1|1|1330165-1330265|CRISPRCasFinder
TCGGCGTGGCAATTGCCAGCACC	ACGCCGACGATGTCCTGATATGGACGATATTTCAAACCTTCCCAGTACGACACGA
TCGGCGTGGCAATTGCCAGCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053627.1\|WP_051482398.1\|1323971_1324190_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|313589
NZ_CP053627.1\|WP_038273089.1\|1325728_1326070_+\|DUF2523-domain-containing-protein	unknown	unknown	gnl\|CDD\|371214
NZ_CP053627.1\|WP_069636227.1\|1326069_1327218_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|283385
NZ_CP053627.1\|WP_038271296.1\|1333327_1334887_-\|phage-portal-protein	unknown	unknown	gnl\|CDD\|227798
NZ_CP053627.1\|WP_081755442.1\|1331075_1333331_-\|Clp-protease-ClpP	unknown	unknown	gnl\|CDD\|132927
NZ_CP053627.1\|WP_038271291.1\|1327222_1327534_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP053627.1\|WP_051482318.1\|1328135_1329008_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271177
NZ_CP053627.1\|WP_152536670.1\|1324657_1325725_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053627.1\|WP_038271298.1\|1335293_1335620_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|226183
NZ_CP053627.1\|WP_038271300.1\|1336170_1336449_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053627.1\|WP_051482319.1\|1329020_1329413_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053627.1\|WP_038271295.1\|1330638_1331013_-\|DUF2190-family-protein	unknown	unknown	gnl\|CDD\|227758
NZ_CP053627.1\|WP_038271299.1\|1335713_1336028_+\|addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|226162
NZ_CP053627.1\|WP_038271367.1\|1337125_1337377_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|198034
NZ_CP053627.1\|WP_038271294.1\|1330348_1330561_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053627.1\|WP_038271297.1\|1334883_1335099_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053627.1\|WP_038273092.1\|1323756_1323963_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053627.1\|WP_160165178.1\|1329599_1329758_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053627.1\|WP_038271302.1\|1337373_1337772_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350250
NZ_CP053627.1\|WP_038271292.1\|1327521_1327794_-\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|226420

Protein	Function_ID	Function_description	E-value
NZ_CP053627.1\|WP_051482398.1\|1323971_1324190_+\|hypothetical-protein	gnl\|CDD\|313589	pfam10389, CoatB, Bacteriophage coat protein B. CoatB is a single filamentous bacteriophage alpha helix of approximately 44 residues. It is likely to assemble into a complex of 35 monomers in a Catherine-wheel like formation. It is the major coat protein of the virion.	7.54883e-06
NZ_CP053627.1\|WP_038273089.1\|1325728_1326070_+\|DUF2523-domain-containing-protein	gnl\|CDD\|371214	pfam10734, DUF2523, Protein of unknown function (DUF2523). This is a family of phage related proteins whose function is uncharacterized.	2.71145e-05
NZ_CP053627.1\|WP_069636227.1\|1326069_1327218_+\|hypothetical-protein	gnl\|CDD\|283385	pfam05707, Zot, Zonular occludens toxin (Zot). This family consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophages present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers.	4.94578e-17
NZ_CP053627.1\|WP_038271302.1\|1337373_1337772_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350250	cd18683, PIN_VapC-like, Uncharacterized subfamily of the VapC (virulence-associated protein C)-like family of the PIN domain superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The PIN domain belongs to a large nuclease superfamily. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	1.22305e-41
NZ_CP053627.1\|WP_038271296.1\|1333327_1334887_-\|phage-portal-protein	gnl\|CDD\|227798	COG5511, COG5511, Bacteriophage capsid protein [General function prediction only].	0
NZ_CP053627.1\|WP_038271291.1\|1327222_1327534_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.79475e-10
NZ_CP053627.1\|WP_051482318.1\|1328135_1329008_+\|site-specific-integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	8.21385e-35
NZ_CP053627.1\|WP_038271295.1\|1330638_1331013_-\|DUF2190-family-protein	gnl\|CDD\|227758	COG5471, COG5471, Uncharacterized conserved protein [Function unknown].	4.60209e-18
NZ_CP053627.1\|WP_038271299.1\|1335713_1336028_+\|addiction-module-antidote-protein	gnl\|CDD\|226162	COG3636, COG3636, Predicted transcriptional regulator [Transcription].	2.32163e-35
NZ_CP053627.1\|WP_038271367.1\|1337125_1337377_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|198034	smart00966, SpoVT_AbrB, SpoVT / AbrB like domain. This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation. AbrB is thought to interact directly with the transcription initiation regions of genes under its control. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator. DNA-binding activity in this AbrB homologue requires hexamerisation. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins.	8.32036e-05
NZ_CP053627.1\|WP_038271298.1\|1335293_1335620_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|226183	COG3657, COG3657, Uncharacterized protein conserved in bacteria [Function unknown].	8.37589e-48
NZ_CP053627.1\|WP_081755442.1\|1331075_1333331_-\|Clp-protease-ClpP	gnl\|CDD\|132927	cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease. Clp protease (caseinolytic protease; ClpP; Peptidase S14) is a highly conserved serine protease present throughout in bacteria and eukaryota, but seems to be absent in archaea, mollicutes and some fungi. This subfamily only contains bacterial sequences. Clp proteases are involved in a number of cellular processes such as degradation of misfolded proteins, regulation of short-lived proteins and housekeeping removal of dysfunctional proteins. They are also implicated in the control of cell growth, targeting DNA-binding protein from starved cells. ClpP has also been linked to the tight regulation of virulence genes in the pathogens Listeria monocytogenes and Salmonella typhimurium. This enzyme belong to the family of ATP-dependent proteases; the functional Clp protease is comprised of two components: a proteolytic component and one of several regulatory ATPase components, both of which are required for effective levels of protease activity in the presence of ATP, although the proteolytic subunit alone does possess some catalytic activity. Active site consists of the triad Ser, His and Asp; some members have lost all of these active site residues and are therefore inactive, while others may have one or two large insertions. ClpP seems to prefer hydrophobic or non-polar residues at P1 or P1' positions in its substrate. The protease exists as a tetradecamer made up of two heptameric rings stacked back-to-back such that the catalytic triad of each subunit is located at the interface between three monomers, thus making oligomerization essential for function.	1.19645e-49
NZ_CP053627.1\|WP_038271292.1\|1327521_1327794_-\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|226420	COG3905, COG3905, Predicted transcriptional regulator [Transcription].	2.32516e-16

>NZ_CP053627.1|WP_160165178.1|1329599_1329758_-|hypothetical-protein
MSALNPCVLPAALLRWIGTSLGIFFVGMHHSAAQHVTPLVQAIQQHSKLRCH
>NZ_CP053627.1|WP_051482319.1|1329020_1329413_-|hypothetical-protein
MPTHEAFAAILQFATHRGRLKPHTAGSVPCYIAPLIYITYTCRLRGIEAITLTEANTTEHGILSNRRKRSRDNITRWTPSLRQAWKELLTHRAAVLNRNHLPQQLRPKDRHLVLAESGRPLTKSALDPAW
>NZ_CP053627.1|WP_051482318.1|1328135_1329008_+|site-specific-integrase
MFNYVWEQAATRWLVEKSYKATAHEDAAKLRWLAPHLARTLLIDIDGDFILRVAMLKANQTTPATANRYLALIRSILRRACDIWRWIDRCPAIALFPEPSKRVRWLTPAQVRSLLAELPLHQRDIVVFALATGLRQANVLKLHWHQVDIVRKVLRIPADQAKGRQAIRIPLSVHAVGVLQRQYGQHGDWVFTYRGQPIRGVNTRAWRHALQRAGIGDFRWHDLRHTWASWHAQAGTPLYVLQELGGWQSESMVRRYAHLTPSHFSGYAEAMLDSMQGKTLLIGNHFLSDR
>NZ_CP053627.1|WP_038271292.1|1327521_1327794_-|ribbon-helix-helix-protein,-CopG-family
MATSLKIDNTLKSRVEHLANQRRRSAHWIMLEAIQQYVEREEARDSFKQEALASWAAYKETNRHLTGQEVRTWLNTWGTKNERETPECHK
>NZ_CP053627.1|WP_038271291.1|1327222_1327534_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MPQVIVTEGAAEGLERCRQFLATKSSEAAKRASQAIEEQLLLLETAPDIGRPFHEMPEMRELIIAFGKSGYVALYRHESIDDAVYILAFRHQKEAGYHDHSPS
>NZ_CP053627.1|WP_069636227.1|1326069_1327218_+|hypothetical-protein
MPIHLLTGSPGHGKTALMVELLLAESKRAERPIFAAGIDGLQPGLASVLGDPRQWNAKDSQGDYLVAAGAIIFIDEAWKWFGHLHDASRQPTPPHVLDLAEHRHRGLDFVWTTQQTGQLYPFVRGLIGQHTHVKRRFGTGWIDVWTWGELIDNVKSSSSRERAQYVLRRLPSQAYGFYRSAQVHTIKARLPFKVFLLPGVVVVAIVCIVVSYRALRPASFSTVVTGAQERPTAELAKPGATASPRFVEGERGEGPRWQTVTAYAKDHLPRFASMPWTAPIYDHRSPTTDPQLICMSGGEGLDAQGVFKGLSCTCYTEQGTLYEIADGECRRIARRGPVYNPYREPSQEQGVVQQAHRPVLPMQRAGGEHVILATGHGQGVLP
>NZ_CP053627.1|WP_038273089.1|1325728_1326070_+|DUF2523-domain-containing-protein
MPMFVARLLTGLLGLLKTKLGYLVMVAFAWLGINWGSYHFVMTPVINQLYIYMDGVGSSGGDWGASAIDWLGVLNFDRAVSMIISAYVARFAVLSGRLYLFKRGFGGKPSGVA
>NZ_CP053627.1|WP_152536670.1|1324657_1325725_+|hypothetical-protein
MSFIRNGDDETSTESTTGEVCDTDRLEDVCKSKSGPQGNYVYFPAMHVCHPVQPPCPEGQRAEHGVCERIDACPHGTITDQHTQACVPEQEACPVGQVRAPDGSCVGDQDKDQCPPGQARGADGQCKADQDHDGIPDDEQDSDAKDKDKDKEKDKPSSFSGGERCDVPPRCSGDPVMCGQARIQWRIECNLRRDVKITGGACDTPPVCTGEKCNAMEYASLLLQWRTACALEKSRGGVVLGEGDDSSAANVAAIKEALTGSDGAVEGAEEGDASGVFSDESGYGREGYPNIKLDDKGRGYSRACPRSITVNVLGHPIVFDATPLCQWMQLGGKLVLLFAGLACLRIVGGRSDGAG
>NZ_CP053627.1|WP_051482398.1|1323971_1324190_+|hypothetical-protein
MLKRCLTVLRRPGVVGGLLAYGFVAPAFAAGIDVSEVLESIKAGLVPIAAIGAAVLSIHVAIKIYKWIRQSL
>NZ_CP053627.1|WP_038273092.1|1323756_1323963_+|hypothetical-protein
MTVAVLLVPACRGADVDIATGTCAAVMWVPQSSILPELTIEGAQFIGAGILGLWAVAYVFRLLRKLIK
>NZ_CP053627.1|WP_038271294.1|1330348_1330561_-|hypothetical-protein
MFGNHTMRYEMIITIGMAVAKSAVPVSVTVLTSDVIIEVATCLYILLQAAHLLWKWRVDWKKRKVKKGER
>NZ_CP053627.1|WP_038271295.1|1330638_1331013_-|DUF2190-family-protein
MANNYIKPGEHLTFTADVSITFGNPMLSGGVVLLGTLLGVALTTIADNTNGEAAVEGVWRLPKKNGQVINAWSKPIWSLSEAAFVNKDAAAGDLINSCIAVETAGASARTVKVKLLPGAGRVQT
>NZ_CP053627.1|WP_081755442.1|1331075_1333331_-|Clp-protease-ClpP
MTANTRPGGLPKAINALDASALEQSAPQARGPSVLALDTRHPDAAELLIYGPIGDTFWEEGITASSIAAQLSAITAPVINVRINSDGGVVSDGLAIFNALNTHPATVTITIDGVAASIASLIAQAGATRRVYRNSTMMIHGPRAGVCGFAEDLRNMAAGLDAIAAAMLTSYSARATQPDAIEQMLSDGGDHWFTAEQMISAGLADTIIDTDPSADALSDAAAAAALRSYIHAISTHPHPAVAAALRHRIQTTVTASAFAALHHTQQRAVMPHIQDTAMKEQLHVILAQAGPSAPTPSVNTPASDPAAETAANDAPMTALIARNTSIRDVFAAFAEVPGVRELEAACLADPRLSVAQAQARLLQRLPGGAMPLAVAPRSPPDGIHLVHDEHDTRRQRIAAGILARAGILTGHEAATARQDNPAAHQPLYILAEQSLIASGVNTRIMDRDQISRMALAQSTGDFPVILENVLHKTLLAAYRLQAYTWPRFCATGSLTDYRPHHRYHMGSFSDLRPVNEEGEYENGVLSDAAKETIQGVRKGRILQITPEVLVNDDLGAFSRPTTALGQAAARTIEKDVYALLALNNGLGPRMSDGNTLFHADHANIPTAAPPSIESIDAARQLMAQQMDVGSNDFIDIVPAIWLSALSLGSKARELNAQEYNDETDKQQRKPNVVRGLFTDVVDTPRLTGSAWYTFADPNIEPVIEVAFLNGVQPPTLEQDTNFRTDGLSWKVVHRYGVGAVGWRGATRNKGA
>NZ_CP053627.1|WP_038271296.1|1333327_1334887_-|phage-portal-protein
MSAAAPRLHRIVAAFDRALLQMAPAWAASRAQHRIKAVAYRQAYEAAEKTHLRQAAREFGSGNTIVTMNGSALRHQARHLDRNHDIISGGLSTLVQNIIGPNGINIIPTPRDAAGTLVESVVDQIMPLYQAWSKRPEVTWMHDWPSVQRLLARTWLRDGEAFVQEIRGFLPTLQHGSAIPFSIEMLEPDFVPLDYDDPSQNILQGVQRNAWGRATGYYVYKQNPGDAYVLIPEKKFVPADLIRHLRTIDRIGQVRGISLLASTFTRIEDLKDYEESERIAAKIAASMAAVIVKGDPTLYDAQTPGQQDRRMRLQAGMIFDDLRPGETVETIDSKRPNANLEPYRNSQLRAIAAPMRISFSSLSKNYNGTYSAQRQELVEQYGAYGVLAYEFISQMVRPVYERLIAMAVVSGELVLPRGVTLASAVGADYLPPSMPWIDPLKEINALTAQVQAGVRSLSSVIAERGGRMYDVLEQLSLDKQWAAARGLSLSVFQTPAAAPAPAADEPDAAEDAPPEDQTP
>NZ_CP053627.1|WP_038271297.1|1334883_1335099_-|hypothetical-protein
MSIATEHVALLQEAYRKVLAGQSVRLGERQVTRADAKWIGDELDKWMRRAAAESVTGTAGVAIADFSRGRP
>NZ_CP053627.1|WP_038271298.1|1335293_1335620_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MFEIKHYITDDGRDLFSEWYEQVKDNKVRIAIDRRLYSVELGNFGDHKPCREGVWELRIDLGSGHRIYYAQVGKTVILLLCGGIKRSQEADISKACESLKDWKRSNVK
>NZ_CP053627.1|WP_038271299.1|1335713_1336028_+|addiction-module-antidote-protein
MKDRLHDDAMADVFRKDPAYAVELLNSILEDGNQGELLIALRQMTKAFGGMSKVAEKAQLNGTHLYRTLSAKGNPEIHSLSAILKTMGMRLAVQPIHPWKADMQ
>NZ_CP053627.1|WP_038271300.1|1336170_1336449_-|hypothetical-protein
MSKESVFTMKLEPELRAEFMAEAASEDRPASQILRELMRSYIEQRRQAREYDDYLRSKVEQARDSMRAGRGRSNDEVEAKFAAQRARLATKA
>NZ_CP053627.1|WP_038271367.1|1337125_1337377_+|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MASLAVTAKGQITLKRDLLQHLGIKPGERIDFEKLPGGELRAKAARPTGTIDDFIGRHAGKVKKPMTIEEMNQIAAAGWTGEE
>NZ_CP053627.1|WP_038271302.1|1337373_1337772_+|type-II-toxin-antitoxin-system-VapC-family-toxin
MKISVDTNVLARAVLQDDANQGRSASTLLKDASLIAVSLPCLCELVWILSRGAKLSKEDVAVTLRDLLDAGNVVMNRPAVEAGLAILEAGGDFADGIMAYESAWLGGETFVSFDKKAVTLLSSQGKVAQLLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

598432 : 607327

Xylella_phage(50.0%)

integrase

attL 594494:594506|attR 604624:604636

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
594494:594506	attL	NA	NA	NA	NA
WP_038273275.1\|598432_599494_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	5.4e-103	58.1
WP_069636229.1\|599506_599743_-	DUF4224 domain-containing protein	A0A2H4JF29	uncultured_Caudovirales_phage	6.5e-09	53.6
WP_038273354.1\|599793_600330_-	pilin	NA	NA	NA	NA
WP_114867068.1\|600326_601712_-	DEAD/DEAH box helicase	C8CLF7	Xylella_phage	1.7e-234	84.1
WP_114867069.1\|601787_602093_+	DUF1640 domain-containing protein	NA	NA	NA	NA
WP_114867070.1\|602094_602367_-	VRR-NUC domain-containing protein	C8CLF9	Xylella_phage	4.4e-33	78.9
WP_081755417.1\|602693_603047_-	DUF2815 family protein	C8CLG2	Xylella_phage	4.5e-38	67.8
WP_038270871.1\|603043_604321_-	DUF2800 domain-containing protein	C8CLG3	Xylella_phage	4.9e-143	62.0
WP_038270872.1\|604317_604548_-	hypothetical protein	NA	NA	NA	NA
WP_152536598.1\|605370_605910_+	hypothetical protein	A0A2H4J154	uncultured_Caudovirales_phage	4.3e-24	46.9
604624:604636	attR	NA	NA	NA	NA
WP_114867072.1\|606208_607327_+	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	2.7e-68	38.6

DBSCAN-SWA_2

739103 : 748147

Xylella_phage(66.67%)

integrase,holin

attL 738341:738355|attR 751064:751078

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
738341:738355	attL	NA	NA	NA	NA
WP_038270998.1\|739103_740123_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	2.3e-159	82.3
WP_081755423.1\|740122_740371_-	DUF4224 domain-containing protein	C8CLF5	Xylella_phage	6.1e-26	69.5
WP_038273354.1\|740425_740962_-	pilin	NA	NA	NA	NA
WP_114867068.1\|740958_742344_-	DEAD/DEAH box helicase	C8CLF7	Xylella_phage	1.7e-234	84.1
WP_114867078.1\|742419_742704_+	DUF1640 domain-containing protein	NA	NA	NA	NA
WP_114867070.1\|742705_742978_-	VRR-NUC domain-containing protein	C8CLF9	Xylella_phage	4.4e-33	78.9
WP_114867079.1\|744131_744830_+	hypothetical protein	C8CLH7	Xylella_phage	5.0e-81	68.3
WP_038273333.1\|744890_745169_+	BrnT family toxin	NA	NA	NA	NA
WP_038273331.1\|745134_745446_+	BrnA antitoxin family protein	NA	NA	NA	NA
WP_114867080.1\|745666_746188_+	lysozyme	V5YSX1	Pseudomonas_phage	1.7e-30	50.3
WP_038272732.1\|746180_746507_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_038272730.1\|746496_746958_+	hypothetical protein	A0A0S0N8C8	Pseudomonas_phage	1.2e-09	33.1
WP_038272727.1\|746959_747175_+	hypothetical protein	NA	NA	NA	NA
WP_038272739.1\|747185_747923_+	site-specific DNA-methyltransferase	A0A097EWK8	Mycobacterium_phage	3.8e-63	52.1
WP_038272724.1\|747922_748147_+	hypothetical protein	C8CLI3	Xylella_phage	6.1e-25	71.6
751064:751078	attR	NA	NA	NA	NA

DBSCAN-SWA_3

898463 : 905594

Mycoplasma_phage(16.67%)

plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038270680.1\|898463_899324_+	sulfate ABC transporter permease subunit CysT	Q6GZ02	Mycoplasma_phage	7.2e-05	28.7
WP_051482278.1\|899335_900280_+	sulfate ABC transporter permease subunit CysW	NA	NA	NA	NA
WP_038270717.1\|900293_901340_+	sulfate/molybdate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.1e-27	33.2
WP_162814073.1\|902026_902623_-	phage late control D family protein	V5YTN9	Pseudomonas_phage	6.9e-31	58.9
WP_038270682.1\|903689_904583_-\|plate	baseplate J/gp47 family protein	R4JDM0	Burkholderia_phage	1.2e-71	49.8
WP_038270719.1\|904582_904921_-	GPW/gp25 family protein	A0A088FV58	Escherichia_phage	8.1e-29	57.7
WP_038270683.1\|905012_905291_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_081755408.1\|905294_905594_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	1.2e-15	49.4

DBSCAN-SWA_4

1254458 : 1261515

Xylella_phage(66.67%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160165226.1\|1254458_1255175_-	hypothetical protein	C8CLI5	Xylella_phage	5.2e-41	49.2
WP_114867106.1\|1255171_1256278_-\|terminase	PBSX family phage terminase large subunit	A0A088F6U9	Sulfitobacter_phage	1.1e-125	60.3
WP_114867107.1\|1256274_1256676_-	lysozyme	A0A1V0EFL1	unidentified_phage	2.8e-28	59.0
WP_038273322.1\|1256928_1257264_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_038273324.1\|1257260_1257515_-	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_114867108.1\|1257616_1258315_-	hypothetical protein	C8CLH7	Xylella_phage	2.9e-81	66.4
WP_114867070.1\|1259468_1259741_+	VRR-NUC domain-containing protein	C8CLF9	Xylella_phage	4.4e-33	78.9
WP_114867109.1\|1259742_1260093_-	DUF1640 domain-containing protein	NA	NA	NA	NA
WP_114867110.1\|1260168_1261515_+	DEAD/DEAH box helicase	C8CLF7	Xylella_phage	3.0e-215	79.6

DBSCAN-SWA_5

1312583 : 1319228

Stenotrophomonas_phage(16.67%)

portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_114867113.1\|1312583_1313054_+\|portal	phage portal protein	B7SYD6	Stenotrophomonas_phage	2.7e-22	49.6
WP_038272147.1\|1313280_1313898_+	glycoside hydrolase family 25 protein	A0A1U9WQS3	Geobacillus_phage	3.0e-21	32.7
WP_038272149.1\|1314836_1315037_+	hypothetical protein	C8CLH7	Xylella_phage	8.2e-13	69.0
WP_171898051.1\|1315452_1315752_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.9e-11	42.5
WP_038272150.1\|1316067_1316436_+	DUF4054 domain-containing protein	B5AX60	Iodobacteriophage	6.2e-06	31.4
WP_038272151.1\|1316483_1317050_-	pilin	NA	NA	NA	NA
WP_160199346.1\|1317097_1317553_-	hypothetical protein	NA	NA	NA	NA
WP_038272154.1\|1318715_1319228_+	hypothetical protein	G8CLC0	Synechococcus_phage	2.1e-12	37.3

DBSCAN-SWA_6

1322266 : 1333331

Stenotrophomonas_phage(44.44%)

integrase,protease

attL 1316263:1316278|attR 1332662:1332677

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1316263:1316278	attL	NA	NA	NA	NA
WP_038273097.1\|1322266_1323415_+	replication initiation factor domain-containing protein	S0F3F7	Stenotrophomonas_phage	5.1e-75	44.9
WP_038273093.1\|1323460_1323754_+	hypothetical protein	NA	NA	NA	NA
WP_038273092.1\|1323756_1323963_+	hypothetical protein	S0F2M5	Stenotrophomonas_phage	3.7e-16	66.7
WP_051482398.1\|1323971_1324190_+	hypothetical protein	A0A1W6DXZ2	Xanthomonas_phage	1.1e-05	51.0
WP_152536670.1\|1324657_1325725_+	hypothetical protein	A0A1W6DXV5	Xanthomonas_phage	4.5e-49	52.9
WP_038273089.1\|1325728_1326070_+	DUF2523 domain-containing protein	A0A1D6ZIU0	Xanthomonas_phage	7.9e-24	49.5
WP_069636227.1\|1326069_1327218_+	hypothetical protein	S0F3F8	Stenotrophomonas_phage	1.4e-128	59.1
WP_038271291.1\|1327222_1327534_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_038271292.1\|1327521_1327794_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_051482318.1\|1328135_1329008_+\|integrase	site-specific integrase	Q7Y5X7	Haemophilus_phage	2.6e-63	44.3
WP_051482319.1\|1329020_1329413_-	hypothetical protein	NA	NA	NA	NA
WP_160165178.1\|1329599_1329758_-	hypothetical protein	NA	NA	NA	NA
WP_081755441.1\|1329754_1330333_-	lysozyme	C8CLH9	Xylella_phage	2.1e-53	57.5
WP_038271294.1\|1330348_1330561_-	hypothetical protein	NA	NA	NA	NA
WP_038271295.1\|1330638_1331013_-	DUF2190 family protein	NA	NA	NA	NA
WP_081755442.1\|1331075_1333331_-\|protease	Clp protease ClpP	B7SYD7	Stenotrophomonas_phage	1.1e-81	43.5
1332662:1332677	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1463962 : 1471097

Stenotrophomonas_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069636227.1\|1463962_1465111_-	hypothetical protein	S0F3F8	Stenotrophomonas_phage	1.4e-128	59.1
WP_038273089.1\|1465110_1465452_-	DUF2523 domain-containing protein	A0A1D6ZIU0	Xanthomonas_phage	7.9e-24	49.5
WP_152536670.1\|1465455_1466523_-	hypothetical protein	A0A1W6DXV5	Xanthomonas_phage	4.5e-49	52.9
WP_051482398.1\|1466990_1467209_-	hypothetical protein	A0A1W6DXZ2	Xanthomonas_phage	1.1e-05	51.0
WP_038273092.1\|1467217_1467424_-	hypothetical protein	S0F2M5	Stenotrophomonas_phage	3.7e-16	66.7
WP_038273093.1\|1467426_1467720_-	hypothetical protein	NA	NA	NA	NA
WP_038273097.1\|1467765_1468914_-	replication initiation factor domain-containing protein	S0F3F7	Stenotrophomonas_phage	5.1e-75	44.9
WP_114867130.1\|1469344_1469527_-	hypothetical protein	NA	NA	NA	NA
WP_152536640.1\|1469557_1469818_-	hypothetical protein	NA	NA	NA	NA
WP_038271631.1\|1470428_1471097_-	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	5.3e-24	36.7

DBSCAN-SWA_8

1550261 : 1558815

Xylella_phage(28.57%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038272997.1\|1550261_1552790_-	ribonuclease R	Q0GXV6	Lactococcus_phage	6.0e-68	36.4
WP_081755492.1\|1553977_1554373_+	hypothetical protein	C8CLH5	Xylella_phage	7.8e-15	45.2
WP_114867133.1\|1554564_1555074_+	lysozyme	V5YSX1	Pseudomonas_phage	1.7e-30	48.8
WP_038272608.1\|1555066_1555393_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_038272606.1\|1555382_1555844_+	hypothetical protein	A0A0S0N8C8	Pseudomonas_phage	2.0e-09	32.3
WP_038272603.1\|1555845_1556061_+	hypothetical protein	NA	NA	NA	NA
WP_051482374.1\|1556065_1556599_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_038272601.1\|1556591_1557098_+	hypothetical protein	C8CLJ7	Xylella_phage	2.6e-23	71.2
WP_081755479.1\|1557505_1557928_+	hypothetical protein	NA	NA	NA	NA
WP_038272599.1\|1558137_1558440_+	type II toxin-antitoxin system HigB family toxin	A0A0P0ZE17	Stx2-converting_phage	2.3e-19	49.5
WP_038272597.1\|1558455_1558815_+	transcriptional regulator	A0A222YXG1	Escherichia_phage	3.5e-38	66.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage