CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP053985	Achromobacter pestifer strain FDAARGOS_790 chromosome, complete genome	5 crisprs	DinG,DEDDh,csa3,WYL,cas3	3	3	3	0
NZ_CP053984	Achromobacter pestifer strain FDAARGOS_790 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053985_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053985_1

291137-291267

Orphan

Consensus_repeat	Method
GGCGGCAATGGCAACGACATCCT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP053985_1

>merge|NZ_CP053985|1|291137-291267|CRISPRCasFinder
GGCGGCAATGGCAACGACATCCTCTACGGCCAAGGCGGCAACGACGAGCTGCAAGGCGGCTATGGCAACGACATCCTGTCGGGCGGCACAGGTAATGACTGTCTGGAAGGCGACGCTGGCAGTGATGTCCT

>NZ_CP053985|1|1|291137-291267|CRISPRCasFinder
GGCGGCAATGGCAACGACATCCT	CTACGGCCAAGGCGGCAACGACGAGCTGCAA
GGCGGCTATGGCAACGACATCCT	GTCGGGCGGCACAGGTAATGACTGTCTGGAA
GGCGACGCTGGCAGTGATGTCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053985.1\|WP_173142925.1\|295434_296505_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|235438
NZ_CP053985.1\|WP_173142914.1\|261399_262890_+\|TolC-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|273829
NZ_CP053985.1\|WP_173142924.1\|294557_295397_-\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320690
NZ_CP053985.1\|WP_173142913.1\|259468_260872_-\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|235490
NZ_CP053985.1\|WP_173149912.1\|296541_297867_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NZ_CP053985.1\|WP_173142915.1\|262914_263127_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053985.1\|WP_173142912.1\|258792_259443_-\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314
NZ_CP053985.1\|WP_173142916.1\|263101_265276_+\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|274550
NZ_CP053985.1\|WP_173142917.1\|265283_266705_+\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP053985.1\|WP_173142919.1\|267449_284282_+\|retention-module-containing-protein	unknown	unknown	gnl\|CDD\|333740
NZ_CP053985.1\|WP_173142920.1\|284443_287683_+\|retention-module-containing-protein	unknown	unknown	gnl\|CDD\|375409
NZ_CP053985.1\|WP_173142927.1\|301963_302683_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP053985.1\|WP_173142918.1\|266712_267366_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP053985.1\|WP_173142928.1\|302897_304385_-\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP053985.1\|WP_173142929.1\|304381_304753_-\|DUF2069-domain-containing-protein	unknown	unknown	gnl\|CDD\|378269
NZ_CP053985.1\|WP_173149914.1\|300415_301948_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP053985.1\|WP_173142923.1\|292496_294455_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|379843
NZ_CP053985.1\|WP_173142911.1\|257680_258757_-\|3-isopropylmalate-dehydrogenase	unknown	unknown	gnl\|CDD\|234832
NZ_CP053985.1\|WP_173142926.1\|298433_300407_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP053985.1\|WP_173142922.1\|291795_292479_+\|transglutaminase-like-cysteine-peptidase	unknown	unknown	gnl\|CDD\|226198

Protein	Function_ID	Function_description	E-value
NZ_CP053985.1\|WP_173142925.1\|295434_296505_-\|chorismate-synthase	gnl\|CDD\|235438	PRK05382, PRK05382, chorismate synthase; Validated.	0
NZ_CP053985.1\|WP_173142914.1\|261399_262890_+\|TolC-family-outer-membrane-protein	gnl\|CDD\|273829	TIGR01844, Proteases_secretion_protein_PrtF, type I secretion outer membrane protein, TolC family. Members of this model are outer membrane proteins from the TolC subfamily within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT subfamily, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (E. coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa). [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Porins].	1.40079e-77
NZ_CP053985.1\|WP_173142924.1\|294557_295397_-\|M48-family-metallopeptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	2.02351e-86
NZ_CP053985.1\|WP_173142913.1\|259468_260872_-\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|235490	PRK05478, PRK05478, 3-isopropylmalate dehydratase large subunit.	0
NZ_CP053985.1\|WP_173149912.1\|296541_297867_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	3.70983e-101
NZ_CP053985.1\|WP_173142927.1\|301963_302683_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.9279e-42
NZ_CP053985.1\|WP_173142912.1\|258792_259443_-\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	4.2567e-136
NZ_CP053985.1\|WP_173142916.1\|263101_265276_+\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|274550	TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0
NZ_CP053985.1\|WP_173142917.1\|265283_266705_+\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	2.10851e-114
NZ_CP053985.1\|WP_173142919.1\|267449_284282_+\|retention-module-containing-protein	gnl\|CDD\|333740	NF012211, tand_rpt_95, tandem-95 repeat protein. This 95-amino acid repeat occurs in tandem in proteins that may be several thousand amino acids long.	3.68003e-13
NZ_CP053985.1\|WP_173142920.1\|284443_287683_+\|retention-module-containing-protein	gnl\|CDD\|375409	pfam17892, Cadherin_5, Cadherin-like domain.	1.34928e-13
NZ_CP053985.1\|WP_173142918.1\|266712_267366_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	3.71575e-25
NZ_CP053985.1\|WP_173142928.1\|302897_304385_-\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP053985.1\|WP_173142929.1\|304381_304753_-\|DUF2069-domain-containing-protein	gnl\|CDD\|378269	pfam09842, DUF2069, Predicted membrane protein (DUF2069). This domain, found in various prokaryotes, has no known function.	1.79577e-33
NZ_CP053985.1\|WP_173149914.1\|300415_301948_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	5.42833e-38
NZ_CP053985.1\|WP_173142922.1\|291795_292479_+\|transglutaminase-like-cysteine-peptidase	gnl\|CDD\|226198	COG3672, COG3672, Predicted transglutaminase-like cysteine proteinase [General function prediction only].	6.35216e-27
NZ_CP053985.1\|WP_173142911.1\|257680_258757_-\|3-isopropylmalate-dehydrogenase	gnl\|CDD\|234832	PRK00772, PRK00772, 3-isopropylmalate dehydrogenase; Provisional.	0
NZ_CP053985.1\|WP_173142926.1\|298433_300407_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.60491e-27
NZ_CP053985.1\|WP_173142923.1\|292496_294455_+\|EAL-domain-containing-protein	gnl\|CDD\|379843	pfam16448, LapD_MoxY_N, LapD/MoxY periplasmic domain. This domain is the N-terminal periplasmic domain of the LapD and MoxY receptor proteins.	1.51931e-40

>NZ_CP053985.1|WP_173142920.1|284443_287683_+|retention-module-containing-protein
MANTSPAIVNEISGRAWLRHGDGSLTELHQGSKIPVGSDVVTASGSTVSLQIENGMPIIIGESREVALTAEMTGTLDDSSEAAVAPPMGTDSERLLAVLRDGHDLSDELDPTAAAMAGGGGAGGSSFVRLARLLETTNPLDLSYSNPNRGDDDLPRMSSTGSVSDDEEAPTPLSVNNAPGARDDAGHGDQNSLVRGNLLANDADPDGDPLAITSVGGRAMTSDGVTVAGSNGGTFTVLPDGSYVFTPGNAFERLAAGETAVSTISYTIMDPSGATSTATAVVTITGTNDGPVSIAISDTSSLDAQTHVSYDISGRFSDPDASDKLIYTATGLPPGLSIDPHTGIITGDIDPSASQGGSLGVYNITITATDPSGATTSQKFDWAIANPAPIAVGDSGAASDDSALDVSAQDGVLANDRDPDGDGLTVSQVNGNAANVGAAIAGSHGGTFTLNADGSYSFDPGSAFQYLGAGEKIYSSITYTVSDGEGGTSTATLTVEITGTNQTPVILPHADQVLEDHSASGNVLSGAADADNDALSVVTYTVDGAKYLAGNTAYIAGVGSILINADGSYTFTPDADWNGAVPQVTYTVTDGSVTTSSTLDIGVLSVNEAPLSRDNPDNAVAGDRYVFGLNDFPFSDPQEGHSLKSVIIDSLPSLGTLLLNGEAIAPGREISLEDLANGKLTFQPDGQNFRRSDGSSFEFRVKDTGGTANGGQDTSHQQTFKLSTGELIAGNNYFGDNSTPDNNIYYWMGGNGNDVILGDKGGVLGIPPPEPHSLSGLFLPDPSELEVHAKSSLDHVLAPLSNDELFGRGGSDILFGDAINTDFLPWGVDGNPARPEGLLDGSGLWALKEFLLLKNGVPPTDADLYRFISNNHDMLDVHGDTRGGQDFLAGNEGDDILYGQGGNDELSGGRGQDILSGGTGNDILEGNGGSDVLIGGMGNDIVIGDGFDFYRRDGSGYSVDSDTFKWEFNDQGTITAPAVDTIRDFSILKPVEDGDILDLQELLVGESDSTLTKYLDFRKEGYNTVIDVNTQGKLGTQGADQKIVLENVDLTHDAYGQFMNNQAIINDLLQKGKLNVDHS
>NZ_CP053985.1|WP_173142919.1|267449_284282_+|retention-module-containing-protein
MANSSPAIVTEITGRAWIRNSDGSLTELHEGSKVPAGSDVVTASGATVALQVENGMPLMIGENREVALNGDAAGPLADPSEASVAPPTGTDSERLLAALQAGRDPFDELDPTAAVVAGGGDNGGSSFVRLARILEVTTPLDLAYPNPARGNDVLPRLSGAGAGSDEDTGTGAVNTPPQARDDAAGGLQDALVRGNMLTNDSDPDGDPLALVSVNGRPMGSGGLTVPGSNGGVFTIAPDGSYVFDPRGEYKSLGEGQTATSTVSYTITDPSGATSTATLTVTITGTNDLPVAPNYQHTTPEDQPVSGKVTGTDPDGDTLTYTVDKQPEHGKLEFNPTTGEYTYTPNENYNGPDQFTVIVDDGHGGKTTSVIEIGVTPVNDAPLVPNYEHTTPEEQPVSGKVVGTDVDGDNLTYTVEKQPENGTLVFNPTTGEYTYTPNENYNGPDQFTVIVDDGKGGKATSTINIGVTPVLDVPTITVSDAGDVNEGSSATFNISLQNTVDLDKDTTVTLKLDGQIETADHGAPTVTIGGQTVQVTANADGTYSFTLPAGTTGGIVVTVPTNDDAVFEGREQMTLTATLTGETSSGTLPSGISDSGNAVIVDTESTDPGNPNPGADVPTLDVSNPGDVNEGSDATFNITLGKAVDAETTITFKLGGEIGADDIGAPVVTIGGTTVNLVNNGNGTYSFQVPAGTTGGIVVTVPTTDDAVFEGRESLTLEATLSGKSASGIDLPAGITDTGNAVIVDDHGTGADVPKLDVSNPGDVNEGTDATFNISLDKAVDAETTITFKFGGEIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNDDAVFEGRESLTLEATLSGKSASGVDLPSGITDTGTAVIVDTESTDPGNPNPGADVPTLDVSNPGDVNEGTDATFNITLDKAVDAETTITFKFGGDIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNDDAVFEGRESLTLEATLSGKTASGADLPSGITDTGTAVIVDTESTDPGNPNPGADVPTLDVSNPGDVNEGTDATFNITLDKAVDAETTITFKFGGDIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNDDAVFEGRESLTLEATLSGKSASGIDLPAGITDTGTAVIVDDHGTGADVPKLDVSNPGDVNEGTDATFNITLDKAVDAETTITFKFGGDIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNDDAVFEGRESLTLEATLSGKSASGIDLPAGITDTGTAVIVDDHGTGADVPKLDVSNPGDVNEGTDATFNITLDKAVDAETTITFKFGGDIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNDDAVFEGRESLTLEATLSGKSASGIDLPAGITDTGTAVIVDDHGTGADVPKLDVSNPGDVNEGTDATFNITLDKAVDAETTITFKFGGDIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNDDAVFEGRESLTLEATLSGKSASGIDLPAGITDTGTAVIVDDHGTGADVPKLDVSNPGDVNEGTDATFNITLDKAVDAETTITFKFGGDIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTTDDAVFEGRESLTLEATLSGKSASGIDLPAGITDTGTAVIVDDHGTGADVPKLDVSNPGDVNEGTDATFNITLDKAVDAETMITFKFGGDIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNDDAVFEGRESLTLEATLSGKSASGIDLPAGITDTGTAVIVDDHGTGADVPKLDVSNPGDVNEGTDATFNITLDKAVDAETTITFKFGGDIEGDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNDDAIFEGRENLTLEATLSGKSASGIDLPAGITDTGTAVIVDDHGTGADVPTLNVDDAGTVNEGSDAVFNVSLGKAVDADTTLTFKLGGEIEASDIGTVKVTIGGQTATITSNPDGSFSVTVPAGTTGGIVVTVPTAADGVFEGSEKLTLTGTLTGASASGIALPGGITDIGNAAIVDILGPGGDAPTLDVSDPGNVNEGSDAVFNVTLGKPVNAETTITFKLGGDIESDDIGAPVVTIGGNPVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDAETTITFKLGGDIESDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTAGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDAETTITFKLGGDIESDDIGAPVVTIGGTTVTLVNNGNGTYSFQVPAGTAGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDAETTITFKLGGDIESDDIGAPVVTIGGNPVTLVNNGNGTYSFQVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGQPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGQPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGNPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGNPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGNPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGKTASGVDLPAGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGQPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLQATLTGTTASGTALPPGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGQPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGTTASGTALPPGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGNPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGTTASGTALPPGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGQPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGTTASGTALPPGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGNPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLEATLTGTTASGTALPPGITDTGNAAIVDTQGPGADVPTLDVSDPGNVNEGSDAVFNVTLGKAVDANTTLTFKLGGEIEANDIGTVKVTIGGNPVTVTANADGTFSVTVPAGTTGGIVVTVPTNNDAVFEGSEKLTLQATLTGTTASGTALPPGITDTGNAAIVDTQGPGADVPKLDVKDAGDVIEGNAANFNVSLDKAVDAETTLTFKLGGEITAADHGVPTVSIGGQSVTVTANADGTYSFKVPAGTTGGIVVTVPTTPDGVYEGRESMTLTATLTGATASGTALPPGITDSGNAAIVDINKPPVVGGGNTAVSEEGLAGGIKDSNGTSDTTDSPQANGQLSITDDNNAAYNITLVAPANGALTSHGTPIVWTLSDNGHTLTGRAGGTDAIVIKIDDNGAYNVKLLAPVDHPDTSREDTLGLSIGVKVSDGVNPTVSTNINITIEDDSPVVQPNAPVSVQTTNIPDVYTGKVSFAGTQTSDSQMKMTFGNGAIEVTAKGFTSKSDVTLIDAMVNQSKSGLGVASTDAPYHNIANEIDYRKTSDGKGASEELTIHLTGGKVAYGATIDFGAMYGGELESGVAKFYRNGVLIAERTFTSDQNGGDYAANFRVEEGGFDTIVISATDNHKNSSSDNSDFTVTGITFLGSDSVQAIAYGEGTLNYGYGADGAGRLELTGAEGGLKTRDGANITVKLSNGNLIEGRDPSGNLVFEMRLTPATGKWEFYQYQPMQGTADGKLDFTYKVTDADGDYTNGHFEVAGVEPPGPSLSIDDYNLDAPGAISVSEALASNGGTFTITAGAGLKSLTLDGPGNADATLTLDRLADLANNPLTLPTSKGTLTLTGYDPSTGKVSYTYQSSGQQSHTGDDTNVQDHFQITVEDKFGGKATGDLGVLITDTAPSLKPIAESSALSSHGTNIMLTLDTSGSMNYGSGVYNGWTQLSRLAVLKSSVNNLLDKYGEAGDVRVMIVEFNTSASQKGGGWMSLAEAKALVSGLGYGGGTNYQTALDTAMNAWNNSGTGKLEGGNVQNISYFFTDGEPDSNRSVSSTQQTTWEKFLTDNHINSYGIGLGTGATGGYIDPISYNPDRPADSNTILVKDLNGLDTAIEGTIAPPIIGDIAAGGTLGADLSGARITQLVIEGKTYSYNVATNKVTATSGATYSFDAATSELTVTTAHGKFTLDLAGDNLGDYRYVPKTAGTDTIQFTVQDGDGDTASSSITVNVTAPVYQAPDAVNDKIITNIMGTQLTVQSGSLLANDVRGTGALTMGPLTVNTGWDQGKDFTRSTLKTYEITGKNTKELSIARSEFTKTGAGTDKAQLVVKGYLDKVGANNGNDQDTLFIALIAGEVLTLDHNFTNPNWIRMEYRLAGSTGPYTVVADGGTIPVTQSGNYEIHIVNIPDNGNGTGSTAEENYTLTMKVDYSNVTLDVATANSSYTIQTADGHSDTANVSVSYQSGNHLAGTNDSEILLAGNGNDTLDGGKGNDVLIGGKGHDVLTGGEGSDTFRWELNDQGTIANPAVDRITDFSMDKPADGGDILDLKDLLVGEKDGNLSQYLNFTEDPANANNTLVEINTQGKLGTQGADQKIVLENVDLTHNGQMDNQAIINDLLQKGKLNVDHS
>NZ_CP053985.1|WP_173142918.1|266712_267366_+|response-regulator-transcription-factor
MKPTPVLLITHDDLLWQQWRNLDTQRWLPARGRSLADLTRWREQGRTLAVLDCDLPRLPSWQDPIWAATLAGLDVVVASPSPNDEQGTQILGAGAHGYCHAYAPPKALSQALEVVATGGIWMGRSLVSRLLKLVEERSQPIAGWSRSLTEREEVVARRAASGQANAQIASALGITERTVKAHLSAVFEKLSVSDRLQLALLVHGISVPDETRSKIPS
>NZ_CP053985.1|WP_173142917.1|265283_266705_+|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit
MNMTSGEAQPTLFGKLWRKVRGIFVFFFDKLLDGTEKGKPKKRSDYVGNAEWVIHESQARGSRILLWVSLLAVALLLVWAATGSIDEVVRGEGKVVPSRQVQIIQSLDGGIVQEILVRPGQEVESGQILLKIDSTRFASSLGENNAEYLSLLAKSARLKALATGEPFVAPEEVLQQAPGLVEMERNAWQARTTELNATINVAREQLKQRQEDLRETIAKRDQAAASCSLTSRELQVTRPLLKSGAVSEVDLLRLQRDVARYCGEQKGAEAQIDRFQASIKEAESKVQESELNIRNLARNELSETNTKLATLREGKAALVDRVKLAEVRAPVRGTVKTLFNNTVGGVVQPGKDIIEIVPTDDTLLLEVRVLPKDIGFLHAKQKAEVKFTAYDFSIYGGLEGEIEQIGADTVTDDKGNSYYVVRVRTNRSTVGDKQLPIIPGMVAEVHILTGKRTVLQYLLKPVLRAKANAFTER
>NZ_CP053985.1|WP_173142916.1|263101_265276_+|type-I-secretion-system-permease/ATPase
MTKMDKLSETAAREWRADARAAHDDPLLDCLVEITRLHGVTATSQALSAGLPLEKHRLTPALLPRAAARAQLSARVVKRKLEDIPQDLLPAILLLRGERACLLLSTDGDKYLISHPELGGSSVEMTAEALAEQYTGLVCFVRPQFRFDARAPEVAKVRERHWFWAAIMENRRMYRDALIAALLINIFAMAMPLFTMNVYDRVVPNNAIETLWVLAIGIALVIIFNMILSTARSHVVDSASKRVDVRLSAQIMERVLDLRLEGRPVSVGSFAANLRSFESIRDFIASATITTLVDLPFILLFLAALVWISPWMILPPLVAIVIILLVSLAAQARMESLTMSSYQASSQRNATLVEALTGLEAVKTLNAQGSIQRNWERATEYIAQTGGKLKLISSSAVGIVQTAQQLVSIAVVIIGVYQVQESAMSMGGIIAASMIAGRCLAPLGQVAGLLMQYQNARTSLASIDNYMKLPVERPPEAEFLHRPVFHGAIEFRDVTFAYPGTSQPVLKKISFKLNPGEKVGIIGRIGSGKTTLEKLALALYQPTEGAVLLDGVDVRQIDPTDVRRAIGHVPQDPTLFYGSLKHNLAMGAPHADDASILAAANLAGVTEFANLHPDGFDMVIGERGESLSGGQRQSVAVARALINDPPILLLDEPSSNMDHQSEAQLRKRLGEASANKTILLVTHRTALLELVDRLIVIDNGHIVADGPKEQVVEALRQGRVGRGS
>NZ_CP053985.1|WP_173142915.1|262914_263127_+|hypothetical-protein
MQKQGNDFSQLDADFVRVLEDLIDALIANGTLRMTDLPVQAQQKLSQRKQQRARLSEHLDLLDDEDGQVI
>NZ_CP053985.1|WP_173142914.1|261399_262890_+|TolC-family-outer-membrane-protein
MASFLLKSTTSVLALAFVPAAFAQSAAPGSGAAGVTLNQVVEQTLLSNPEIQAKYHDFQASLEGQAVARGAFFPQINAQGYVGREYRNNVPGVGSQQWSRPGYTVELRQLIFDGFRTSNDVKQAGFDKLARFYDLLATSDNTAFTAVQAYIDLQRYRDMELLARQNYTLHEETLKQIGERADSGVGRRVDLEQAGGRLALAQTNLMTETANLLDVQQRFQRVTGALPPEGMQPAPDITGKLPVKPADFNESLRRNPSFLSKQAGLQAAQAGVASSKGAFSPKFEFVASTGRDQNDPTPQNRDIQSSNVQVVMSYNLYRGGSDSARVRQTSAQSYAARDIRDYTCRNVQQDLAVAWNNVASLSQKLPFLRDHEVATTKVREAYRQQFQIGQRSLLDLLDTENELFESRRALTNALYDLQLAQYRWLALSHALLPALSLQPARNEMPEENGKLEVSDEVIKLCNSTIPDSARLAPVRVQYNEGNLPPTFIPVNSKAKP
>NZ_CP053985.1|WP_173142913.1|259468_260872_-|3-isopropylmalate-dehydratase-large-subunit
MAQTLYDKLWDAHVVHQESDGTCLLYIDRHLVHEVTSPQAFEGLAIAGRKPWRTGANLAVADHNVPTLNRAQGIDDPISRLQVDTLDANCDKYGITEFRMNDLRQGIVHVIGPEQGATLPGMTVVCGDSHTSTHGALGALAFGIGTSEVEHVLATQTLLMKKAKSMLIKVEGELPFGCTAKDVVLHIIGIIGTAGGTGYAIEFAGSTIRALSVEGRMTVCNMAIEAGARSGMVAVDDKTIEYFRGRPFAPTGVLWEQAAGYWRTLHTDEGAKFDAVVEVNARDIKPQVTWGTSPEMVLPVDSRVPDPDREKDDVRRSGMERALQYMGLKPNTPLTDIRVDRVFIGSCTNSRIEDLRAAAAVARGKHVASNVRQAMVVPGSGLVKQQAEREGLDKIFIEAGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFEGRQGQGGRTHLVSPAMAAAAAVAGHFVDVRTFR
>NZ_CP053985.1|WP_173142912.1|258792_259443_-|3-isopropylmalate-dehydratase-small-subunit
MQAFTTHEGLVAPLDRENVDTDLIIPKQFLKSIKRTGFGPNLFDELRYLDHGEPGMDNSKRPLNPDFVLNQPRYQGASVLLARKNFGCGSSREHAPWALTQFGFRAIIAPSYADIFFNNSFKNGLLPIVLSELEVSRLFDEVKAFPSYKLRVDLERQVVVAADGREMGFDIEPFRKYCLFNGFDDIGLTLRQSDKIRAFEAERLARHPWLESRPIA
>NZ_CP053985.1|WP_173142911.1|257680_258757_-|3-isopropylmalate-dehydrogenase
MTHNIAVLPGDGIGPEIVEQAVRVLKALDVSFEIKQAPVGGAAFDAFEHPLPPATLNLAKESDAVLFGAVGDWKYDSLPREFRPEQAILGLRKALGLFANLRPAILYPELASASSLKPEIVSGLDILIIRELTGDIYFGTPRGVRSSPDGAFTGEREGYDTMRYAESEVRRIARIGFESARKRGKKLCSVDKANVLETSQFWRDIVIEIAREYPDVELSHMYVDNAAMQLVRNPRQFDVIVTGNLFGDILSDEAAMLTGSIGMLPSASLNAGGQGLYEPSHGSAPDIAGQGIANPLATILSAAMLLRYSLNLAPQADRIEAAVRRVLADGLRTADIFEPGTTKVGTAQMGDAVLKALA
>NZ_CP053985.1|WP_173142922.1|291795_292479_+|transglutaminase-like-cysteine-peptidase
MPSSRRFRRTLNLCRLALLCLACGWGGSSALEVNADRLQSLSASRYGAKGSKAVSEWLQLMRNPAPAQERGALTQANDFWNRSLMSGEDITIWKQADYWATPLESLGRGAGDCEDYVIGKYFTLLALGVPANKLRFIYVRARIGGAASSTQIAHMVLGYYETPNAVPLVLDNLISTILPATQRRDLTPVFSFNADGVYVDGKPAAPVDRLSRWRDLLQRMEREGVRP
>NZ_CP053985.1|WP_173142923.1|292496_294455_+|EAL-domain-containing-protein
MSILRQLLLSVTLAIGVILLGTLALSVNTAREYLSGQLQVQSTDAAVSLALSLSQPANNDPVVQELLVSALYDGGHFSLVRLSDPEGKVLIERKSTATAASVPAWFQALAPLTTQSASHAVSDGWRQIGEVTLIANDAYAWEALWRSSLKMIALVVGAGILWAVFAFMLVGWIKNRLLREISDHVRSIGQESPTAQVEARVPELSGVVQALNQTRERIHASVEEQNAKIESLELELNQDPVTGLPNRKYFVNEFRRALETPTVTTGRGIDGGHVLVFRQRDLADLNRHMPREFIDQWLRTVCERIRGTLKSMHVASPLLARLNGSDFALLLPGCAAPQAMMVAEQVRADLHASRIPVGEGHLCRWAQAMTDYGHGSQAGPVLARLDFGLMRAESAGNDQVVIAGATDMQSPSESGERAWKDAIQSALEEHRFELATENLQATDGSTVRTEAMLMLRTAADQVPIPATLFIPPAVRLDLVADCDLEAVSLGLDWLAANPGELAVRVALPSLRGQKFFRQLALLLTEHRPLARRLYLEIDAHGLVECHEQIATLARVASEFGAHIGVRRLAQQFGAIAQLHTLPLSYVKLGGGFVGGMSQSPGSQQLTASVLETARGLKIAVYAEDVPDAETQRILAKLGIGIMRGPGVRTAAA
>NZ_CP053985.1|WP_173142924.1|294557_295397_-|M48-family-metallopeptidase
MNRKRHLLRNAGAALALAALAGCTGMNTTQSGAIGVNRTQYMSSMVPSQALEQEATQQYADILKQAQAKGLLDRDAQQVARVRAISQRLIAQAGVFRPDAASWKWEVHVLSSNEINAWCMPGGKIAVYTGLLAKIKPSDDELAAVLGHEISHALREHARERVSQQMATNLGLSVLAIATGSSAASDLGEQFTSVMFTLPNSRTHETEADRMGVELAARAGYDPRAAVTLWQKMGAADQGSAPPEILSTHPSAASRISDLQAAAQQVLPLYEQSKGKASR
>NZ_CP053985.1|WP_173142925.1|295434_296505_-|chorismate-synthase
MPGNTLGTLFTVTNFGESHGPAIGCIVDGCPPGLPLDVSDIQLELDRRRPGTSRHVTQRQEADQVEILSGVYEGVTTGTPIGLLIRNTDARSKDYSNIADTFRPGHADYAYWRKFGVRDPRGGGRSSARLTAPTVAAGAIAKKWLAEQYGVKVRGYMSQLGPVAIPFVSWDDVPNNPFYAPNAAVVPELEAYMDQLRRDGDSVGARIEVVAENLPAGWGEPIYDRLDADIAHVMMGLNAVKGVSIGAGFDSIAQRGSEHGDEITPDGFLTNNAGGVLGGISTGQPVTVSLAIKPTSSIRVERRSVNRANDPVMVQTLGRHDPCVGIRATPIAEAMLALVLIDHALRHRGQCGDPAV
>NZ_CP053985.1|WP_173149912.1|296541_297867_-|bifunctional-diguanylate-cyclase/phosphodiesterase
MCWVFVRRERLLRQRLTRDELTGVLSQQELHRRVRAWLNQAEGHSRRGAFFLVSFEQYAEISAMLRAGEDQALLVQVANRLGLICRSMGGMVARTGADAFTVCAPDVDEAGAAQVSAKLLEALSAPYELGGRPLMAMFRVGAALYPEHGRSVEELQRCVQVALLPLKERGGPGWNLFDFRMLARQRDQQGLENDLRLALTTPAMEQFELYYQPVCDSGTGMVQGCEALLRWHHPVLGSVSPAVTIELAERSGLIVPLGAWILERACTQAALWPATWRVHVNLSVKQMNEDGLVELVSNALAVANLAPRKLVLEITESLFILHYERHVKILNTLRAMGIGVALDDFGCGYSSLNHLRCLPIDWVKIDRSFISALESDAGSREVVSALFGLCQAMHLPVVAEGVETEGQREILKSLGCRVMQGFLLGRPAPASEIQALASAVS
>NZ_CP053985.1|WP_173142926.1|298433_300407_+|EAL-domain-containing-protein
MSTFRRLLFFTALLIGLVLLGAQAVGMLAAHRYLTSQLAQRSDDGANALAWALSHAAGGPSELAALADELYAQGGYALVRITTENGIPAIERRTQHTDLQPREHDWRDTWLNMEAPAVSRPYTAPDGSSRGAVTVQADSRTARDTLWQGGVRVLGLVLAAGLLWILFSLNLARRIEARTSRDICERVRALAPGNRKTLNGTCELAGVDQALVDAQRMVAATVQEQNARIESLQSEIYKDPITRLHNRKYFVDQFRQALADKDPEAGGHLLMFRQRDLAQINRHLSRAFTDQWLRSSSDRLRKLVAEFGGPAAMLARISGSDFALLLPRTSAPQASLLAERVRRELRSLRVPMDKHESCRWALALASYAPGDGMSDTLARLDHALMCAESADDDQIAPASRAPDSTRIGEYSWHDALVTALEQHRFSLSVQPLHDLSGALLHQEASLTLHDTSGADPVPASIFMPPAVRLGLSAECDIQAIRLGLDWLFARPGALAVAISLASIAQPSFQSRLQRMLADRPALSARLIVEIDAAALAVQGADLHPLCDIIVAAGARVGVSRLSYQFGAIEHLHEFPLSYLKLCGGFITGLLHSPGSQHLAATAVATASALDIAVYAEDVPDIATQNVLAGLGVHAMRGPVVNSAQTHDLAPDHPWVSS
>NZ_CP053985.1|WP_173149914.1|300415_301948_+|HAMP-domain-containing-histidine-kinase
MLLRICWLLRVRRPLHPRRTGDASAVRQTMLPRLGLLLCALLGPGAALAYSPGASYEDLHLGLTAGVATACGVACAVAWAATRNAIYGAGLAFMLLEGVFRSMPTLLPPASLQAGSYAALLALTTPILAAACATKLATACRWASAALAIVSILALIIAYDPGNGIASATIAGACAIASLPLAIWFLIRAAGRTPARAASLALAGAYSVSAWLLGHDAWLPQSGAGAIVELARLLLVSSALTLLATDQHGRPQQGSKSAGHEHTDAEHLAQGELRLAELAGALDTQRQMNALISHELRAPLATVSAAAQSLDMILAESGEAVDNRLARIHRSVTRMTELMDQLLSQDRLGEQAWTPRGEQTDMADLVRDVVTAMQPDTAHALMLQAGASLPVYCDRPLTSVVVRNLIHNAIKYSPANEPVRIETGETRVGAIPMAWVAVTDRGPGIGVEEQTRIFEPHFRRSAHRETQGMGIGLYLARRICQNQGGSLTMESEVGVGTRFVVTLPASAPAA
>NZ_CP053985.1|WP_173142927.1|301963_302683_-|response-regulator-transcription-factor
MAGADGLLCIGLLEDDADFREELALGLGGYGFRVAFACDNAAAFYRRLQEQPCDIVILDAHLPGEDGFSVATRLRALSPVGIVMLTGRSALEDRVRGLEGGADVYMTKPVDLLELSSVIRSLARRMRLAKAPRPVDAETRAAADTSWSLQDGGWILVAPDGASLHLSAQERTFLVALMDAAGSAVSRQVLAELFLPDSPGGFELRRIDVLVSRLRAKAQSAGLKLPVLSVRGQGYVFAA
>NZ_CP053985.1|WP_173142928.1|302897_304385_-|YdiU-family-protein
MSAHTLRDLRVVNSFAALPGAFYTRLAPQALNNPRLLHGNAEAAELIGLDPSVMSTPEFLSVFSGAQPLPGGDTLAAVYSGHQFGVWAGQLGDGRAHLLGEVEGPRGNWELQLKGSGMTPYSRMGDGRAVLRSSVREYLASEAMHGLGVPTTRALALVVSDDPVMRETVETAAIVTRMSPSFVRFGSFEHWSSRRQPDMLKTLADYVIDRFYPECREAGTGDPSNEMAPYINLLRAVTRRTALLMADWQAVGFCHGVMNTDNMSILGLTLDYGPYGFMDGFRLGHICNHSDSEGRYSWNRQPSVALWNLYRLGGSLHALVQDVEGLRAVLDEFEPVFTRAFHDRMGAKLGLAAWRPADEALLDDLLKLMDANQADFTLTWRRLADALSGQRSAFEDLFIDRPAAGAWLDRLVERHAQDGRPVQDVTAGMNRVNPLYVLRNHLAEEAIRAAKTGDVGEIDTLMKLLRNPYEAQPGHERHAALPPDWAGSLEVSCSS
>NZ_CP053985.1|WP_173142929.1|304381_304753_-|DUF2069-domain-containing-protein
MNPELNPRLRLLASVSLFALIVLCVTWETVVAPVRPGGSWMLLKALPLAFPLRGILRGNLYTYQWASMLSLLYLMEGVVRAMSDPAPLSVLMAWGEILLSTIFFLSAIFYVRPAKRAARRQRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053985_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053985_2

726945-727048

Orphan

Consensus_repeat	Method
CGCCGCGCCTTCGGCTCGCTGCCCCCC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP053985_2

>merge|NZ_CP053985|2|726945-727048|CRISPRCasFinder
CGCCGCGCCTTCGGCTCGCTGCCCCCCTCAGGGGGCGCTTTTACCTAGGGGCGGCCCGGCGGTAAAGATTACCCCCACGCCGCGCCTTCGGCTTGCTGCCCCCC

>NZ_CP053985|2|2|726945-727048|CRISPRCasFinder
CGCCGCGCCTTCGGCTCGCTGCCCCCC	TCAGGGGGCGCTTTTACCTAGGGGCGGCCCGGCGGTAAAGATTACCCCCA
CGCCGCGCCTTCGGCTTGCTGCCCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053985.1\|WP_173143248.1\|727130_728381_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320702
NZ_CP053985.1\|WP_054423686.1\|730279_730660_-\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
NZ_CP053985.1\|WP_173143256.1\|736221_736965_-\|phosphoadenylyl-sulfate-reductase	unknown	unknown	gnl\|CDD\|234997
NZ_CP053985.1\|WP_173143241.1\|720900_721830_+\|phenylacetic-acid-degradation-operon-negative-regulatory-protein-PaaX	unknown	unknown	gnl\|CDD\|274064
NZ_CP053985.1\|WP_173143255.1\|735271_736180_-\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NZ_CP053985.1\|WP_173143245.1\|724417_725380_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP053985.1\|WP_173143251.1\|730958_731831_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|274527
NZ_CP053985.1\|WP_173143249.1\|728377_729292_+\|ribosome-small-subunit-dependent-GTPase-A	unknown	unknown	gnl\|CDD\|234631
NZ_CP053985.1\|WP_173143247.1\|726371_726917_-\|oligoribonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235429
NZ_CP053985.1\|WP_173143253.1\|732373_733720_-\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP053985.1\|WP_173143242.1\|721848_722475_-\|NAD(P)H-hydrate-epimerase	unknown	unknown	gnl\|CDD\|223140
NZ_CP053985.1\|WP_173143254.1\|733931_735230_-\|sulfate-adenylyltransferase	unknown	unknown	gnl\|CDD\|225448
NZ_CP053985.1\|WP_173143252.1\|731846_732299_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053985.1\|WP_173143239.1\|718489_719254_-\|phenylacetate-CoA-oxygenase-subunit-PaaC	unknown	unknown	gnl\|CDD\|368300
NZ_CP053985.1\|WP_173143240.1\|719736_720726_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	unknown	unknown	gnl\|CDD\|184320
NZ_CP053985.1\|WP_173143250.1\|729412_730144_-\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP053985.1\|WP_013392438.1\|719269_719554_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	unknown	unknown	gnl\|CDD\|237504
NZ_CP053985.1\|WP_173143246.1\|725383_726358_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP053985.1\|WP_173143244.1\|724031_724358_+\|DUF4387-domain-containing-protein	unknown	unknown	gnl\|CDD\|379559
NZ_CP053985.1\|WP_173143243.1\|722657_724019_+\|acyclic-terpene-utilization-AtuA-family-protein	unknown	unknown	gnl\|CDD\|377804

Protein	Function_ID	Function_description	E-value
NZ_CP053985.1\|WP_173143248.1\|727130_728381_+\|M48-family-metallopeptidase	gnl\|CDD\|320702	cd07343, M48A_Zmpste24p_like, Peptidase M48 subfamily A, a type 1 CaaX endopeptidase. This family contains peptidase family M48 subfamily A which includes a number of well-characterized genes such as those found in humans (ZMPSTE24, also known as farnesylated protein-converting enzyme 1 or FACE-1 or Hs Ste24), Taenia solium metacestode (TsSte24p), Arabidopsis (AtSte24) and yeast (Ste24p). Ste24p contains the zinc metalloprotease motif (HEXXH), likely exposed on the cytoplasmic side. It is thought to be intimately associated with the endoplasmic reticulum (ER), regardless of whether its genes possess the conventional signal motif (KKXX) in the C-terminal. Proteins in this family proteolytically remove the C-terminal three residues of farnesylated proteins. Ste24p is involved in the post-translational processing of prelamin A to mature lamin A, a major component of the nuclear envelope. ZmpSte24 deficiency causes an accumulation of prelamin A leading to lipodystrophy and other disease phenotypes, while mutations in this gene or in that encoding its substrate, prelamin A, result in a series of human inherited diseases known as laminopathies, the most severe of which are Hutchinson Gilford progeria syndrome (HGPS) and restrictive dermopathy (RD) which arise due to unsuccessful maturation of prelamin A. Two forms of mandibuloacral dysplasia, a condition that causes a variety of abnormalities involving bone development, skin pigmentation, and fat distribution, are caused by mutations in two different genes; mutations in the LMNA gene, which normally provides instructions for making lamin A and lamin C, cause mandibuloacral dysplasia with A-type lipodystrophy (MAD-A), and mutations in the ZMPSTE24 gene cause mandibuloacral dysplasia with B-type lipodystrophy (MAD-B). Within cells, these genes are involved in maintaining the structure of the nucleus and may play a role in many cellular processes. Certain HIV protease inhibitors have been shown to inhibit the enzymatic activity of ZMPSTE24, but not enzymes involved in prelamin A processing.	1.6524e-172
NZ_CP053985.1\|WP_054423686.1\|730279_730660_-\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	8.58747e-66
NZ_CP053985.1\|WP_173143256.1\|736221_736965_-\|phosphoadenylyl-sulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	7.64715e-106
NZ_CP053985.1\|WP_173143241.1\|720900_721830_+\|phenylacetic-acid-degradation-operon-negative-regulatory-protein-PaaX	gnl\|CDD\|274064	TIGR02277, Transcriptional_repressor_PaaX, phenylacetic acid degradation operon negative regulatory protein PaaX. This transcriptional regulator is always found in association with operons believed to be involved in the degradation of phenylacetic acid. The gene product has been shown to bind to the promoter sites and repress their transcription. [Regulatory functions, DNA interactions].	1.03414e-125
NZ_CP053985.1\|WP_173143245.1\|724417_725380_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	9.89557e-112
NZ_CP053985.1\|WP_173143251.1\|730958_731831_+\|EamA-family-transporter	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	1.61471e-25
NZ_CP053985.1\|WP_173143249.1\|728377_729292_+\|ribosome-small-subunit-dependent-GTPase-A	gnl\|CDD\|234631	PRK00098, PRK00098, GTPase RsgA; Reviewed.	5.05569e-157
NZ_CP053985.1\|WP_173143247.1\|726371_726917_-\|oligoribonuclease	gnl\|CDD\|235429	PRK05359, PRK05359, oligoribonuclease; Provisional.	1.76158e-130
NZ_CP053985.1\|WP_173143253.1\|732373_733720_-\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.5297e-24
NZ_CP053985.1\|WP_173143242.1\|721848_722475_-\|NAD(P)H-hydrate-epimerase	gnl\|CDD\|223140	COG0062, COG0062, Uncharacterized conserved protein [Function unknown].	2.09987e-44
NZ_CP053985.1\|WP_173143254.1\|733931_735230_-\|sulfate-adenylyltransferase	gnl\|CDD\|225448	COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism].	0
NZ_CP053985.1\|WP_173143255.1\|735271_736180_-\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NZ_CP053985.1\|WP_173143239.1\|718489_719254_-\|phenylacetate-CoA-oxygenase-subunit-PaaC	gnl\|CDD\|368300	pfam05138, PaaA_PaaC, Phenylacetic acid catabolic protein. This family includes proteins such as PaaA and PaaC that are part of a catabolic pathway of phenylacetic acid. These proteins may form part of a dioxygenase complex.	1.30038e-120
NZ_CP053985.1\|WP_173143240.1\|719736_720726_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	gnl\|CDD\|184320	PRK13778, paaA, phenylacetate-CoA oxygenase subunit PaaA; Provisional.	0
NZ_CP053985.1\|WP_173143250.1\|729412_730144_-\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	2.8916e-71
NZ_CP053985.1\|WP_013392438.1\|719269_719554_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	gnl\|CDD\|237504	PRK13781, paaB, phenylacetate-CoA oxygenase subunit PaaB; Provisional.	8.45337e-65
NZ_CP053985.1\|WP_173143246.1\|725383_726358_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	9.33797e-120
NZ_CP053985.1\|WP_173143244.1\|724031_724358_+\|DUF4387-domain-containing-protein	gnl\|CDD\|379559	pfam14330, DUF4387, Domain of unknown function (DUF4387). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are approximately 110 amino acids in length. There is a conserved RSKN sequence motif.	1.42782e-47
NZ_CP053985.1\|WP_173143243.1\|722657_724019_+\|acyclic-terpene-utilization-AtuA-family-protein	gnl\|CDD\|377804	pfam07287, AtuA, Acyclic terpene utilisation family protein AtuA. This family consists of several bacterial and plant proteins of around 400 residues in length. One member of this family has been characterized in Pseudomonas citronellolis as AtuA, a member of a gene cluster that is essential for the acyclic terpene utilisation (Atu) pathway.	5.82008e-20

>NZ_CP053985.1|WP_173143247.1|726371_726917_-|oligoribonuclease
MAVNENRLVWLDMEMTGLDPEKERIIEVAVVVTEPDLTVVAEGPVLVVHQPDSLLDAMDSWNKSTHGKSGLIDKVKASTISEAQAEDTLLAFLAQHVPAGKSPLCGNTISQDRRFMFAYMPRLEQFFHYRNLDVSTLKELARRWAPAVYKGFEKKSRHEALADIYESIDELKHYREHFLKV
>NZ_CP053985.1|WP_173143246.1|725383_726358_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MPAAPSACEPLIGDHPSMAALRDLVGRVARSKASIVLIYGETGTGKGLVARNLHAQSARAAKGYTEINCAAIPGNLLESELFGHERGAFTGAVARKTGLLEAANGGSVFLDEIRELDPVMQAKILTLLDSRRFRRIGSVQEVSVDARFIAATNKILLGEVQAGRFRDDLYYRLQVVSINLPPLRERGDDVIVLAQRFLERYNATHGSRFTAIDPEVQRIFKAYAWPGNVRELSNLLERICILEDGDTVLARHLPQRILREAGKPAPAAAPAAAGSYAELSAQFQRGLIRAALQAQDGNLGRAAESLGLTRHALRHQMLKLGLDG
>NZ_CP053985.1|WP_173143245.1|724417_725380_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKALMQTTLFLAASLLAGAAAAQTDVPKQVKIVVPFTAGASNDAIARAIAPQLAARLGNTVIVENRGGAAGAIGSEYVARSAKDGSVLLLTSSTFLTTAATQPHLPYDPLKQFAPVAMIGQGPLVIAASAQTPYTSLKQLLEAARGKPGALNYGSAGVGSLAHLATVMLDDAAGTEMTHVPYKGAANAASDLAGGLIHVMLSNYSTLAPVVQGKKVKLLATTAQSPSPAFPDLPPAAQALPGYSVQIWVGVFAPAGTPQPYIDKLNAALVEIAASPEMKTLLDLDGTVPSRMDSAEFGARVREELAQWQAIARKHNISAE
>NZ_CP053985.1|WP_173143244.1|724031_724358_+|DUF4387-domain-containing-protein
MSTQKLSTLAKTIRSKNAGVNKITFDIIFREPATYEAVKRSGALTRASMAALYRIDDSRISDFVHYDPGLAIKFTIYRLAPSGSAGDGDIFGAQQYAPLLDVDVPMPD
>NZ_CP053985.1|WP_173143243.1|722657_724019_+|acyclic-terpene-utilization-AtuA-family-protein
MRSMSIICPNGHLGFAPLRTESFQLGVAAGPDCIAADSGSDDVGPVPLGSDTSTSPQAWQRHDLEQMLLAARKLGVPMVIGSAGDTGSNSRVDLYVRLIKEIAAEHKLAPFKIGYFYSEVDKERVRRALRDGRQVAGLDGYADLTEAELDASDRIVAVAGVHPYIKLLEAGADVIIGGRSSDAAVFAAPALHQGYDADRAYYLGKVLECASFCAEPYGGKETVMGEISAEDVRVTAMHPDQRCTIASVAGHAMYERSNPYEEFFAGGRLDMAECRYEQLSEKTARITGSRFEPAAQVRVKLEGSGKVGERYMGLCGIRDPYTIANVDRVIAWARDKVRERFGDSGYELHYKVYGRDGVMGDLEPLRGQPGHELCVMVQGVAPTAEMAEELTLTGLRQMFYARLPDVKGTAGSVSFPLDEVVRTSAAYRWTLNHTLPVTDAGELFPTHLTEAGA
>NZ_CP053985.1|WP_173143242.1|721848_722475_-|NAD(P)H-hydrate-epimerase
MSSSYSVARIRDAERQALAAGRRLMPLAGAAAARYAAARIRPGAVVLALAGPGNNGGDALEAAAGLRALGHDVRVLLPSGAQRLPADAARAYAGWLAAGGATWSELEPGFVPGLVIDGLFGIGLNRPLGAGWQALVDTVNAWNVPVLALDVPSGIDADTGEALGRPIRARWTLSFIGRARGLERPGPGRDACGVSEVDTLGVAIAPQA
>NZ_CP053985.1|WP_173143241.1|720900_721830_+|phenylacetic-acid-degradation-operon-negative-regulatory-protein-PaaX
MANPQSPLDRFLSRLIKNDPPRAKSLCVSLLGDALAPHGGAIWLGDLIELLAPLGINERLLRTSVFRLVAQNWLQSERHGRRSLYLISEQGLRHTAHASQRIYVGPAQEWNGEWTLVALPRTGNGLAERAELRRELVWEGFGMIAPGLFAHPHTEARAAHDILEKLGIPDRALVLSARDLAGAGGLPIASLASQCWNLDELAEQYRQFAKNFGPLEKLLETPPSPAEAFIVRVMLLHSWRRIVLHDPQLPGPMLPEDWPGHAAREICGRIYWQVFDASEAHLDALAGRDNERYAPLAADIAARFGGKPA
>NZ_CP053985.1|WP_173143240.1|719736_720726_-|1,2-phenylacetyl-CoA-epoxidase-subunit-A
MYAQLVETGVKQVKTADQLEGREQTFQRRIDDGVRIEAKDWMPDAYRKTLVRQISQHAHSEIVGMLPEGNWITRAPSLKRKAILLAKVQDEAGHGLYLYSAAETLGVSRDDLIDDLHAGRAKYSSIFNYPTLSWADIGMIGWLVDGSAIINQIPLCRCSYGPYARAMVRVCKEESFHQRQGYDLLMQMCLHGTPEQKAMVQDSLNRWWWPALMMFGPSDADSPNSAQSMAWKIKLFSNDELRQKMVDQTVPQAEYLGLTVPDPEVKWNAERGHYDFGEIDWTEFYAVLKGNGPCNRERLAARVKAHEDGAWVRDALVAYADKQAERKAA
>NZ_CP053985.1|WP_013392438.1|719269_719554_-|1,2-phenylacetyl-CoA-epoxidase-subunit-B
MSKDWPLWEVFIRSQHGLAHKHVGSLHASDAEMAINHARDVYTRRNEGLSIWVVRASDISASSPGDKDPLFEPANSKVYRHPTFFPMPEEIKHM
>NZ_CP053985.1|WP_173143239.1|718489_719254_-|phenylacetate-CoA-oxygenase-subunit-PaaC
MDKTLFEYLLRLGDSSLILSQRLGAWTGHGPILEEDLALTNTALDLLGQARMWLTLAGEVEGAGRDEDALAYLRDAHQFHNLLLAERPNGNYADTMARQFLFDVWHYFLLQRLEQSTDERVAAIAAKAIKEVTYHVRRSSDMVVRLGDGTAESHAKMQAAIDDAWRFTGELFADDAVDLDVAARGIGCELSALRQPWLAHVREVLEEATLTVPDEAAANHLAYRGGRQGRHTEDLGYVLAEMQFLPRAYPGATW
>NZ_CP053985.1|WP_173143248.1|727130_728381_+|M48-family-metallopeptidase
MFTLLFVAFLLTDIAVRLWLATRQIRHVALHRDQVPPEFSHRIGLASHQRAADYTVARVKLGMLERTYDAILLVCLTLMGGLQFIDLMVAQLTSNDFLRQMLLLVVVALLLGVLGLPFTLWRQFKLEARFGFNRMTPGLFVADAVKGLLVAAVLGLPLAAAVLWLMGSAGAYWWVWAWALWTAFNLALLIIYPMFIAPLFNKFTPLSDPELAGRIQRLAQRCGFALNGLFVMDGSRRSAHGNAYFTGFGRSRRIVFFDTLLARLNGDEIEAVLAHELGHFAKRHIVKRIVFSFAAALVFFAILGWVSQQPWFYVGLGVMPQLGGRNDAMALLLFFLVIPVFTFMLTPVASWYSRRDEFEADRYAAEQSSPERLVSALVKLYDDNAATLTPDPVHSAFYDSHPPAAVRIRHLTAAAA
>NZ_CP053985.1|WP_173143249.1|728377_729292_+|ribosome-small-subunit-dependent-GTPase-A
MSAPAAGPNEGRIIAAHGRHYTVELADGTLRKCFPRGKKAGAAVGDRVRITPQGKDEGAIDAILPRRNLLYRSDEMRSKQFASNVDQLLIVVAVQPTFSDDLTGRALAGAWSADIAPIIILNKTDLADELPAARARLAPIAALGVDVIELSALEPEKVHTLLAPRLAGHTSLLLGQSGMGKSTLLNALVPDAAAPTREHSTALDMGKHTTTSTRLYHLPAPGGDLIDSPGFQAFGLQHLSREDIIRGFPEFTEPIEQCRFYNCTHRQEPGCGVVAALQAGAIDPARYALYQRILEENLAGQQRY
>NZ_CP053985.1|WP_173143250.1|729412_730144_-|CoA-pyrophosphatase
MSDSSSSPRPRRPLARPGFDPATQPWVVANASLPAVPARLLTPDSLRGTLSQPSTWTLELSRDTDLRYPGREGVPVPAAVLIPLVTRDNGVHIMLTQRAAHLHDHAGQISFPGGRIETSDSTPEAAALREAQEETGLPANHVEVLGSMPPYLTATGFSIIPVVSLVRPGFDLAPDAFEVAEVFEVPLSFLMDPANHRLYEARLEDGRVRQYYGMPYGKHFIWGATAGMLRNLYHLLRHGFTPR
>NZ_CP053985.1|WP_054423686.1|730279_730660_-|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGQAKPEFAPGDTVIVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSAFTVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRNRSGKSARIKEKLVSKQAPAA
>NZ_CP053985.1|WP_173143251.1|730958_731831_+|EamA-family-transporter
MSYSSLILVVLAAMAHATWNLLAKRAAMVGAPFVFAYGLCASVLYAPWVIWVLLHDGMTWTWPVVGAILTSSLLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTTGAFLLLGEPATSTGIIGMLCVVGGVLLIATQGRLTIFKQAQAWVGVRWGVVIGLFIAAYTVVDAYGVKVLLISPVLFDWFTCVTRTTMMAPHMLRRRPQSWEAMRGHWHLALAVGLLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGPGRLAGCLGILAGVILLGSS
>NZ_CP053985.1|WP_173143252.1|731846_732299_-|hypothetical-protein
MNTADISVLSDELVVTLNPLRRGTNHARAWCARVAGMALPWNTSAADVEPRRRVRPGSVPARWPFPPAPAEAGALAGQAVAAPVPMPAPAVPVAPVEAAPASRERCLGNATVEPVTAQVTRKAMVIDVVMVLAWGAIIPGLMWLGAAAGF
>NZ_CP053985.1|WP_173143253.1|732373_733720_-|PA0069-family-radical-SAM-protein
MARTDHSFPAGSGSPAAAPAALRGRGAVTNVRHRFQRDDRVQVDDGWSSSGLPADFVDSVPDNFPEAASGEQTAARVIPILPDARIAPAAPKTTVTAEEARKMLSRNDSPDIPFDVAVNPYRGCEHGCVYCYARPTHSYLGLSPGLDFETRLVAKANAVQALRAELARPGYKPSPINIGSATDAYQPIEREWRLTRGLLELMLETRHPLTIVTKNALVARDLDLLAALAEQKLVVVYMSITTLDAGMARTLEPRAAAPWRRLETVRSLTDVGVPVGVLVAPIIPFINDESMEHILQESKAAGAHYASYTVLRLPWEVKTLFEDWLNAHFPDRAQRVLHRIEDLRNGRRNDPNFGSRMRGTGVWADLLRQRFTIATRKLGLNRHRLALDCDRFLPPAASVGAADFLSPVGAQASSGVPFSAVSPAAGAVHGRAARQLQAMAAGQLSLFD
>NZ_CP053985.1|WP_173143254.1|733931_735230_-|sulfate-adenylyltransferase
MNALNDSFLSGADTGVLRLITAGSVDDGKSTLIGRLLYDSKGVFADQLDAISRAKHKRVAGDGIDFSLLTDGLEAEREQGITIDVAYRYFSTPARKFIIADAPGHEQYTRNMVTGASTADVAVILIDATRAADGVLLPQTKRHSTIARLLGIRHIVVAVNKMDLVDWDRAVFERIRDAYADLAGKLGIEHFDALPLSALNGDNVVTLSPQTPWYEGEPLLALLESLDLASDGRALPLRFPVQWVARHDGSRKDDFRGYAGRVASGVLRPGDEITVQPSGVTAVVREVRAFDRALDEAVAGDSITLVLDRDVDVSRGDVIVHASAPAQVTREFEAELCWLDAQALNPARKYLLKSGTRLTSAKIRAVLSHRDIHELQEVENTEGTLRMNDIGRVTITTRESLAVDRYADVPATGTFILIDEATHQTAAAGMLR
>NZ_CP053985.1|WP_173143255.1|735271_736180_-|sulfate-adenylyltransferase-subunit-CysD
MSAVIQRSHLDWLESEAIFILREVAAESEKPVLLFSGGKDSVVLLRLAEKAFRPGRFPFPLMHIDTGHNFEEVIAFRDARAAELGETLIVRSVEDSIARGSVVLRRETDSRNAAQAVTLLEAIEEFGFDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMRVFPISNWTELDVWQYIQREQLALPSIYYSHQREVVRRKGLLVPVTRLTPPQDGEQVERLQVRFRTVGDISCTCPVASDAADTRAIIAETAVTDITERGATRMDDQTSEASMERRKKEGYF
>NZ_CP053985.1|WP_173143256.1|736221_736965_-|phosphoadenylyl-sulfate-reductase
MSTTDLLPELEPGLAARWRELGARLADVQQRYPDAALASSLAAEDTLLTHAIYSAGLDLEVFTLDTGRLHAETLGVLDAVREHYGREITVYRPVAAAVEQHVAEHGAYAFYESVELRKACCQIRKVEPLKRALAGRGAWITGQRRAQSTTRGVLPLEEDDPTFGLYKFNPLAEWSEEEVWSVIRALGIPYNPLHDQGYPSIGCEPCTRAIRPGEDLRAGRWWWESSDSKECGLHAGNRVISIAARAD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053985_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053985_3

2050616-2050757

Orphan

Consensus_repeat	Method
ACAGCCCCCTCGGGGGGCAGCAAACGCGCGACAGCGCGTGCAGCGTGGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053985_3

>merge|NZ_CP053985|3|2050616-2050757|CRISPRCasFinder
ACAGCCCCCTCGGGGGGCAGCAAACGCGCGACAGCGCGTGCAGCGTGGGGGTGCACATCGCCGTCCCGCCGCCGGGCCGTCCCAAGGCGGGACAGCCCCCTCGGGGGGCAGCAAACGCGCGCCAGCGCGTGCAGCGTGGGGG

>NZ_CP053985|3|3|2050616-2050757|CRISPRCasFinder
ACAGCCCCCTCGGGGGGCAGCAAACGCGCGACAGCGCGTGCAGCGTGGGGG	TGCACATCGCCGTCCCGCCGCCGGGCCGTCCCAAGGCGGG
ACAGCCCCCTCGGGGGGCAGCAAACGCGCGCCAGCGCGTGCAGCGTGGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053985.1\|WP_173144279.1\|2054070_2055054_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP053985.1\|WP_173144277.1\|2052628_2053174_+\|DUF934-domain-containing-protein	unknown	unknown	gnl\|CDD\|377598
NZ_CP053985.1\|WP_173144283.1\|2061656_2063702_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP053985.1\|WP_173144276.1\|2050893_2052636_+\|nitrite/sulfite-reductase	unknown	unknown	gnl\|CDD\|223233
NZ_CP053985.1\|WP_173144270.1\|2043914_2044643_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NZ_CP053985.1\|WP_173144269.1\|2043152_2043905_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NZ_CP053985.1\|WP_173144280.1\|2055064_2056582_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341286
NZ_CP053985.1\|WP_173144282.1\|2057437_2061211_-\|methionine-synthase	unknown	unknown	gnl\|CDD\|236539
NZ_CP053985.1\|WP_173144271.1\|2044648_2046355_+\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|237225
NZ_CP053985.1\|WP_173144272.1\|2046380_2046980_+\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198314
NZ_CP053985.1\|WP_173144267.1\|2041656_2042421_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP053985.1\|WP_173144281.1\|2056578_2057364_+\|citryl-CoA-lyase	unknown	unknown	gnl\|CDD\|235748
NZ_CP053985.1\|WP_173144275.1\|2049376_2050312_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176117
NZ_CP053985.1\|WP_173144274.1\|2047744_2049085_-\|DUF3100-domain-containing-protein	unknown	unknown	gnl\|CDD\|378631
NZ_CP053985.1\|WP_173144284.1\|2063755_2064712_+\|cobalamin-binding-protein	unknown	unknown	gnl\|CDD\|238564
NZ_CP053985.1\|WP_173144278.1\|2053170_2053968_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224332
NZ_CP053985.1\|WP_013391270.1\|2050387_2050579_+\|DUF2970-domain-containing-protein	unknown	unknown	gnl\|CDD\|378581
NZ_CP053985.1\|WP_173144273.1\|2047181_2047688_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053985.1\|WP_173144285.1\|2064861_2065665_+\|thiazole-synthase	unknown	unknown	gnl\|CDD\|234687
NZ_CP053985.1\|WP_173144268.1\|2042413_2043133_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487

Protein	Function_ID	Function_description	E-value
NZ_CP053985.1\|WP_173144279.1\|2054070_2055054_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.22483e-153
NZ_CP053985.1\|WP_173144277.1\|2052628_2053174_+\|DUF934-domain-containing-protein	gnl\|CDD\|377598	pfam06073, DUF934, Bacterial protein of unknown function (DUF934). This family consists of several bacterial proteins of unknown function. One of the members of this family BMEI1764 is thought to be an oxidoreductase.	8.24057e-46
NZ_CP053985.1\|WP_173144283.1\|2061656_2063702_+\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	1.56916e-72
NZ_CP053985.1\|WP_173144276.1\|2050893_2052636_+\|nitrite/sulfite-reductase	gnl\|CDD\|223233	COG0155, CysI, Sulfite reductase, beta subunit (hemoprotein) [Inorganic ion transport and metabolism].	0
NZ_CP053985.1\|WP_173144270.1\|2043914_2044643_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	1.09578e-66
NZ_CP053985.1\|WP_173144269.1\|2043152_2043905_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	1.12522e-75
NZ_CP053985.1\|WP_173144280.1\|2055064_2056582_+\|AMP-binding-protein	gnl\|CDD\|341286	cd17631, FACL_FadD13-like, fatty acyl-CoA synthetase, including FadD13. This family contains fatty acyl-CoA synthetases, including Mycobacterium tuberculosis acid-induced operon MymA encoding the fatty acyl-CoA synthetase FadD13 which is essential for virulence and intracellular growth of the pathogen. The fatty acyl-CoA synthetase activates lipids before entering into the metabolic pathways and is also involved in transmembrane lipid transport. However, unlike soluble fatty acyl-CoA synthetases, but like the mammalian integral-membrane very-long-chain acyl-CoA synthetases, FadD13 accepts lipid substrates up to the maximum length of C26, and this is facilitated by an extensive hydrophobic tunnel from the active site to a positively charged patch. Also included is feruloyl-CoA synthetase (Fcs) in Rhodococcus strains where it is involved in biotechnological vanillin production from eugenol and ferulic acid via a non-beta-oxidative pathway.	3.39967e-142
NZ_CP053985.1\|WP_173144282.1\|2057437_2061211_-\|methionine-synthase	gnl\|CDD\|236539	PRK09490, metH, B12-dependent methionine synthase; Provisional.	0
NZ_CP053985.1\|WP_173144271.1\|2044648_2046355_+\|FAD-binding-protein	gnl\|CDD\|237225	PRK12843, PRK12843, FAD-dependent oxidoreductase.	0
NZ_CP053985.1\|WP_173144272.1\|2046380_2046980_+\|glutathione-S-transferase	gnl\|CDD\|198314	cd03205, GST_C_6, C-terminal, alpha helical domain of an unknown subfamily 6 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs, including Pseudomonas fluorescens GST with a known three-dimensional structure. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Though the three-dimensional structure of Pseudomonas fluorescens GST has been determined, there is no information on its functional characterization.	5.00101e-49
NZ_CP053985.1\|WP_173144267.1\|2041656_2042421_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	1.18232e-115
NZ_CP053985.1\|WP_173144281.1\|2056578_2057364_+\|citryl-CoA-lyase	gnl\|CDD\|235748	PRK06224, PRK06224, citryl-CoA lyase.	1.47287e-103
NZ_CP053985.1\|WP_173144275.1\|2049376_2050312_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176117	cd08426, PBP2_LTTR_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.90644e-46
NZ_CP053985.1\|WP_173144274.1\|2047744_2049085_-\|DUF3100-domain-containing-protein	gnl\|CDD\|378631	pfam11299, DUF3100, Protein of unknown function (DUF3100). Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known.	5.39912e-98
NZ_CP053985.1\|WP_173144284.1\|2063755_2064712_+\|cobalamin-binding-protein	gnl\|CDD\|238564	cd01144, BtuF, Cobalamin binding protein BtuF. These proteins have been shown to function as initial receptors in ABC transport of vitamin B12 (cobalamin) in eubacterial and some archaeal species. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).	1.40267e-72
NZ_CP053985.1\|WP_013391270.1\|2050387_2050579_+\|DUF2970-domain-containing-protein	gnl\|CDD\|378581	pfam11174, DUF2970, Protein of unknown function (DUF2970). This short family is conserved in Proteobacteria. The function is not known.	1.42955e-15
NZ_CP053985.1\|WP_173144278.1\|2053170_2053968_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	4.91714e-37
NZ_CP053985.1\|WP_173144285.1\|2064861_2065665_+\|thiazole-synthase	gnl\|CDD\|234687	PRK00208, thiG, thiazole synthase; Reviewed.	8.58542e-161
NZ_CP053985.1\|WP_173144268.1\|2042413_2043133_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	8.73838e-116

>NZ_CP053985.1|WP_013391270.1|2050387_2050579_+|DUF2970-domain-containing-protein
MLSFLRTVKSVLWGFFGVRRGRGYDADIANNKPAPLILTGLLMAACLVVILVLVARWAVNAAL
>NZ_CP053985.1|WP_173144275.1|2049376_2050312_+|LysR-family-transcriptional-regulator
MDEKLDARRTHYFMQVMSRGSVRGAAEVLDMDPSAVSRAIAALERDCGIALFERRGRGVVPTDAGHILARYIKRQQDIQESFFSEIDSLRKAERGHIDLVLGEGFVELMFERVLPGYWRSHPEVTLDIDVARTSEIVQRIIDDRAYIGLVFQPPNDARLRTHYSRPEPIRAIVRDDHPLTRLRRPLLLTDLADHPGASMQEGFGVRQHIQAAEISEQVRLRNVLTTSSFKALWQFAAAGIGYALTPPIAVTADLRAQRLASLPLANPILNQGSLHVLSRAGRHISPAARELLDHIVRGIGAPAGSTSDTVG
>NZ_CP053985.1|WP_173144274.1|2047744_2049085_-|DUF3100-domain-containing-protein
MSHASASLAAPSMPLSGRIRMLAAILLVVVVSEAIGSATFNVGPGKIVLQPMLWAIFIGAIVAAFGQRMPAGLNIDTAMQTRISGYLQYALLPFLAKLGLMVGGALPQVREAGWALVFQEFGHFFGTMAIGLPLALLLGIKREAIGATFSVGREPSLAIIGERYGMNSPEGRGVMAEYITGTVIGALFVALMAGFITSLNIFDPRSLAMGAGVGSGSMMAAGVGAIASQQTPEVAHQVAALAAAANLLTTVVGVYFTLFISLPTTIFLYDKLEPVLGRFSRGKAETAAAADDSVAQETPAHGAKMGFGDRLTAYVICGLFALVGNRLGYNVPFADALPGMGIIILLVVITDLVLRVVPKLPAVFVLSLIAMTAGCPGVLPYSDQIIAMVGKVNFLPFTTVILAMAGLSILKDLPAFRKLGWKIVVVSLAANAGTFLGATMIAEFFH
>NZ_CP053985.1|WP_173144273.1|2047181_2047688_+|hypothetical-protein
MNVAAISAIHRADAPYPARSAALDAARAFPETQRVAHVQAARAAAAGHAAQAIRERASLSLPLSSFGASNADALRDLHAESRMRRAVEDFTAQPDPAAQRAGSANDLGTIEGLMPLQAYRVAMGNPQVQELQTAVAMKAAGLGIPKVANIGATENVTDNARYRPGHTP
>NZ_CP053985.1|WP_173144272.1|2046380_2046980_+|glutathione-S-transferase
MKIFYSPASPFVRKCMVIAHELGLADRIEKLPSAAGPVARDQTIIPSNPLGQVPTFITDDGQALYDSRVVCEYLNDLGGGSLFPAGKTRWQVLTEQSMADGMLGAALLARYETVLRPEALRWDGWVEGQLDKVRDGLALVEQNAAALAGRLDIGTITIGCALGYLDFRFPDLDWRAGHPATAAWYETFSQRPSMQATKP
>NZ_CP053985.1|WP_173144271.1|2044648_2046355_+|FAD-binding-protein
MEGITWDKEVDALVVGSGAGGMAAALTAREEGLEVLLVEKTGRIGGSTAISGGALWIPLNAQTEAAGHPDSYDQVWTYLEQTVGAAAPDDMKRAYLEAGPRMMDYLVSRGILDLAARTASPDYYPDLPGAAMGGRSLDPLEFDGRKLGRDFRLLRDPLKEFTVLGGMMVNITDVRHLLRATRSYAAWRHSMKLALRYAADRVRGYHRGTRLLLGNALAAQLFHGLLARRIEYWLDTPALALHRDTAGRVLGAAVQRGGKTLNIRARRGVVMATGGFPWDPERRSQSYPQPTGLWSMSPRDNTGDGIRLSETAGAALGTGHASPAFWAPISVLVSADGERLHYPHLVWDRAKPGLIAVNGAGQRFVNESASYHEFVQAMYRSHDTTPSIPAFLICDQRFVDAWGLGLALPGGRPRQHLIDAGYLLQGATLAALAARLGVPADALQATVQRYNAHAAQGQDPDFGKGSTAYNRYLGDPEHEPNPCLTPLGAGPYYAVKVYPGDIGTACGIAANPHAQALDAASAPIPGLYVAGNDMQSVMGGAYPGPGITLGPALTFGWIAGQHLAHAQH
>NZ_CP053985.1|WP_173144270.1|2043914_2044643_+|SDR-family-oxidoreductase
MNLGTALVTGGASGMGLAIVERLARDGFRVVMADRNAELAAKEAEALRAQGLDVEYRVVDLTDEAATRALARALAPLTALVNNAGLFDERKFFEVDSADYRRAFDVNLLAVASLTQEAARDMAPGSKIVNIASRAYLGAKNHPHYVASKAALVGYTRASAMELAPRGILVNAIAPGLIDTPLLRNLTPERLAAQLALQPTGRAGQPQDIANAVSFLAAPHMDFITGQVIFVDGGKSLGGSGA
>NZ_CP053985.1|WP_173144269.1|2043152_2043905_+|SDR-family-oxidoreductase
MISMQDKRVLVTGAGRGLGAAIAQGFARQGAAVIVADVDAALAAAAVQAIRAAGGKAADAVLDVTDATAVRAFAQRSATEHGNLDILINNAGISARAPFDDPRTPEIWDRLMSVNLQGTFNVTHAFVEQLKATRGAIVNLCSIVAYGCSISTAGYVVSKGGVRSFTEVLARDLAPHGVRVNAVAPGLMETEMTAGQRAQAQGTDWYMQRAPMARAGRADEIVGPVLFLASDLASYVNGVVLPVDGGYLAV
>NZ_CP053985.1|WP_173144268.1|2042413_2043133_+|ABC-transporter-ATP-binding-protein
MAEYLLEVDAVSAAYGNIRALQDVSLKVPQGAIVALLGANGAGKSTTLNVISRLVAPTAGSVRFAGEPIHRLAADAIVGRGIVQVPEGREIFRDMSVRENLEMGAYLRTDRAEVRRDLDMVCDTFPRLRERYEQKAATLSGGEQQMLATGRAMMARPRMILLDEPSMGLSPLVVEQIFDIVLRLNREQGITILLVEQNVKLALSVSSYAYILENGEIALEGESAALASDEGVQRAYLGA
>NZ_CP053985.1|WP_173144267.1|2041656_2042421_+|ABC-transporter-ATP-binding-protein
MSSHPYLDVQGLTVKFGGLTAINGLSMQVERGRIHALIGPNGAGKSTTFNCISRYYRPSSGSIQFDGADITRKKPHEMAALGVARTFQNLELFGALSVRENALLGTYAHGADSAGKLLRPAAAQTRERVEHLLERVGLADFLDTPACSLDFGRQKMLELARALAISPKLLLLDEPAAGLRNREIETLDRLLTELCERDGITVLLVEHVMQLVMSISHRITVMSFGEKIAEGSPAEVRSNPRVIEAYLGKGAAGG
>NZ_CP053985.1|WP_173144276.1|2050893_2052636_+|nitrite/sulfite-reductase
MYVYDPVDQQLVEQRVAQFSDQTRRFLDGQLTEDEFRVLRLQNGLYIQRHAPMLRVAIPYGILASRQLRTLAHIARKWDRGYGHFSTRQNIQFNWPKLEDVPDILAELATVQMHAIQTSGNCIRNTTTDHFAGVAPDELVDPLVWCEIIRQWSTLHPEFAFLPRKFKIAVSGAVQDRAAVGVHDIGLQAVERDGKLGFRVWVGGGLGRTPIVGKLINPFVEWQDLLTYLQAALRVYNLHGRRDNKYKARIKILVKDLTPEVYAQQVDEQWQLIKGGPDTITQEFVDSIKARFVWPQYDSAATQDIDNTAALAAADPRFARWLRTNVHPHKVAGYAAVTVSLKPTGVPPGDITADQMDAVANLADEYGFGELRVSHEQNLILADVRRARLHELWTTLQALNLATPNIGLLTNIIACPGGDFCALANAVSIPVAEAIQRQFDNLDYLFEIGELDLNISGCINSCGHHHVGHIGILGVDKAGEEWYQVTIGGRQNGAAKPLPDIESTRGGGAAIGRIIGPSFARDQVAGVVDRLVRTYLGLRDSEEERFIDVVDRVGIDPFKQDVYSDPAFAKPTQHAEAAHV
>NZ_CP053985.1|WP_173144277.1|2052628_2053174_+|DUF934-domain-containing-protein
MSEIYPHDTPGPHLIRNGRLEADTARLFTPEPEVPAEGQVPGDAPGWIVPLSTWKTSRATLRRHQHPVAVLLDPDADLRDLADTDGTLDPAGIAFIAVDFPVYTDGRGYSLAQLLRTRYRWQGELRAVGDVMIDTIHYQARVGFDSFLVKPGHDPHKALEAFKTFTVHYQKTYRVPTPAAA
>NZ_CP053985.1|WP_173144278.1|2053170_2053968_-|helix-turn-helix-domain-containing-protein
MNKPESEGSGPRVLRRGLRVLGVLRQAGAAGMHVVDIARAAGMQRTTAYRYLDVLVQEGYALRESEAPRWRVAELGVMMAGDPHAQAVRSLRPVLRQISDVSGDSAFLICRAGNDSLCLHREVGNYPVQVLAVTVGHRQPLGVGAAGLALLAALPSAESEEVIAQNEQALRAYGGMTVAQMRRLVENTRGRGWSVVGNAAVPGVLGVGVALCDAGGYPRLAVSVSSLISRMQAARQRNIADLIRAQLAQDEVRTQRWALPGFSGG
>NZ_CP053985.1|WP_173144279.1|2054070_2055054_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKMQSKRWAAAAAALGALLAAPALAAKPYPERPVTLVVGYAAGGATDIVARLMAKSLSEELGQTIVVENKTGANSNIGAEIVSRAAPDGYTLYVGSIANTINRTLYSQLSYDFVKDFEPVGLLATIPNILVVNPKLPIKTVQEYVAYAKKNPGKLTCASSGSGSSIHLSCELFKMQTGTDILHVPYRGSGPAVADLLGGQVDSMFDNLPSSLPHVQAGKLRAIGVTSPQRLPSAPDTPTLAESGLAGFDVESWFGVMAPAGTPKPVVERLNQAINKALASPALQTSYQQSGFYAPQQPNTPETYAKKIASEIDKWGKVVKSANLKAN
>NZ_CP053985.1|WP_173144280.1|2055064_2056582_+|AMP-binding-protein
MYPIDFFFRAAEQYPDRIALDGPEGLVTYSRLAADTRALAAALQDLDPAPQTRVAICAGNSARHILALLAVLASGKVWVPLNYRSTEREIGRILDATEPSIVIVDGVGAPLAPEVQAPQGRRHIHLDDAAAPLALDELLARCAGREPQRHALPRDATQAVKFTGGTTGLPKGVMQPYHAWNAGIINQIMSWGLTHEDRYVVAAPITHGTGTYLLPVLARGGAHLLLDGVTPASITAAFRERGGTLSFMPPTLIYMIMAQPGVSRADFPRLRNLIYGGAPMPVEKIDKARAFFGPVLGTTYGQTEAPQIVTVLRPSDLEAPQNRASVGRVTWLSDVAIMAPDGALLPRGEIGEVVVQGDLVMASYWRLPEKTAETVVNGWLHTGDTGLIDARGYLFLKDRLRDVIITGGFNIYPVDVENALSAHPAVYECSVFGLPDDKWGEAVHAAVQFHPGVEASEDELKAHVRALLGPVATPKQFHIHDSLPRSSVGKVLKNAVRDAAQKESS
>NZ_CP053985.1|WP_173144281.1|2056578_2057364_+|citryl-CoA-lyase
MKTPETRLCAHHLTGMSYRDVDLVEDLIGKKTFTEVMIMQILGREARPVDLRIVDAVLVTLMEHGLTPSAITTRLIYMSAPENLQGAVASGLMAVGSRFVGTMENCSRLLDRIRQAEDGRAEALAIAREFRESRSALPGFGHHLHKPDDPRSIKLLALAEAEPDLKGDSLKALRLFSAAIDETYGKHITINATGAVAALLSEIGVPTELMRGFAVISRAAGLVSHVAEEQQSPSGRYIWETIDHAIPYVGRGKTHQGAEQA
>NZ_CP053985.1|WP_173144282.1|2057437_2061211_-|methionine-synthase
MSYPRLPYPPEAYTHGGEFARLLGKRILILDGAMGTMIQRYKLGEADFRGERFAGHGKDVKGNNELLSLVRPDVISEIHRQYLEAGADVIETNTFGATSIAQGDYELPELAYELNLVSARLAREACDAYSTPERPRFVAGALGPQPKTASISPDVNDPGARNVTFEELRVAYVEQLNGLLDGGIDIVLIETIFDTLNAKAAIFATEEVFEARGVRLPVMISGTVTDASGRILSGQTVEAFWNSVRHARPITIGLNCALGAALMRPYVAELARICDTYVCVYPNAGLPNPMAETGFDETPADTSALLEEFARAGLVNMSGGCCGTTPDHIREIAAKVMSLTPRAVPDIPVKTRLSGLEPLNIDEDTLYVNVGERTNVTGSKMFARLIREEKYDEALAVARQQVENGAQIIDINMDEAMLDSVACMRRFLNMIASEPDIARVPIMIDSSKWEVIEEGLKCVQGKPVVNSISMKEGLEPFRHHARLCRRYGAAVVVMAFDELGQADTLERRKEICGRAYKILVEEEGFPPEDIIFDPNVFAVATGIDEHNHYAVDFIEGTRWIRENLPHARISGGVSNVSFSFRGNEPMREAIHTVFLYYAVKEGMTMGIVNAGQLGVYADLDPKLRDLVEDVVLDRAEPVGKTEADDERTPTERLVQFADSVKGSGAKKEEDLAWRNAEVEKRLSHALVHGITAFIVEDTEEVRQKIFDRGGRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAHLIPFIEEEKRQIAAAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMVPCAQILEKAKEENADIVGLSGLITPSLEEMAYVASEMQRDEYFRSRKLPLMIGGATTSRVHTAVKIAPNYEGPVIYVPDASRSVGVATNLMSDQSATYLAELAQEYEEVRRRHANRKATPILPLAEARASRPAIDWDNYTPPRPKFIGRRTFKSYDLAEIAKYVDWGPFFQTWSLFGPYPAILDDKVVGEQARKVHADGLAMMKRIIEGRWLTANGVVGFYPANSINDEDIEVYKDETRSEVLFTYRNLRQQGAKREGVSNKSLSDFIAPKSSGKLDYIGMFAVTAGLGIEKKEAEFEKALDDYSSIMLKSLADRLAEGFAECLHARVRQDLWGYAPDEALSNEDMIAEKYVGIRPAPGYPACPEHVIKTDMFRVLDGADIGMMLTDSYAMYPASSVSGFYFSHPQSQYFNVGVIGEDQLQDYAARSGRGIEDLKRTLAPNLG
>NZ_CP053985.1|WP_173144283.1|2061656_2063702_+|TonB-dependent-receptor
MKTRSIRRYAGALLCSAPAIAAAQQAASTTPQLDAVTVTAQRVPTDGRTLPVSISVITAEDIAAASARTLQDVLSTQAGIHLINTSSSSDNSIVDLRGFGITGASNTLILIDGVKQNTNDLSAPSLGVVPLDQVERIEIVRGSGSVQYGGGTTGGVINIITRSDFAKEPVTARATATFGSYGLRQYDAAVAMNNEKVGVDAYMQSLHSDGYRDHSGERREGGGGGITFRHDDGSIRLYGRTTTQKLELPGPRTINPKTGLNEYQDDPRGSKNDLDYVKTTTTTFGLQLEQAIGAGTLYADLSTREKKLDGLTYDGFGDILRDQKLEENIASVRYRLPINGGHSIVFGADGQEAKTTANQNAYYDFQPSKWQSRQHQYGLFAEGQVRATESTYVTAGVRRQYASDDLDVISGSGTASDRSNHLTAWQLGVRQDLPAGFGVYGKVGRSFRLPNADELLSVQTPLAPQTSTDKEIGVTWQSASSSARLSYFRYDLTNEIQYNPLADGMWGPGTGANTNLDPTRRQGIELEGHTAISSSVSLDANLTWMEAQFRSGTYAGVDLAGKTVPLAPKWLANAGVTWRPTDAFLWNVTAQYVGKSRMDNDQANQFAKELDAYVLFNTKVAYKFTRNIEGAIGVNNIFDRQYATYGIRGGNASFEMLGPVANYSLYPAPGRNFYASLTLRY
>NZ_CP053985.1|WP_173144284.1|2063755_2064712_+|cobalamin-binding-protein
MTLARAYPRIVPGLFLASGQWLATGLVAGLLAGLAAPAAAGQATPGPAAALQVRDDQGRTVPLAAPARRAVTLAPHATELVFAAGAGDRLVATIRGSDYPPAARQLPIIGDGTQPDPERVAAVRPDLLIAWQPAAAAPLARVMDKLGVPVFYSDPQTLAAIPDAVERMGALFGTEAQARPAAQALRARLDALAARYAGRRPVRVFVQAGLDPIYTLNDSSIVSDALRVCGGVNVFGQAPVVAPQVTLESVLAARPEAVLAGISRPEDAARNLAAWQALGLPAARLGHVYGVDADALYRPGPRLIDAAEAICADLDHLR
>NZ_CP053985.1|WP_173144285.1|2064861_2065665_+|thiazole-synthase
MTTQDTLTIAGRAYSSRLLVGTGKYKDFEQTRAALDASGTEIVTVAIRRTNIGQNPGEPNLLDYVPPSKFTLLPNTAGCYSADEAVRTLRLARELLDGHELVKLEVLGDPQTLFPNMPETLKATKTLVDEGFKVMVYCTDDPIQCRMLEDLGAVAVMPLASLIGSGMGILNPWNLRLIIEQARVPIVVDAGVGTASDAAIAMELGCDAVLMNTAIAGARDPILMASAMKKGVEAGREAFLAGRMPKKLYSGAPSSPSEGLITAGAPK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053985_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053985_4

4966799-4966999

Orphan

Consensus_repeat	Method
CGCCCACGGCTCCGGTCACTCCGCCGAGCAGGCCCGTGACCGGCGCCAGCA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP053985_4

>merge|NZ_CP053985|4|4966799-4966999|PILER-CR
CCACGGCTCCGGTCACTCCGCCGAGCAGGCCCGTGACCGGCGCCAGCACTCCGCCATTTGCGCCGCCGGTTGCGCCGCCCACGGCTCCGGTCACTCCGCCGAGCAGGCCCGTGACCGGCGCCAGCACTCCGCCATTGGCGCCGCCGGTTGCGCCGCCTACGGCTCCGGCCACTCCGCCGAGCAGGCCCGTGACCGGCGCCA

>NZ_CP053985|4|1|4966799-4966999|PILER-CR
CCACGGCTCCGGTCACTCCGCCGAGCAGGCCCGTGACCGGCGCCAGCACTC	CGCCATTTGCGCCGCCGGTTGCGCCGC
CCACGGCTCCGGTCACTCCGCCGAGCAGGCCCGTGACCGGCGCCAGCACTC	CGCCATTGGCGCCGCCGGTTGCGCCGC
CTACGGCTCCGGCCACTCCGCCGAGCAGGCCCGTGACCGGCGCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053985.1\|WP_173146584.1\|4976405_4977734_+\|pilus-assembly-protein-CpaE	unknown	unknown	gnl\|CDD\|349765
NZ_CP053985.1\|WP_173146583.1\|4975047_4976409_+\|type-II-and-III-secretion-system-protein-family-protein	unknown	unknown	gnl\|CDD\|227299
NZ_CP053985.1\|WP_173146571.1\|4961679_4962657_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP053985.1\|WP_173146570.1\|4959445_4961683_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173870
NZ_CP053985.1\|WP_173146576.1\|4969100_4970723_-\|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein	unknown	unknown	gnl\|CDD\|225387
NZ_CP053985.1\|WP_173146578.1\|4972261_4972462_+\|Flp-family-type-IVb-pilin	unknown	unknown	gnl\|CDD\|226366
NZ_CP053985.1\|WP_173146569.1\|4958664_4959324_+\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NZ_CP053985.1\|WP_173146581.1\|4973534_4974026_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|377921
NZ_CP053985.1\|WP_173146568.1\|4957580_4958585_+\|magnesium-and-cobalt-transport-protein-CorA	unknown	unknown	gnl\|CDD\|213364
NZ_CP053985.1\|WP_173146577.1\|4971308_4972139_+\|signal-protein	unknown	unknown	gnl\|CDD\|225837
NZ_CP053985.1\|WP_173146579.1\|4972604_4973126_+\|prepilin-peptidase	unknown	unknown	gnl\|CDD\|227295
NZ_CP053985.1\|WP_173146574.1\|4965895_4966441_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP053985.1\|WP_173146582.1\|4974022_4974982_+\|Flp-pilus-assembly-protein-CpaB	unknown	unknown	gnl\|CDD\|274472
NZ_CP053985.1\|WP_173146573.1\|4964155_4965853_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NZ_CP053985.1\|WP_173150366.1\|4952958_4954410_+\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP053985.1\|WP_173150365.1\|4954395_4955292_-\|DUF72-domain-containing-protein	unknown	unknown	gnl\|CDD\|376655
NZ_CP053985.1\|WP_173146567.1\|4955411_4957517_+\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|223288
NZ_CP053985.1\|WP_173146585.1\|4977763_4979125_+\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NZ_CP053985.1\|WP_173146580.1\|4973071_4973533_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|377921
NZ_CP053985.1\|WP_173146572.1\|4962662_4964159_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094

Protein	Function_ID	Function_description	E-value
NZ_CP053985.1\|WP_173146584.1\|4976405_4977734_+\|pilus-assembly-protein-CpaE	gnl\|CDD\|349765	cd03111, CpaE-like, pilus assembly ATPase CpaE. This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.	1.12539e-63
NZ_CP053985.1\|WP_173146583.1\|4975047_4976409_+\|type-II-and-III-secretion-system-protein-family-protein	gnl\|CDD\|227299	COG4964, CpaC, Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion].	1.64497e-96
NZ_CP053985.1\|WP_173146571.1\|4961679_4962657_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	6.20408e-62
NZ_CP053985.1\|WP_173146570.1\|4959445_4961683_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173870	cd08505, PBP2_NikA_DppA_OppA_like_18, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP053985.1\|WP_173146576.1\|4969100_4970723_-\|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein	gnl\|CDD\|225387	COG2831, FhaC, Hemolysin activation/secretion protein [Intracellular trafficking and secretion].	2.20982e-71
NZ_CP053985.1\|WP_173146578.1\|4972261_4972462_+\|Flp-family-type-IVb-pilin	gnl\|CDD\|226366	COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion].	6.93152e-14
NZ_CP053985.1\|WP_173146569.1\|4958664_4959324_+\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	2.01264e-31
NZ_CP053985.1\|WP_173146581.1\|4973534_4974026_+\|pilus-assembly-protein	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	1.05527e-08
NZ_CP053985.1\|WP_173146568.1\|4957580_4958585_+\|magnesium-and-cobalt-transport-protein-CorA	gnl\|CDD\|213364	cd12830, MtCorA-like, Mycobacterium tuberculosis CorA-like subfamily. This bacterial subfamily belongs to the Thermotoga maritima CorA (TmCorA)-like family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. This subfamily includes the Mg2+ transporter Mycobacterium tuberculosis CorA (which also transports Co2+). Thermotoga maritima CorA forms funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport by a related protein, Saccharomyces cerevisiae Alr1p. Natural variants in this signature sequence may be associated with the transport of different divalent cations. The functional diversity of the MIT superfamily may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.47845e-126
NZ_CP053985.1\|WP_173146577.1\|4971308_4972139_+\|signal-protein	gnl\|CDD\|225837	COG3300, COG3300, MHYT domain (predicted integral membrane sensor domain) [Signal transduction mechanisms].	5.35968e-41
NZ_CP053985.1\|WP_173146579.1\|4972604_4973126_+\|prepilin-peptidase	gnl\|CDD\|227295	COG4960, CpaA, Flp pilus assembly protein, protease CpaA [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	3.82794e-07
NZ_CP053985.1\|WP_173146574.1\|4965895_4966441_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	8.22813e-10
NZ_CP053985.1\|WP_173146582.1\|4974022_4974982_+\|Flp-pilus-assembly-protein-CpaB	gnl\|CDD\|274472	TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB. Members of this protein family are the CpaB protein of Flp-type pilus assembly. Similar proteins include the FlgA protein of bacterial flagellum biosynthesis.	2.39072e-38
NZ_CP053985.1\|WP_173146573.1\|4964155_4965853_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	0
NZ_CP053985.1\|WP_173150366.1\|4952958_4954410_+\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	1.58533e-133
NZ_CP053985.1\|WP_173150365.1\|4954395_4955292_-\|DUF72-domain-containing-protein	gnl\|CDD\|376655	pfam01904, DUF72, Protein of unknown function DUF72. The function of this family is unknown.	2.53738e-57
NZ_CP053985.1\|WP_173146567.1\|4955411_4957517_+\|ATP-dependent-helicase	gnl\|CDD\|223288	COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair].	3.83412e-156
NZ_CP053985.1\|WP_173146585.1\|4977763_4979125_+\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	3.57959e-152
NZ_CP053985.1\|WP_173146580.1\|4973071_4973533_+\|pilus-assembly-protein	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	7.89366e-05
NZ_CP053985.1\|WP_173146572.1\|4962662_4964159_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.52368e-56

>NZ_CP053985.1|WP_173146574.1|4965895_4966441_-|MarR-family-transcriptional-regulator
MLQQQTYFHHEHVTGMAESAGSNRRSGMLDEVVLLLGRQFAAYNAACQSALAEKLGLPLADLKALELVMEFDALPTGHLAQLMGVSSGGATALINRLEAAGYVQRGRHPLDRRMIVIRPVEETCQMLGQERQWIAEAIATTARGYDTAELETVHAFLMRCGRSLKRDTLAWLETGSAHQAG
>NZ_CP053985.1|WP_173146573.1|4964155_4965853_+|ABC-transporter-ATP-binding-protein
MSQAPLLEVHGLDVDIASESGMTHAVKRLQLAISRRQTFALVGESGCGKSMTALALLRLLPDAGSIVGGQIDLDGEDLNRLPESAMRGVRGGRIGIIFQEPSTSLNPVMRVGDQIIETLIAHTPLRGTAARARAMDWLRRVGIPEPERRIDDYPFQFSGGQKQRVMIAIALAAEPLLLIADEPTTALDVTVQAQVLDLLADIQREMGMAVLLITHDLAVVKNVAHHVALMRGGEIVESADAEEFFRAPKHPYARQLFEAIPTFEKRGTPLTASGREAMARDEARLAASAQARETAVVLDVQDLKVHYPVRKGPLRRIASWVKAVDGVTFTLKAGETLALLGESGCGKTTTGKALLRLIDGARVSGRATLLGQDVLSADRRTLQRLRQDIQIVFQDPYASLDPRMRVGDILDEGLASLRAGMDKESRRAHAARLIERVGLPSNTLARYPHEFSGGQRQRIAIARALAVEPKVLICDEPTSALDVSVQAQILDLLRELQLELGIAYLFITHNFGVVEYLADRIAVMDGGRIIELGQADAVLHEPRQDMTRRLLAAVPRLHFGPPEAA
>NZ_CP053985.1|WP_173146572.1|4962662_4964159_+|ABC-transporter-permease
MPKFVFLWTDIALWLMVLGALAYVWHVRRSPNLRATWARVARDTPAMCSAVILAAFVVVGLLDSVHYRPLLPPAPGAAADAPPAYAPAVRSALDGLLTGSVLTTPEKTYSEPLAIRQFTKETMLVNDKPVRDFPRLRGAGVHLEDADRDHLGDVAKRLGLGLAAGLAVSAAVIGLMYAGLARRRAAGAAEEAASDVPWRAMAVTFTLLCLTAGAFAGLSSGYHALGTDRIGNDVLWQALKSIRTALVIGSLTTIAMLPPAIVFGIAAGYFKGKVDDGIQYLYTTITSIPGVLLVAACALMMQVYIDNHADLFDTSAARADLRLFLLCMILGFTGWAGLCRLLRAETLKLRELEYVQAARAFGVSHWRIMTRHLLPNVAHLVLITVVLEFSGLVLYEAVLSYLGIGVDPSMNSFGSMIDGARLEMSRDPMIWWNLLTAFLFMLALVLAANLFADAVRDAFDPRTRRYKPGRMARFGLFGRAPRTALATDTRQSRPGDAP
>NZ_CP053985.1|WP_173146571.1|4961679_4962657_+|ABC-transporter-permease
MIGYVIRRLLYGVLILIGVNLFTFILFFAVNTPDDMARLAIGGQRANQEAVEKWKVERGYDKPLFFNARAQGAAQLTDTVFYQRSVPLLVMDFGASDGGRDIGREIKTRMGPSLALAVPTFFLGLFVSIVFSLTLVYFRATRLDFWGVVVCVLLLSISSLFYIIAGQWVFAKLLRLVPFSGFSGGLDVVKFLALPVLVAIVSRLGPEARFYRTLFLEEIGKDYVRTARSKGLAERIVLFRHVLRNAMLPILTSTVAALPLLFMGSLIAESFFGIPGLGSYTIDAINAQDFSIVRAMVFLGAALYIVGLILADISYTLADPRVRFE
>NZ_CP053985.1|WP_173146570.1|4959445_4961683_+|ABC-transporter-substrate-binding-protein
MRALKRLWAAAMLLSLALAGCSQESPINSPYPSGAESQNTLFSAFVKRSPKYLDPASSYSGDETPYTYNIYETLYGYHYLKRPYELVPRAAASIDPPVYLDAQGNTLPADTPGEQIAQSIYDIKIRPGAHYAPHPAFARKTDGGYDYFPLAPGELDDKFYIPDFPRTGTRELTADDYVYAFRRLVSPRVVSPISSLMTEHVTGLKEYADRLRQRDQALRRDVPGGAVAPPWLDLREADGFTGVQALDPHTLRIRVNGKYPQFKYWLAMTFTAPIPWEADRFYSQPGMGAHDLSFNTWPVGTGPYMLVESLQNRRHVLGRNPNFHGEPYPCQGEPGDAAAGLLADCGKPTPFIDRAEFSVEKEAIPLTGKFLQGYYDVPQIERGEYGVAMLVAAGDSQDKARLYNEHGIKLPTTVETANWYMGFNWLDPVVGKGDTPEQEESNRKLRQAISIAFDWEEYVAVFENSQASVAYGPVPPGVLGYREPPEGVNPVVYNLVDGKPVRKSVDVARRLLAEAGYPDGRNAKTGAPLVLYYDSMQGGGSNPQFDWMRRQMAKIGVQLDVRATDYNRFQDKMMRGSAQIFLWGWNADYPDAENFLFLLYGPNAKAKGGGENAANYASPEYDRLFEQMKFLDDGPEKEQLIARMTAIVQRDAPWMFGYFPMSGGAYQQWVGNAKPTQMVRNTLQYMKIDAALRQQKIDEWNYPRWWPIGLFALLLALAVWPSYVALKRRERQTAFAPALGKEHQS
>NZ_CP053985.1|WP_173146569.1|4958664_4959324_+|thermonuclease-family-protein
MRGKPNFRGGSKLTALIVALILAAAGAIVNWLQPSGTPGQDRAERPAPTSQGRSGATLAGGIPQGSYTLTGMIVNVADGDTVTLRAPDGQHRIRMDSIDAPEEGHGSDQPGQPYAEAARKNLADLVAGKTLTAQCYEKDQYGREVCALILDDGRSANRLQVEAGYAWAYTARQGDYLRDKAMPDLQRQAKSAGRGLWAQPGAMQPWKWRYDCWRQRQCG
>NZ_CP053985.1|WP_173146568.1|4957580_4958585_+|magnesium-and-cobalt-transport-protein-CorA
MATEEQAADDSKREVVASIAYVNGRRDREVPIDEVAQYVSQDHGMLWIGLRNPRPEMLAKVASELGACDKNQEEMLESHRRPKIIDYGNMILIVAITVEVEAERPIFGETQFLIGDGFLVTVRRGATAGHSPLRERLEASPDLLKRGSDYVASELLDWLVDRYVAAAGKIESVVEGAEQKLLIRGAKDSDIRRLYRQRRDLLRIHTVVSPLAEICRRLARVEMSAVDEHARPYFGEVADRVLRVDELFNSLRESLAFAFEASLMIGQAAQNDTTRKLASWAAILAVPTAIAGIYGMNFEFMPELKSPLGYPITLGVIASVCSFLYWRFRKSGWL
>NZ_CP053985.1|WP_173146567.1|4955411_4957517_+|ATP-dependent-helicase
MSDQTDTSSPSAERPDPLADLNPAQREAAEFGVAGAPGDDGPLLVIAGAGSGKTNTLAHRVAHLILNGADPQRMLLLTFSRRAALEMERRVGSVLQRVMRLRATQQAPSLPWAGTFHAIGARLLRDCAQRIGLSEAFTIHDRGDAEDLMGMVRHELGLSSTKSRFPLKGTCLAIYSRVVNSQTPVADVLKTSFPWCAQWEDELKNLFRAYVAAKQDQQVLDYDDLLLYWAEMMGDPGIAADVGARFDHVLVDEYQDTNRLQSAILMAMKPDGRGLTVVGDDAQSIYSFRAATVRNILDFPGQFPTPARVITLDRNYRSTQPILNASNAVIGLATERYAKDLWTDRQSSQLPELVTVSDEAGQARWVADQVLAQREGGATLKSQAALFRTASHSAALELELTRRNIPFVKFGGLRFLEAAHVKDLLSLLRWAENPRGRMAGFRVAQLLPGIGPATAGKLMDAMSASAEPLRALREFKPGAAAQEEWGAFADTYAALCDPALKWPADVDLALRWYGAQLERLYDDARVRRADLDQLARIAAGYGTRERFLTELTLDPPDATSDESGAPHRDEDYMILSTIHSAKGQEWKAVYVLNVVDGCIPSDMSTGTAEEIEEERRLLYVAMTRAKERLQLIVPQRFYVHQQTGMGDRHVYGSRTRYITNAMLPLFDHLPKPPELPEGRGMPKAPQAPSVDVAKRVRNLFS
>NZ_CP053985.1|WP_173150365.1|4954395_4955292_-|DUF72-domain-containing-protein
MRLLTGTASWTDPTLLACGRFYPLEVRSAEARLRFYASRFPMAEVDSSYYAMPTAENAYLWAQRTPDDFVFNIKAFRLFTGHQTPLSALPADIRRELPDWPEPVIYHDQMPADLRDELWRRYPLALEPLRMAGKLGAVHFQFPPWIRRDARGRARVADCARRMEEHLVSVEFRHRSWFESPAATADTLAFERDLGVAHTVVDSPQGFDNTVPAVWECTHPELTLLRLHGRNTATWNVSGAASSSRFQYEYSEQELAELAERFARLAAQSAQAHAVFNTNFEDQGMRNAAAFAAALAPA
>NZ_CP053985.1|WP_173150366.1|4952958_4954410_+|PLP-dependent-aminotransferase-family-protein
MNKRLYRGIREAILDGAIAADSRLPASRDLAAELGIARNTVVHVYSQLLAEGYTRSRQGNGTFVNASVPDSYLDSGRRKRQPPPAQPRPALSPRGAAIVDSVSASPYQWGAFMPGVPDLTEFPHKKFGRIFSALWRNPSPDLLTYAYGGGLPALREALAQHLALTRSIDCDPEQIIITEGSHQAIDLTTRILGEAGETAWVEDPGYWGARTVLQANGLHTVHLPVDEEGMRLPETVGTPPRFIFVTPSHQYPLGPVMSLTRRRQLLAVARQSGSWIIEDDYDSEFRFSGRPIASLLGLEPDAPVIYMGTFSKTLYPGLRVGYLVLPKTLTAAFQAAHAELYREGHLMTHAALATFISEGHYAAHIRRMRMLYGRRRAMLVNLIERRLGPDWLHRDASMAGLHLVLTLPQDMDDLRVVDVARGKGVLTRALSRYYVNDEGRRPGLLLGYACVPEHDIARKFEVLLESLNEVARAPAALAASGGR
>NZ_CP053985.1|WP_173146576.1|4969100_4970723_-|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein
MRGNPVDAMPRLERPPSATQPPPYVQTATPEQLALQARLAQRIVPRNFDVSGVRAIPFEEVSGMLSPLAGKEISLGQLVQEVDKITQLYRDKGFPLSFALVQNQTFANGLVVVTVVEGYIARVRIEGDLGNAQGRLEALAAPMQEERPLKQATLERQLNLMRTVPGVKFTPSLDLPRRADGATELVLAASRQPVSLTGGIADLGTGMQPVVNLATNSLTPLGEQVKLTASVPFNTDDVKYVSGEIRVPLGADGLALKIDGYHYDARPQDDAIEMLGFERRVKNDRIGIGVSYPFLLNNTRSLTGTLGVYAANSKDRYEARNTDRWLQQDAQVRAATAEMRYIQVSETKATDVTLSVAKGFDAAGAKKDISTNYGYSATPLLDLDFTRYNLNARQTFVLPAQIGLVFSGAAQYSSNILPSSEQISYGSWRYAMGYPQGEQSGDKGVGVSAEINRRFGVGWEYLSSVQPYALVDYARTWYNNKDLQTLNQRHLSSVALGLRFTDDKYYLFDFNVAKPVGSATVNDDRNVRFNANYSLFYDAF
>NZ_CP053985.1|WP_173146577.1|4971308_4972139_+|signal-protein
MSPGDVVPLSFNGGLVALSFLIAALGSYVALLAAAGIRAETQDGEIRIGYIVIGAVAMGGVGIWSMHFIGMLAQNLPFEVGYQVGLTILSFVVAAGFSGWAFWYVGRDRFTFLRCLVGGCAAGFGVASMHYVGMSAARMPAVLLWNLPLVVLSVLIAVVAATAALWLAFNTQNERQRIGAAILMAVAVCGMHYTGAAAGAVICAAPNDAIGLHVGGAMLPYIAFALSIVTLLVMRWHLQRASKRFRARTAQRIDSIIESAPGVVTDRFPGATPGPG
>NZ_CP053985.1|WP_173146578.1|4972261_4972462_+|Flp-family-type-IVb-pilin
MKATLAQFWNDEDGITALEYGLIAGMVAVALIVAVGAFTGSLKGMFEELGTKLDNAKTGTSTPPPT
>NZ_CP053985.1|WP_173146579.1|4972604_4973126_+|prepilin-peptidase
MYPGVVLWWLLFACWILALIHADLRYRRVPNRLIVAGLAGQSLWLLAALLAPGWAYPPRWSGWLMALAGFLVAVPFLPLWRRRLMGAGDIKAIAVLGLLLGFAPLLVTLALASVLAGLHGLLYLAVSRVWALSNRARQIPYAAYLGLAACSAVLIPWSSPWYSWCSSWCFTGS
>NZ_CP053985.1|WP_173146580.1|4973071_4973533_+|pilus-assembly-protein
MEFALVFVVFFLVFYGILTYSLVVAAQHSVTLAAQDGARKVLQWQAGAASLTARAEAGRDSALYQAEWISAMSAAPVQVAVCGSAGALSSAAGGACSGLPLAQDQIEVYVSYAYGAHPLIPSVPLLQAALMPASSVLSARATVHLGNALGGGG
>NZ_CP053985.1|WP_173146581.1|4973534_4974026_+|pilus-assembly-protein
MRAYPQRPVGKTPRQRQRGIAALEFSLTLTLLLLFICGVVGFGALFWMQQQLAAAAADGARAAVHARFNGQADVPAAACLAAMGSFSAGSAVLCSTTRAPCAWTGAGGRQADCATVAMTYNTQSWPLLETVRGLITALPGTNRNWVPSRLRSQAVVQISQGTP
>NZ_CP053985.1|WP_173146582.1|4974022_4974982_+|Flp-pilus-assembly-protein-CpaB
MSSLSKIVAGMLLVAGLALAFVAWRLASAPASPPASVAPAPVEAAPAEPVKLHPVVVAREPIPAGSRIDSARMLTVAQWQVALSGGFADIAPLEGAVAKVDIAAGDPIVPSLLTQGLARQLKPGERAVAISVDEVIGGGNRIVPGDMVDVFFMIEKSAEVAVGQARLLQSQVRVLAYGRASVEGPDEKSALQQGGPGQPARTAVLAVPVDRVNELMLASRAGRLQLALRPVGDDSMPDAQLFAQRGTVLPVRADLTPAQRESLLSGSNRAYAGESLVQLDGTTAAALAPAARAASRQQGAGGGRTVEIIRGEKSERVRY
>NZ_CP053985.1|WP_173146583.1|4975047_4976409_+|type-II-and-III-secretion-system-protein-family-protein
MKKHQRTTMICLLSAAAAMTHAGLGLAQSAAPAAGASAPARDISMAVKGQQTLMLESGAPTRIAIGDPDVADVKVLPASGKRAGSVLLYGKKPGTTQLQVWTGNNAAPQIWNVRVGGSVQGALASRGLGGGANVDIAGGQAVVSGHAESQLGQIASAAMAASAVGGEKNVVDMSTAGAGGVVQVEVKVVEVSRSVMKAAGISFTASNGPWSGGSSTMPASLGGPLAAGFSLFYDSNNFSARLRLLQTNGMARVLAEPTLVALTGQSASFLAGGELPIPQAGGLGTVNVTFKPFGIGLTVTPTVLSRDRISLKVAPEASELDYTNGIAINTSADTSTIIPALRTRRADTTVELGDGESFVISGLVSRQTKAMVNKVPMLGDLPIIGAFFRSVDYSQEDTELVIVVTPRLVRPIARGVALPLPGAKQEQTDTAFNAWGYYLTGPVGGQQMPGFSR
>NZ_CP053985.1|WP_173146584.1|4976405_4977734_+|pilus-assembly-protein-CpaE
MSDMKTHASEWVGLQNGTRFLFCSQGNTVAAQLGQALGDLGMLTQESPRIEELARRLTEIAPQVVFLDFTLSDDEPGKLFKSAELARLLARIAPTVPRVAVGFLSQPEGAIAALRAGVSDFVDPSVAPQEIKEVVLRLLDRPSSGRMDGTRRSVVLLGARPGVGTSTLAVHLAGMAQDRLKLAQVQRAAAAGAKAAKPSGEPLPLSSRVALMDLGWPVGDCQLYLNIGGDFDFAEAARNLRRLDSTLLGSAMAHTANGLSVLSLPRDLGQMRDVSQSDSLLVFERMRQHFSVVVADTGGFTNPEFVSSLARASQLNWIVTDQSVGALVSLAGLLQELEQLHVERRSLGLIVNRYDERYGMTAQQIAERFQLELVGTLPDRTLPLMVCTNRGHLLHEEAERDVYVRAVQALAERLCAEESGAGGRSGWLATWLPGVHRRMVVG
>NZ_CP053985.1|WP_173146585.1|4977763_4979125_+|CpaF-family-protein
MIMTATIEFGGDGDKGFSASDRYQEVKTAAYEHLLSRIEELGAEFGRWARSAIQEFVDIEVASFVRLRRVPINEGEMRAIAEALTKELAGLGPLEDLLADPAVEDILINGYDNVFVSRRGVLARETLRFTDNQHVLRIVRRILAPIGRRLDESSPMVDARLPDGGRLNVVIEPLAVDGPMVSIRKFRQDPLKPADLLTLGSFDEEIYRLLNEAVKNRCNILVSGGTSSGKTSLLNALAFFIPETERVVTVEDTTELSLNHPHVVRLESRQGGFDGSGAVTIRELIRNSLRMRPDRVVVGEVRGAEVMDMLQAMNTGHEGSMATIHANSPRECLYRIEMLAGFAGFQGSEDSLRRQIASALDFIVQIGRLSNGKRRVLSVTEITGMGDNVISTQELYRHESYATPDGDEKDRWNWLGIHPHTPKLAKLRNEARTNDNPPDDRDGGGGGFWSRRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053985_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053985_5

5179314-5179420

Orphan

Consensus_repeat	Method
CCCCTGGGGGGAAGCGCGTAGCGCTTCGGGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053985_5

>merge|NZ_CP053985|5|5179314-5179420|CRISPRCasFinder
CCCCTGGGGGGAAGCGCGTAGCGCTTCGGGGGGAGCCCACCTTGCGGAGCCGGCTTTGCCGGTCCGCAGGCATGCCCCTGGGGGGAAGCGCGCAGCGCTTCGGGGGG

>NZ_CP053985|5|4|5179314-5179420|CRISPRCasFinder
CCCCTGGGGGGAAGCGCGTAGCGCTTCGGGGGG	AGCCCACCTTGCGGAGCCGGCTTTGCCGGTCCGCAGGCATG
CCCCTGGGGGGAAGCGCGCAGCGCTTCGGGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053985.1\|WP_088141481.1\|5174889_5175075_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370696
NZ_CP053985.1\|WP_173146849.1\|5177385_5178255_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP053985.1\|WP_173146851.1\|5178260_5179184_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP053985.1\|WP_173150375.1\|5181009_5182821_-\|dipeptide-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|182342
NZ_CP053985.1\|WP_173146855.1\|5184075_5184438_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|130454
NZ_CP053985.1\|WP_173150373.1\|5169716_5170397_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053985.1\|WP_173146857.1\|5184587_5185745_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP053985.1\|WP_173146837.1\|5170452_5171838_+\|MATE-family-protein	unknown	unknown	gnl\|CDD\|240554
NZ_CP053985.1\|WP_173146853.1\|5179422_5180955_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173853
NZ_CP053985.1\|WP_173146841.1\|5173597_5174200_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP053985.1\|WP_173146859.1\|5185976_5187248_-\|beta-ketoacyl-ACP-synthase-II	unknown	unknown	gnl\|CDD\|235781
NZ_CP053985.1\|WP_173146845.1\|5175109_5175547_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|182510
NZ_CP053985.1\|WP_173146847.1\|5175611_5177351_-\|peptidase-M14	unknown	unknown	gnl\|CDD\|349451
NZ_CP053985.1\|WP_088158209.1\|5183740_5184049_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP053985.1\|WP_173146861.1\|5187253_5187760_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP053985.1\|WP_173146839.1\|5171969_5173601_+\|lytic-murein-transglycosylase	unknown	unknown	gnl\|CDD\|372592
NZ_CP053985.1\|WP_013394879.1\|5187838_5188312_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP053985.1\|WP_035360603.1\|5182872_5183385_-\|winged-helix-DNA-binding-protein	unknown	unknown	gnl\|CDD\|227918
NZ_CP053985.1\|WP_173146863.1\|5188420_5189905_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|223594
NZ_CP053985.1\|WP_173146843.1\|5174307_5174880_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112

Protein	Function_ID	Function_description	E-value
NZ_CP053985.1\|WP_088141481.1\|5174889_5175075_+\|hypothetical-protein	gnl\|CDD\|370696	pfam09791, Oxidored-like, Oxidoreductase-like protein, N-terminal. Members of this family are found in the N terminal region of various oxidoreductase like proteins. Their exact function is, as yet, unknown.	1.0724e-13
NZ_CP053985.1\|WP_173146849.1\|5177385_5178255_-\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	3.62217e-95
NZ_CP053985.1\|WP_173146851.1\|5178260_5179184_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.02339e-113
NZ_CP053985.1\|WP_173150375.1\|5181009_5182821_-\|dipeptide-ABC-transporter-ATP-binding-protein	gnl\|CDD\|182342	PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional.	0
NZ_CP053985.1\|WP_173146855.1\|5184075_5184438_+\|response-regulator-transcription-factor	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	5.81208e-22
NZ_CP053985.1\|WP_173146857.1\|5184587_5185745_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	1.67839e-52
NZ_CP053985.1\|WP_173146837.1\|5170452_5171838_+\|MATE-family-protein	gnl\|CDD\|240554	cd13149, MATE_like_2, Uncharacterized subfamily of the multidrug and toxic compound extrusion (MATE) proteins. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. A number of family members are involved in the synthesis of peptidoglycan components in bacteria.	4.20283e-67
NZ_CP053985.1\|WP_173146853.1\|5179422_5180955_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173853	cd00995, PBP2_NikA_DppA_OppA_like, The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Similar to the ABC-type dipeptide and oligopeptide import systems, nickel transporter is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, which is the initial nickel receptor that controls the chemotactic response away from nickel. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand binding domains of ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.04472e-149
NZ_CP053985.1\|WP_173146841.1\|5173597_5174200_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.14617e-10
NZ_CP053985.1\|WP_173146859.1\|5185976_5187248_-\|beta-ketoacyl-ACP-synthase-II	gnl\|CDD\|235781	PRK06333, PRK06333, beta-ketoacyl-ACP synthase.	0
NZ_CP053985.1\|WP_173146845.1\|5175109_5175547_-\|acetyltransferase	gnl\|CDD\|182510	PRK10514, PRK10514, putative acetyltransferase; Provisional.	5.17136e-43
NZ_CP053985.1\|WP_173146847.1\|5175611_5177351_-\|peptidase-M14	gnl\|CDD\|349451	cd06232, M14-like, Peptidase M14-like domain; uncharacterized subfamily. Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavages. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.	1.44122e-71
NZ_CP053985.1\|WP_088158209.1\|5183740_5184049_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	7.26633e-05
NZ_CP053985.1\|WP_173146861.1\|5187253_5187760_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.50796e-35
NZ_CP053985.1\|WP_173146839.1\|5171969_5173601_+\|lytic-murein-transglycosylase	gnl\|CDD\|372592	pfam13406, SLT_2, Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.	5.97371e-83
NZ_CP053985.1\|WP_013394879.1\|5187838_5188312_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	8.6624e-41
NZ_CP053985.1\|WP_035360603.1\|5182872_5183385_-\|winged-helix-DNA-binding-protein	gnl\|CDD\|227918	COG5631, COG5631, Predicted transcription regulator, contains HTH domain (MarR family) [Transcription].	4.44944e-63
NZ_CP053985.1\|WP_173146863.1\|5188420_5189905_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|223594	COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones].	2.03346e-90
NZ_CP053985.1\|WP_173146843.1\|5174307_5174880_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.05262e-23

>NZ_CP053985.1|WP_173146851.1|5178260_5179184_-|ABC-transporter-permease
MTGFLIKRVLQAVFVIVAVTLLVSYAVRLTGDPALMLSQGSGSVTEQDLANIRQALGLNRPFHEQYLSYMQGLLHGDFGRSFMGGTSVAKLIGDALPATLMLAFTSLLASILISLPLGIQAAIKRGRATDQAIRILSLVGLSFPNFWLALMLVLLLSITFPLLPPSGWSGPASLVLPSLTMAIILSATNIRLVRTTMLETLSAQYIMVARSKGLKERVVLYKHALRNCAIPLITYLGLQFGGLIGGIVVIEMVFNWPGLGTLAFDAISGRDYPVLQGTVTVLASVIVLVNLIVDIAYGIVDPRIRTR
>NZ_CP053985.1|WP_173146849.1|5177385_5178255_-|ABC-transporter-permease
MQTTTPTAAAAKAAKPRSRYRSLEFVLGALLTGTMIVLVLTSGWLFPDGGEAMDLAARLTAPFASAAHPFGTDPLGRDVLARVIVGGKISLTVGFVSVVGGALLGIVMGLIAGYYRGFWDMIVMRFADVQLALPFILVAITFIAILGGGLFNVIFFMIVSQWVQYARLVRAQVLALREREFVLAARAFGVRDLAMIRHHIVPNLLGPLVILMTLNVANNILLESSLTFLGLGVDPMIPSWGGMLADGRTYMQTAWWVSVFPGLAIMLTVLGLNLLGDWLRDRLDPTGKV
>NZ_CP053985.1|WP_173146847.1|5175611_5177351_-|peptidase-M14
MSLLEKTFDRTLDAWTHAYMAPAWRGSVVEGWLFEGVEARRAAQERLAQAGVTARFRSAYKPLLHYFLEEVEREGLTSVVVRYPLHEHAQAKRFTLEAYPLIALLQGVEVSMQPGARDLHYDVSLRYADGRQIETRVHAPNQIGYAQDGTPELSPTGWLRVRDAEGALQTDAAQATEYQQAFRAIVDTVRNHAWGSHEPYFERLEIRVDLPGMDFALPVDEEIVSTFEALHEDIYFSLLEHFQKHSGRPSGDRGLQPGQIIPDIRRHDGAARVQISLEHFEALAPVAPAALDAPLAQVREPLSAGQVAGCMAAFGGDAFQAVSRQGRPVLGTYLRGPGPAVFISGAQHANETSGVVGALRAAQALAARGDAHFALIAAENPDGYALFNRLRAHHPRHMLHASRYSALGDDIAYRERAPFFEREGRHQAHAISGAQLHINLHGYPAHEWTRPLSGYLPRHFELWTIPKGFFLVLRHHPGWGDRARRLIEGVTARLARNVPGLVEFNARQLELFQAHALETGFDVLNGIPVQISESDREDLPMALISEFPDETVYGERFVFAHTVQMETVLAATELYRAGL
>NZ_CP053985.1|WP_173146845.1|5175109_5175547_-|acetyltransferase
MNIRERNHGDDLALVDIWLRSVRATHTFLTEKEIQAMYPQVLNTDLPSVRVWVCEDDAGEVAGFMGLNGNKVQMLFVDANKRGKGAGRRLLNFARSLHGTLLVDVNEQNPQAHGFYKHYGFEDMGRSEQDDAGRPRPIIHMKLAG
>NZ_CP053985.1|WP_088141481.1|5174889_5175075_+|hypothetical-protein
MSTKQIPEDDPQPVPPVAPEPEECCNSGCIPCVYDTYNEAMDDYRAALKAWRARHPEQSKG
>NZ_CP053985.1|WP_173146843.1|5174307_5174880_+|GNAT-family-N-acetyltransferase
MPAALLPDTFQTARLHARRMDETHFSFIAAMHADERLMATMGGTRTDAASRRYLLQNVEHWAEQGYGMYVLADRASCALAGRAGLKRTQSRGHDEVEVAYAFLPASWGKGYATEIAQALLALGFDRLSVEALAAVALEENAASCRVLEKCGMRQVGGAGAGGSGKRRYEIHRAEWPLPQADAAAGGGRRR
>NZ_CP053985.1|WP_173146841.1|5173597_5174200_+|class-I-SAM-dependent-methyltransferase
MTVASGTQGYGENAAALADQYESIAFADVHRDVAHLIPAAPSRIADIGAGSGRDAAALARMGHAVVAAEPTPELRQEGQRRHALPNLEWVDDALPDLAVLRGQGRLFDVIMLTAVWMHLDPDERRLSMQALAALLAPQGQILMSLRHGPVPPGRRMFDVSAQETIALAAGHGLSSHHLSEREDMLDRADVRWSFLGLRRD
>NZ_CP053985.1|WP_173146839.1|5171969_5173601_+|lytic-murein-transglycosylase
MRQRFVRLRIDTFSRVLLAAAFAAAAGGAQAQGPASATGSSAQPAVPVQTLPALTPKRSFDNTPAPAANTPAAPADDRAGQALPPRSAAPAPASLPAPAALPAPAAAPAPTAAPAATAAPAATAAPAAPAATASPAPTVIIPTELDTKACIAKLRKGATANGLTVADWDQYTANAKLLPTTVASAKGQPEGREAWWDYIAKTVDEERVRDGLGVLAKYGPQLSAISQQYQVDPATLVAIFGIETNYGRQVGKTNVLDAWLTRACTENKPLWEKNAYASVRLLRDGMVPADNFVGSWSGAFGMTQFIPTSFYELAADGDGNGKIDLYNSLPDALASTANHLRKRRAKWTHSLPAVIEVRVPAELAAAIPASPDAEYVGSQDRRTIAQWAQAGVKQGNGSALKLASGNEEQAYLFAPTGSAGPVFLATVNFDAILHYNQSRRYGLAVSMLLNRLQGGPDLVAAWPTDDPGLSRAQIKELQEMLYGLGHDVGVADGIPGSKTRDAVREEQVKRKLPEDGRVGKRIYDAIKATWPPAAIQARPAAQQ
>NZ_CP053985.1|WP_173146837.1|5170452_5171838_+|MATE-family-protein
MTSENPSTATSDPRARFVSGPMGPHVLEMVLTGWASMLAVFAVEFLSLLYLGTLKDEAVLGAVGFGSMTQFTIISVCIGVTVGGTALVSRALGAGEAPRARALAGASLVLMAAAALVSGALFLAVIGPYTAAINLAEDVRAHLLSYVLITTPFAVVMGVGMMLSNLLRAAGHGRQSMWVLLAGTAAVAALDPLVIFVLDGGMEGVAWAGGVGRLVTVALGAWLVFGKHRLVAWPAGAALRAHLAAIGRIALPAALTTLATPAAVIFTVSTYAGFGSSVMAGATVVDRVLQLAYALFFVLPGAIGPILGQNLGAGQWDRVQQTVQLTTRWSLMYGFGVAVLLALLAPWVPDLFQVTGPGRDLIVFFCRYGSFAWALNSLYFVAIAVFNNLGYATYSTAIGWLRATVGTLPFVWLGAYYGGPEGVLAGQTAGFALFSLIAMLLCRRVMRAPPAGAAVQARQAA
>NZ_CP053985.1|WP_173150373.1|5169716_5170397_+|hypothetical-protein
MGRLAAAAALAALALSGCGASRVDGVSVAWPPFRDGTLAALPADPAQCPDLAGVYRAQGEFVSGDREAGASMDLRSFLQYPLDLPGMGDNPLPEWRSGPEATVAFTAAADGWEILALDGQGARASGRLPQLNGAQDPAALPGAAQPSRPDGIRRLGGCTQGRLWISVRHDWRQYESMGVRRHVALLRPEAGGLLVTVRRESDSIGLLPWYSNEGSVYQYWFAPAGR
>NZ_CP053985.1|WP_173146853.1|5179422_5180955_-|ABC-transporter-substrate-binding-protein
MLSLRKTYTATALALALGGALPAVFATAHAAGTLNVAINQDPGSWDPIDTFVTFWGSVGSNLYDGLTMRGADLKLQPGLATSWEYLDDNKRLRFKLREGVKFHNGEPFNAEAVKFTFERLLGAEGAKGPQKANYDSIGEIKVVDEYTVDFILKQPDPVLLTKLAGYGAMIVPPKYIKEKGEDNFNTNPVGTGPFKFESYQPKVNVTLARNDDYWGGKPKLDKVVYRFIGEPGTQVAELQAGRIDIATLIPLGLIETVKKSGNADVISTGGPVAYALRYNTKNGITQNRDVRRALIMAVDRDAIVKQLLLGQAKTIASFQGPQSFGYNPEQKPLPFNPAEAKKLLAAAGVKPGATVQIDVRGSDSNFREVAQAVSGYLQGVGVRATIKPYETGVLLNDIIPGGKTGEMWQNQWGGWTYDYDNTAYLMYHTGQKWNPYDNDAKLNGMLEAQRTVYDVKKRETMLQEIAGYVADQALELPLYSLNTIVGVNKRVKDLEVPGDIRFRFLNAAVE
>NZ_CP053985.1|WP_173150375.1|5181009_5182821_-|dipeptide-ABC-transporter-ATP-binding-protein
MRGLSVDFNTENGVFRAVDNLDFEVRPGRTLAIVGESGSGKSVTSMAIMRLTDYTSGRIATGQILFRDDADREVDLTAASDEEMRAIRGNDIAMIFQEPMTSLNPVFTVGDQIVEAIMLHQQLSRSAARQSARKLLEKVRLPDAEQMLERYPHQLSGGMRQRVMIAMALSCQPRLLIADEPTTALDVTIQAQILNTIRELQRDLGTAVIFITHDMGVVAEMADDVVVMLRGKKVEQGTVDEIFNAPKHPYTRALLAAVPRLGSLTGRDLPLRTPQTVLEGDTLREVGETREQDTARYDEPVLRVEKLTTRFDVGHNFLGRVTHRVHAVEEVSFDVYPGETLALVGESGSGKSTIGKTLQQLVAPTSGAVRYNGEDIFSMDSAGRQRLRQEIQYIFQDPYASLDPRKTVAFSIAEPIRTHGLLTSEDAIARRIGELLEQVGLKPEHAKRYPHEFSGGQRQRVCIARALASNPKLIIADESVSALDVSIQAQILNLLMDLQKDRGLSYLFITHDMAVVEKVSHRVAVLYLGQIVELGTRRQIFESPQHAYTKKLLAAVPVAEPGRHIDTSLIEGEIPSPVRRVGDEPAIIPLVEFAPGHQVARAA
>NZ_CP053985.1|WP_035360603.1|5182872_5183385_-|winged-helix-DNA-binding-protein
MPVSVRDAIVSSSHLASSAPELSEVEFGLIIASHAFNRWMVRCMACAGLPELTSLDILVLNHVFHRGRGKKLADICFTLNVEDTHLVNYSLKKLERLGVVQSAKTGKEVIYTATDAGAAAIQRYAEVREQCLVKPFIDSPAADDASHQLANTLRALSGLYDQAARAATSL
>NZ_CP053985.1|WP_088158209.1|5183740_5184049_+|DUF4148-domain-containing-protein
MQMIRKAALILALSAAATGAALAQSAPPPAGLANPYGPSLTRAEVLADLALWKRAGVDRFWRGEETPDIYSPEYKAAFTEYFRLRSGPEYQAEVQRQNASRR
>NZ_CP053985.1|WP_173146855.1|5184075_5184438_+|response-regulator-transcription-factor
MAESSVINPPESSPRLQLADLELDLLRCRAYRDRQFLPLTPKEFGLLAFLMQRPGVACVGWELAEQVWKMKLHIHDKRNFKSHAVAVAMRRLRKKVDAGAGPKLLHTIRGGSYMLAAGPM
>NZ_CP053985.1|WP_173146857.1|5184587_5185745_-|porin
MKKLYAAAAATALSGAAYAQSSSVTLYGLIDTGIGYANVDGTYTDPATGSRTRVDSSRIGSTTGTTAGSRWGLRGKEDLGDGLYALFQLESGYDSRNGNSLQSGRLFGREATVGLGSADWGEVRLGRQYNVAARYFTGMFGSSFGGGFNQLNTGAGLGFSSAYFVRYDNLVVYETPSMGGFKGAIGYAFNADDRRLAQTGFATADNTRAITAGLRYDNGPVMGFATYDQLNASNKLSPSQTDATPRSYIIGGSYDFEVVKVALAYNRMSDGWFAGKGFPNGGSIGGFTGTPSYAFVKGFRSNAYMLALAAPVGRSGGAFASWQRADANNKQLTGGDATSNTYSLGYNYNLSKRTDLYAVASYTTNWAFLDNVKATEVNMGIRHRF
>NZ_CP053985.1|WP_173146859.1|5185976_5187248_-|beta-ketoacyl-ACP-synthase-II
MNMKRIVVTGMGLVSPLGCGVEHVWRSLLHGDSGIVALPPDLVEGIPSKVGGLVPAYADGHPAGFDSNLAADARDQKKMDRFILLALTAAKEALEQAKWSPATEDEQTRTATIIASGIGGFGAIADAVRITETKGPRRLSPFTIPSFLANMAAGSVAIRHGFRGPLGAPVTACAASVQAIGDAARLIRAGEADIALCGGAEACIDRVSVGAFAAARALSTNYAEHPAQSSRPFDQARDGFVIGEGAGLLVIEELQHALDRGATPIVELVGYGTSSDAYHMTSTPADGNGARRAMELALQQAGIAPSAVQHLNAHATSTQLGDSSELNAIRAVFGAAGLPAVSATKSATGHLLGAAGGVEAIFTALAIRDQIAPATHNLETPDDLASGIDIVHGAPRPMEIEYAISNGFGFGGVNASVLFRRFA
>NZ_CP053985.1|WP_173146861.1|5187253_5187760_-|helix-turn-helix-transcriptional-regulator
MKRIDLSKWACPVARSLDRVGEWWSILILRDAMYGLTRFDEFQGSLGIASNMLTRRLADLVAAGLLDRVQYSSKPPRHEYILTELGRSFRPVMLALIEWGGERFSPEGRAVQLVDKTTGRPARIGLVDLNTGLPITQDSHGLAPGPAADEVIKNRFARMAAKHAVLND
>NZ_CP053985.1|WP_013394879.1|5187838_5188312_-|Lrp/AsnC-family-transcriptional-regulator
MEKIDKFDLNIISCLQKDGALSQRELADRVGLSQNACWRRLQRLNACGIIRGTRAEVNLVELGLDLTVFVMIRTSHHAKAWADGFRQHVGRLPEVTEFYRIGGDWDYLIKVVCRGMAGYDRFYQKLITDFELSTVTGFFSMEAIIENRPPDLGGLEG
>NZ_CP053985.1|WP_173146863.1|5188420_5189905_+|aminotransferase-class-V-fold-PLP-dependent-enzyme
MNTPTKTTPAKITPLQQFQESLKTEDVAAALADGLIGKDAEVEGPYGIKPLVYADYVASGRALMQVERFILEQVLPYYANSHTEASYCGGFITRLRREARAAIARCCGAGDEHAVIFAGSGATAGINRLVHLFGVREAIAAGRKVRVIIGPYEHHSNILPWRECGAEIVELAESPEGGPDLAQLDAALQAGEGTLVVCALSAASNVTGIVADVAEVTRRVKAAGAKMLWDYAGGAPYLPIRMTPAADAAIDAIVFSPHKFIGGPGASGVLIVRRDAVLDTKPTWPGGGTVRFVSPAGHDYSGSLEAREEAGTPNVVGDIRAALVLLVKEALGAEFMRQRNQHFVQRALARWQGAAQLELLGSLTAARLPIFSFRVRNGRGGFVHQQLVTRMLSDRFGIQARGGCACAGPYVHRLLDIGADASQQMRQAILDGREMEKPGFIRLNFSVLLPDDKADFILDSVLALAADATEFEHRYGFDPSRAIFFPHSTEKQAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP053985_4	4.2\|4966928\|27\|NZ_CP053985\|PILER-CR	4966928-4966954	27	NZ_CP053985.1	4967003-4967029	0	1.0
NZ_CP053985_4	4.2\|4966928\|27\|NZ_CP053985\|PILER-CR	4966928-4966954	27	NZ_CP053985.1	4967081-4967107	0	1.0
NZ_CP053985_4	4.2\|4966928\|27\|NZ_CP053985\|PILER-CR	4966928-4966954	27	NZ_CP053985.1	4967159-4967185	0	1.0
NZ_CP053985_5	5.1\|5179347\|41\|NZ_CP053985\|CRISPRCasFinder	5179347-5179387	41	NZ_CP053985.1	1547253-1547293	0	1.0
NZ_CP053985_5	5.1\|5179347\|41\|NZ_CP053985\|CRISPRCasFinder	5179347-5179387	41	NZ_CP053985.1	1547329-1547369	0	1.0
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP053985.1	4967003-4967029	1	0.963
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP053985.1	4967081-4967107	1	0.963
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP053985.1	4967159-4967185	1	0.963

1. spacer 4.2|4966928|27|NZ_CP053985|PILER-CR matches to position: 4967003-4967029, mismatch: 0, identity: 1.0

ctccgccattggcgccgccggttgcgc	CRISPR spacer
ctccgccattggcgccgccggttgcgc	Protospacer
***************************

2. spacer 4.2|4966928|27|NZ_CP053985|PILER-CR matches to position: 4967081-4967107, mismatch: 0, identity: 1.0

ctccgccattggcgccgccggttgcgc	CRISPR spacer
ctccgccattggcgccgccggttgcgc	Protospacer
***************************

3. spacer 4.2|4966928|27|NZ_CP053985|PILER-CR matches to position: 4967159-4967185, mismatch: 0, identity: 1.0

ctccgccattggcgccgccggttgcgc	CRISPR spacer
ctccgccattggcgccgccggttgcgc	Protospacer
***************************

4. spacer 5.1|5179347|41|NZ_CP053985|CRISPRCasFinder matches to position: 1547253-1547293, mismatch: 0, identity: 1.0

agcccaccttgcggagccggctttgccggtccgcaggcatg	CRISPR spacer
agcccaccttgcggagccggctttgccggtccgcaggcatg	Protospacer
*****************************************

5. spacer 5.1|5179347|41|NZ_CP053985|CRISPRCasFinder matches to position: 1547329-1547369, mismatch: 0, identity: 1.0

agcccaccttgcggagccggctttgccggtccgcaggcatg	CRISPR spacer
agcccaccttgcggagccggctttgccggtccgcaggcatg	Protospacer
*****************************************

6. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to position: 4967003-4967029, mismatch: 1, identity: 0.963

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
ctccgccattggcgccgccggttgcgc	Protospacer
********** ****************

7. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to position: 4967081-4967107, mismatch: 1, identity: 0.963

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
ctccgccattggcgccgccggttgcgc	Protospacer
********** ****************

8. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to position: 4967159-4967185, mismatch: 1, identity: 0.963

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
ctccgccattggcgccgccggttgcgc	Protospacer
********** ****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	263057-263083	4	0.852
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	395081-395107	4	0.852
NZ_CP053985_1	1.1\|291160\|31\|NZ_CP053985\|CRISPRCasFinder	291160-291190	31	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	405259-405289	5	0.839
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KX388535	Agrobacterium tumefaciens strain EU6 plasmid pTiEU6, complete sequence	125099-125125	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000059	Agrobacterium tumefaciens strain CFBP1898 plasmid pTi_CFBP1898, complete sequence	135241-135267	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	KY000034	Agrobacterium sp. strain C58PMP90 plasmid pTi_C58PMP90, complete sequence	130087-130113	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	KY000036	Agrobacterium sp. strain GV3101 plasmid pTi_GV3101, complete sequence	131352-131378	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP042277	Agrobacterium tumefaciens strain 186 plasmid pTi, complete sequence	72771-72797	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP032929	Agrobacterium tumefaciens strain 1D1460 plasmid pTi1D1460, complete sequence	110365-110391	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP039927	Agrobacterium tumefaciens strain CFBP7129 plasmid pTiCFBP7129, complete sequence	81982-82008	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NC_002147	Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence	119659-119685	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP032925	Agrobacterium tumefaciens strain 1D1108 plasmid pTi1D1108, complete sequence	71407-71433	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_AF010180	Agrobacterium fabrum str. C58 plasmid pTiC58, complete sequence	22203-22229	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP030831	Neorhizobium sp. NCHU2750 plasmid pTiNCHU2750, complete sequence	171622-171648	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP033026	Agrobacterium fabrum strain 1D132 plasmid pTi1D132, complete sequence	72411-72437	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NC_003065	Agrobacterium fabrum str. C58 plasmid Ti, complete sequence	162957-162983	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_MK439382	Agrobacterium tumefaciens strain CFBP2178 plasmid pTiCFBP2178, complete sequence	166979-167005	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_MK439383	Agrobacterium tumefaciens strain CFBP1935 plasmid pTiCFBP1935, complete sequence	162250-162276	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_MK439386	Agrobacterium tumefaciens strain T37 plasmid pTiT37, complete sequence	152504-152530	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_MK318986	Agrobacterium rhizogenes strain C6.5 plasmid pTiC6.5, complete sequence	115868-115894	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_MK439385	Agrobacterium tumefaciens strain Kerr27 plasmid pTiKerr27, complete sequence	192552-192578	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_MK439384	Agrobacterium tumefaciens strain Kerr108 plasmid pTiKerr108, complete sequence	169465-169491	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_MK439381	Agrobacterium tumefaciens strain Sule1 plasmid pTiSule1, complete sequence	166978-167004	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_MF511177	Agrobacterium rhizogenes strain C5.7 plasmid pTiC5.7, complete sequence	115868-115894	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000039	Agrobacterium deltaense strain Tun180 plasmid pTi_Tun180, complete sequence	141043-141069	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000064	Agrobacterium tumefaciens strain CFBP7126 plasmid pTi_CFBP7126, complete sequence	79484-79510	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000069	Agrobacterium deltaense strain Tun176 plasmid pTi_Tun176, complete sequence	118668-118694	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000058	Agrobacterium rhizogenes strain CFBP1317 plasmid pTi_CFBP1317, complete sequence	134107-134133	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000068	Agrobacterium deltaense strain Tun151 plasmid pTi_Tun151, complete sequence	133160-133186	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000070	Agrobacterium tumefaciens strain Tun178 plasmid pTi_Tun178, complete sequence	49308-49334	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000031	Agrobacterium genomosp. 1 strain Tun198 plasmid pTi_Tun198, complete sequence	34388-34414	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000041	Agrobacterium tumefaciens strain CFBP296 plasmid pTi_CFBP296, complete sequence	174291-174317	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000066	Agrobacterium deltaense strain CFBP7129 plasmid pTi_CFBP7129, complete sequence	90622-90648	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000044	Agrobacterium fabrum strain CFBP1933 plasmid pTi_CFBP1933, complete sequence	108587-108613	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000050	Agrobacterium tumefaciens strain CFBP4442 plasmid pTi_CFBP4442, complete sequence	49385-49411	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000062	Agrobacterium genomosp. 3 strain CFBP4424 plasmid pTi_CFBP4424, complete sequence	183732-183758	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000057	Agrobacterium fabrum strain CFBP5505 plasmid pTi_CFBP5505, complete sequence	152027-152053	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000071	Agrobacterium tumefaciens strain Tun183 plasmid pTi_Tun183, complete sequence	52849-52875	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000047	Agrobacterium genomosp. 1 strain CFBP2516 plasmid pTi_CFBP2516, complete sequence	35475-35501	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000046	Agrobacterium genomosp. 1 strain CFBP2177 plasmid pTi_CFBP2177, complete sequence	126738-126764	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000051	Agrobacterium genomosp. 1 strain CFBP5503 plasmid pTi_CFBP5503, complete sequence	183524-183550	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000063	Agrobacterium fabrum strain CFBP6549 plasmid pTi_CFBP6549, complete sequence	72296-72322	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000052	Agrobacterium tumefaciens strain CFBP7000 plasmid pTi_CFBP7000, complete sequence	29574-29600	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000049	Agrobacterium rhizogenes strain CFBP4423 plasmid pTi_CFBP4423, complete sequence	195380-195406	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000055	Agrobacterium rubi strain Tun159 plasmid pTi_Tun159, complete sequence	58460-58486	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000043	Agrobacterium rhizogenes strain CFBP1905 plasmid pTi_CFBP1905, complete sequence	204223-204249	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000048	Agrobacterium rhizogenes strain CFBP2746 plasmid pTi_CFBP2746, complete sequence	114864-114890	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000053	Agrobacterium genomosp. 1 strain DC12-001 plasmid pTi_DC12-001, complete sequence	195058-195084	5	0.815
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_KY000054	Agrobacterium tumefaciens strain Tun154 plasmid pTi_Tun154, complete sequence	212441-212467	5	0.815
NZ_CP053985_4	4.2\|4966928\|27\|NZ_CP053985\|PILER-CR	4966928-4966954	27	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	9547-9573	5	0.815
NZ_CP053985_4	4.2\|4966928\|27\|NZ_CP053985\|PILER-CR	4966928-4966954	27	NZ_CP032196	Klebsiella pneumoniae strain AR_0097 plasmid unnamed2, complete sequence	96372-96398	5	0.815
NZ_CP053985_4	4.2\|4966928\|27\|NZ_CP053985\|PILER-CR	4966928-4966954	27	NZ_CP027615	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed3, complete sequence	102053-102079	5	0.815
NZ_CP053985_1	1.1\|291160\|31\|NZ_CP053985\|CRISPRCasFinder	291160-291190	31	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1053257-1053287	6	0.806
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	17541-17567	6	0.778
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP044424	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN1, complete sequence	66080-66106	6	0.778
NZ_CP053985_4	4.1\|4966850\|27\|NZ_CP053985\|PILER-CR	4966850-4966876	27	NZ_CP020444	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed4, complete sequence	117214-117240	6	0.778
NZ_CP053985_4	4.2\|4966928\|27\|NZ_CP053985\|PILER-CR	4966928-4966954	27	NZ_AP022335	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence	10641-10667	6	0.778
NZ_CP053985_4	4.2\|4966928\|27\|NZ_CP053985\|PILER-CR	4966928-4966954	27	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1560024-1560050	6	0.778
NZ_CP053985_1	1.1\|291160\|31\|NZ_CP053985\|CRISPRCasFinder	291160-291190	31	NC_006362	Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence	35620-35650	7	0.774
NZ_CP053985_1	1.1\|291160\|31\|NZ_CP053985\|CRISPRCasFinder	291160-291190	31	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	455539-455569	7	0.774
NZ_CP053985_1	1.1\|291160\|31\|NZ_CP053985\|CRISPRCasFinder	291160-291190	31	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	33702-33732	8	0.742
NZ_CP053985_1	1.1\|291160\|31\|NZ_CP053985\|CRISPRCasFinder	291160-291190	31	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	327107-327137	8	0.742
NZ_CP053985_1	1.1\|291160\|31\|NZ_CP053985\|CRISPRCasFinder	291160-291190	31	NC_011887	Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence	246444-246474	8	0.742
NZ_CP053985_1	1.1\|291160\|31\|NZ_CP053985\|CRISPRCasFinder	291160-291190	31	NZ_CP011274	Planctomyces sp. SH-PL62 plasmid pPL62-1, complete sequence	77495-77525	9	0.71

1. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 4, identity: 0.852

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
ctccgccaattgcgccgccggctgcca	Protospacer
******** ************.***

2. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 4, identity: 0.852

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
agccgccggttgcgccgccggttgcgc	Protospacer
  *****. ******************

3. spacer 1.1|291160|31|NZ_CP053985|CRISPRCasFinder matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

-ctacggccaaggcggcaacgacgagctgcaa	CRISPR spacer
gccgcgg-caaggcggcaatgacgagcagcaa	Protospacer
 *..*** ***********.******* ****

4. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KX388535 (Agrobacterium tumefaciens strain EU6 plasmid pTiEU6, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

5. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000059 (Agrobacterium tumefaciens strain CFBP1898 plasmid pTi_CFBP1898, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

6. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to KY000034 (Agrobacterium sp. strain C58PMP90 plasmid pTi_C58PMP90, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

7. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to KY000036 (Agrobacterium sp. strain GV3101 plasmid pTi_GV3101, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

8. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP042277 (Agrobacterium tumefaciens strain 186 plasmid pTi, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

9. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP032929 (Agrobacterium tumefaciens strain 1D1460 plasmid pTi1D1460, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

10. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP039927 (Agrobacterium tumefaciens strain CFBP7129 plasmid pTiCFBP7129, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

11. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NC_002147 (Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

12. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP032925 (Agrobacterium tumefaciens strain 1D1108 plasmid pTi1D1108, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

13. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_AF010180 (Agrobacterium fabrum str. C58 plasmid pTiC58, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

14. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP030831 (Neorhizobium sp. NCHU2750 plasmid pTiNCHU2750, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

15. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP033026 (Agrobacterium fabrum strain 1D132 plasmid pTi1D132, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

16. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NC_003065 (Agrobacterium fabrum str. C58 plasmid Ti, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

17. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_MK439382 (Agrobacterium tumefaciens strain CFBP2178 plasmid pTiCFBP2178, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

18. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_MK439383 (Agrobacterium tumefaciens strain CFBP1935 plasmid pTiCFBP1935, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

19. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_MK439386 (Agrobacterium tumefaciens strain T37 plasmid pTiT37, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

20. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_MK318986 (Agrobacterium rhizogenes strain C6.5 plasmid pTiC6.5, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

21. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_MK439385 (Agrobacterium tumefaciens strain Kerr27 plasmid pTiKerr27, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

22. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_MK439384 (Agrobacterium tumefaciens strain Kerr108 plasmid pTiKerr108, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

23. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_MK439381 (Agrobacterium tumefaciens strain Sule1 plasmid pTiSule1, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

24. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_MF511177 (Agrobacterium rhizogenes strain C5.7 plasmid pTiC5.7, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

25. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000039 (Agrobacterium deltaense strain Tun180 plasmid pTi_Tun180, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

26. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000064 (Agrobacterium tumefaciens strain CFBP7126 plasmid pTi_CFBP7126, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

27. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000069 (Agrobacterium deltaense strain Tun176 plasmid pTi_Tun176, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

28. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000058 (Agrobacterium rhizogenes strain CFBP1317 plasmid pTi_CFBP1317, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

29. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000068 (Agrobacterium deltaense strain Tun151 plasmid pTi_Tun151, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

30. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000070 (Agrobacterium tumefaciens strain Tun178 plasmid pTi_Tun178, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

31. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000031 (Agrobacterium genomosp. 1 strain Tun198 plasmid pTi_Tun198, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

32. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000041 (Agrobacterium tumefaciens strain CFBP296 plasmid pTi_CFBP296, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

33. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000066 (Agrobacterium deltaense strain CFBP7129 plasmid pTi_CFBP7129, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

34. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000044 (Agrobacterium fabrum strain CFBP1933 plasmid pTi_CFBP1933, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

35. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000050 (Agrobacterium tumefaciens strain CFBP4442 plasmid pTi_CFBP4442, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

36. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000062 (Agrobacterium genomosp. 3 strain CFBP4424 plasmid pTi_CFBP4424, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

37. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000057 (Agrobacterium fabrum strain CFBP5505 plasmid pTi_CFBP5505, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

38. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000071 (Agrobacterium tumefaciens strain Tun183 plasmid pTi_Tun183, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

39. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000047 (Agrobacterium genomosp. 1 strain CFBP2516 plasmid pTi_CFBP2516, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

40. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000046 (Agrobacterium genomosp. 1 strain CFBP2177 plasmid pTi_CFBP2177, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

41. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000051 (Agrobacterium genomosp. 1 strain CFBP5503 plasmid pTi_CFBP5503, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

42. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000063 (Agrobacterium fabrum strain CFBP6549 plasmid pTi_CFBP6549, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

43. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000052 (Agrobacterium tumefaciens strain CFBP7000 plasmid pTi_CFBP7000, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

44. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000049 (Agrobacterium rhizogenes strain CFBP4423 plasmid pTi_CFBP4423, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

45. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000055 (Agrobacterium rubi strain Tun159 plasmid pTi_Tun159, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

46. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000043 (Agrobacterium rhizogenes strain CFBP1905 plasmid pTi_CFBP1905, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

47. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000048 (Agrobacterium rhizogenes strain CFBP2746 plasmid pTi_CFBP2746, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

48. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000053 (Agrobacterium genomosp. 1 strain DC12-001 plasmid pTi_DC12-001, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

49. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_KY000054 (Agrobacterium tumefaciens strain Tun154 plasmid pTi_Tun154, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
tggcgcgatttgcgccgccgggtgcgc	Protospacer
.  *** ************** *****

50. spacer 4.2|4966928|27|NZ_CP053985|PILER-CR matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccattggcgccgccggttgcgc	CRISPR spacer
tgacgccagtggcgacgccggttgcgc	Protospacer
.  ***** ***** ************

51. spacer 4.2|4966928|27|NZ_CP053985|PILER-CR matches to NZ_CP032196 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccattggcgccgccggttgcgc	CRISPR spacer
caacgccattggcgtcgacggttgcga	Protospacer
*  ***********.** ********

52. spacer 4.2|4966928|27|NZ_CP053985|PILER-CR matches to NZ_CP027615 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

ctccgccattggcgccgccggttgcgc	CRISPR spacer
caacgccattggcgtcgacggttgcga	Protospacer
*  ***********.** ********

53. spacer 1.1|291160|31|NZ_CP053985|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 6, identity: 0.806

ctacggccaaggcggcaacgacgagctgcaa	CRISPR spacer
caacggccaaggtggcaacgacgtgctcaat	Protospacer
* **********.********** ***  *

54. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 6, identity: 0.778

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
gaccgccattttcgccggcggttgctt	Protospacer
  ********* ***** ******* .

55. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP044424 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN1, complete sequence) position: , mismatch: 6, identity: 0.778

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
gccagccctttgcgccgccggttgcct	Protospacer
 .* *** ***************** .

56. spacer 4.1|4966850|27|NZ_CP053985|PILER-CR matches to NZ_CP020444 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ctccgccatttgcgccgccggttgcgc	CRISPR spacer
gccagccctttgcgccgccggttgcct	Protospacer
 .* *** ***************** .

57. spacer 4.2|4966928|27|NZ_CP053985|PILER-CR matches to NZ_AP022335 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence) position: , mismatch: 6, identity: 0.778

ctccgccattggcgccgccggttgcgc	CRISPR spacer
gcacgccattggcgccgccgaatgcgt	Protospacer
 . *****************. ****.

58. spacer 4.2|4966928|27|NZ_CP053985|PILER-CR matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 6, identity: 0.778

ctccgccattggcgccgccggttgcgc	CRISPR spacer
gaacgccatgggcgccgccggctgcgt	Protospacer
   ****** ***********.****.

59. spacer 1.1|291160|31|NZ_CP053985|CRISPRCasFinder matches to NC_006362 (Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence) position: , mismatch: 7, identity: 0.774

ctacggccaaggcggcaacgacgagctgcaa	CRISPR spacer
ccacggacacggcggcaacgacgagccatat	Protospacer
*.**** ** ****************...*

60. spacer 1.1|291160|31|NZ_CP053985|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 7, identity: 0.774

ctacggccaaggcggcaacgacgagctgcaa	CRISPR spacer
catccggcaaggcggcaatggcgagctgcat	Protospacer
*  * * ***********.*.*********

61. spacer 1.1|291160|31|NZ_CP053985|CRISPRCasFinder matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ctacggccaaggcggcaacgacgagctgcaa	CRISPR spacer
cttcggccagggcggcaacgacgtcatcaat	Protospacer
** ******.*************   *  *

62. spacer 1.1|291160|31|NZ_CP053985|CRISPRCasFinder matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ctacggccaaggcggcaacgacgagctgcaa	CRISPR spacer
cgacggcaaaggcgtcaacgacgagttcggc	Protospacer
* ***** ****** **********.*  .

63. spacer 1.1|291160|31|NZ_CP053985|CRISPRCasFinder matches to NC_011887 (Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence) position: , mismatch: 8, identity: 0.742

ctacggccaaggcggcaacgacgagctgcaa	CRISPR spacer
gctcggccacggcggcaacgacgcgcagaag	Protospacer
 . ****** ************* ** * *.

64. spacer 1.1|291160|31|NZ_CP053985|CRISPRCasFinder matches to NZ_CP011274 (Planctomyces sp. SH-PL62 plasmid pPL62-1, complete sequence) position: , mismatch: 9, identity: 0.71

ctacggccaaggcggcaacgacgagctgcaa	CRISPR spacer
cttcggccagggcggcaacgacgtcatcacg	Protospacer
** ******.*************   *   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1317508 : 1326132

Pseudomonas_phage(28.57%)

holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173143709.1\|1317508_1317916_-	M15 family metallopeptidase	A9DET4	Yersinia_phage	3.5e-34	55.9
WP_173143710.1\|1317912_1318203_-\|holin	holin	C7BGD7	Burkholderia_phage	5.0e-11	41.3
WP_173143711.1\|1318204_1320487_-	hypothetical protein	V9VFA8	Achromobacter_phage	4.1e-132	41.9
WP_173143712.1\|1320543_1323432_-	hypothetical protein	A0A0D4DBG7	Acinetobacter_phage	2.8e-117	32.9
WP_173143713.1\|1323501_1324011_+	hypothetical protein	A0A088F840	Sulfitobacter_phage	1.6e-28	43.7
WP_173143714.1\|1324007_1324337_+	hypothetical protein	NA	NA	NA	NA
WP_173143715.1\|1324326_1325289_+	hypothetical protein	NA	NA	NA	NA
WP_173143716.1\|1325278_1325683_+	hypothetical protein	W6MWX0	Pseudomonas_phage	1.6e-07	38.3
WP_173143717.1\|1325679_1326132_+	hypothetical protein	B5WZU9	Pseudomonas_phage	2.5e-33	50.7

DBSCAN-SWA_2

4362536 : 4431391

uncultured_Caudovirales_phage(19.23%)

head,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173146113.1\|4362536_4363025_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_042794727.1\|4363162_4363741_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_173146114.1\|4363810_4364836_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	7.2e-36	28.0
WP_173146115.1\|4365081_4365468_+	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_173150311.1\|4365541_4366339_-	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
WP_173146116.1\|4367507_4368707_+	MFS transporter	NA	NA	NA	NA
WP_173146117.1\|4368720_4368885_+	hypothetical protein	NA	NA	NA	NA
WP_173146118.1\|4368973_4371637_+	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_173146119.1\|4371640_4375090_+	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_173146120.1\|4375640_4377842_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.8e-45	36.8
WP_013395612.1\|4377887_4378214_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_173146121.1\|4378233_4378842_+	recombination protein RecR	NA	NA	NA	NA
WP_173146122.1\|4378910_4380170_+	CoA transferase	NA	NA	NA	NA
WP_173146123.1\|4380181_4381222_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_173146124.1\|4381214_4382024_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	35.2
WP_173146125.1\|4382027_4382822_+	ABC transporter permease	NA	NA	NA	NA
WP_173146126.1\|4382834_4383362_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_173146127.1\|4383425_4384379_-	transaldolase	A0A0E3FNR2	Synechococcus_phage	2.8e-10	27.9
WP_173146128.1\|4384598_4385753_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.3e-51	33.3
WP_173146129.1\|4385763_4389003_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_173146130.1\|4389092_4389857_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_173146131.1\|4389861_4390506_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_173146132.1\|4390524_4391433_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_173146133.1\|4391443_4392529_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-27	36.4
WP_173146134.1\|4392525_4394238_-	iron ABC transporter permease	NA	NA	NA	NA
WP_173146135.1\|4394328_4395654_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_173146136.1\|4395782_4396211_-	FlxA-like family protein	NA	NA	NA	NA
WP_173146137.1\|4396347_4397658_+	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	1.7e-151	66.4
WP_173146138.1\|4397710_4399330_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-11	53.1
WP_054451366.1\|4399992_4400469_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_173146139.1\|4400599_4401199_-	YhbY family RNA-binding protein	NA	NA	NA	NA
WP_173146140.1\|4401217_4401850_+	RlmE family RNA methyltransferase	NA	NA	NA	NA
WP_173146141.1\|4402064_4403951_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	7.3e-111	42.1
WP_173146142.1\|4403969_4404815_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	2.0e-28	33.8
WP_173146143.1\|4404811_4406155_+	phosphoglucosamine mutase	A0A1X9I671	Streptococcus_phage	2.4e-07	24.1
WP_173146144.1\|4406366_4407173_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_173146145.1\|4407349_4408837_-	exopolyphosphatase	NA	NA	NA	NA
WP_173146146.1\|4409057_4411133_+	polyphosphate kinase 1	NA	NA	NA	NA
WP_173146147.1\|4411432_4412473_+	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	2.7e-51	39.8
WP_173146148.1\|4412632_4413649_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_173146149.1\|4413675_4414530_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_088142208.1\|4414578_4415355_+	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	9.0e-15	33.0
WP_173146150.1\|4415692_4415905_-	AlpA family phage regulatory protein	Q7M299	Enterobacteria_phage	2.3e-05	40.4
WP_173146151.1\|4415901_4416765_-	hypothetical protein	A0A077K8T2	Ralstonia_phage	1.4e-24	30.4
WP_173146152.1\|4416769_4417033_-	hypothetical protein	NA	NA	NA	NA
WP_173146153.1\|4419322_4419556_-	hypothetical protein	NA	NA	NA	NA
WP_173146154.1\|4419635_4420034_-	hypothetical protein	NA	NA	NA	NA
WP_173146155.1\|4420026_4420314_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_173146156.1\|4420616_4421018_+	helix-turn-helix transcriptional regulator	A4JWR8	Burkholderia_virus	2.3e-14	55.1
WP_173146157.1\|4421135_4421429_+	hypothetical protein	NA	NA	NA	NA
WP_173146158.1\|4421442_4422552_-	phage late control D family protein	A0A2H4JAV0	uncultured_Caudovirales_phage	3.9e-80	45.3
WP_173146159.1\|4422551_4423007_-\|tail	phage tail protein	A0A2H4JG54	uncultured_Caudovirales_phage	1.2e-32	52.8
WP_173146160.1\|4423018_4425610_-\|tail	phage tail tape measure protein	A0A2H4JE61	uncultured_Caudovirales_phage	2.5e-170	50.6
WP_173146161.1\|4425865_4425979_-\|tail	GpE family phage tail protein	E5FFG6	Burkholderia_phage	6.0e-05	66.7
WP_173150313.1\|4425987_4426329_-\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	7.9e-16	47.4
WP_173146162.1\|4426380_4426896_-\|tail	phage major tail tube protein	V9IQX1	Stenotrophomonas_phage	7.5e-50	57.1
WP_173146163.1\|4426950_4428135_-\|tail	phage tail sheath protein	A0A077K9Y4	Ralstonia_phage	1.6e-148	66.5
WP_173146164.1\|4428288_4428630_-\|tail	phage tail protein	NA	NA	NA	NA
WP_173146165.1\|4430104_4430335_-	hypothetical protein	A0A077KER5	Ralstonia_phage	1.0e-06	50.0
WP_173146166.1\|4430422_4430791_-	hypothetical protein	NA	NA	NA	NA
WP_173146167.1\|4430795_4431002_-\|tail	tail protein X	A0A2H4J946	uncultured_Caudovirales_phage	7.9e-19	65.2
WP_173146168.1\|4431001_4431391_-\|head	head completion/stabilization protein	E5E3S2	Burkholderia_phage	3.1e-24	51.9

DBSCAN-SWA_3

5992054 : 6000183

Moraxella_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173148129.1\|5992054_5992642_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.9e-21	33.9
WP_013394055.1\|5992670_5993045_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	1.9e-10	27.8
WP_173148131.1\|5993214_5994219_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_173148134.1\|5994427_5995720_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.6e-63	35.6
WP_173148136.1\|5995830_5996862_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.4e-94	52.9
WP_173148138.1\|5996911_5997553_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_173148140.1\|5997743_5998502_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.1e-65	50.8
WP_173150467.1\|5998546_5999311_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-31	46.3
WP_173148143.1\|5999328_6000183_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	6.4e-14	43.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP053985

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection