CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP054000	Finegoldia magna strain FDAARGOS_764 chromosome, complete genome	3 crisprs	csa3,PD-DExK,RT,cas9,cas1,cas2,csn2,cas3,DEDDh,DinG	0	10	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054000_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054000_1

164122-164207

Orphan

Consensus_repeat	Method
TTACCAGGTTTTTCTTCTTTGCCAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054000_1

>merge|NZ_CP054000|1|164122-164207|CRISPRCasFinder
TTTGCTGGTTTTTCTTCTTTACCAGGTTTTTCTTCTTTGCCAGGTTTTTGTTCTGGTTTTTGTTCTGGTTTTTCTTCCTTACCAGG

>NZ_CP054000|1|1|164122-164207|CRISPRCasFinder
TTTGCTGGTTTTTCTTCTTTACCAGG	TTTTTCTTCTTTGCCAGGTTTTTGTTCTGGTTTT
TGTTCTGGTTTTTCTTCCTTACCAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054000.1\|WP_002840422.1\|173165_173606_-\|peroxiredoxin	unknown	unknown	gnl\|CDD\|224146
NZ_CP054000.1\|WP_002840922.1\|155311_156007_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225818
NZ_CP054000.1\|WP_002840044.1\|154638_155304_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|340412
NZ_CP054000.1\|WP_002840982.1\|163392_163845_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054000.1\|WP_172884251.1\|167980_168529_-\|M50-family-metallopeptidase	unknown	unknown	gnl\|CDD\|100078
NZ_CP054000.1\|WP_002841058.1\|162614_163154_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP054000.1\|WP_002840743.1\|152756_154559_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP054000.1\|WP_002840771.1\|168564_169038_-\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|272878
NZ_CP054000.1\|WP_002840850.1\|150937_152773_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP054000.1\|WP_052537213.1\|161774_162440_-\|nitroreductase	unknown	unknown	gnl\|CDD\|379633
NZ_CP054000.1\|WP_002840916.1\|172237_173173_-\|TIGR01212-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|224163
NZ_CP054000.1\|WP_002840817.1\|156089_156953_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP054000.1\|WP_002837093.1\|171770_172193_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|214640
NZ_CP054000.1\|WP_002840804.1\|166803_167952_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|369468
NZ_CP054000.1\|WP_002840805.1\|173598_174435_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|319818
NZ_CP054000.1\|WP_002840693.1\|158033_160619_-\|ATP-dependent-chaperone-ClpB	unknown	unknown	gnl\|CDD\|274529
NZ_CP054000.1\|WP_002840984.1\|160637_161582_-\|J-domain-containing-protein	unknown	unknown	gnl\|CDD\|237667
NZ_CP054000.1\|WP_002840908.1\|169999_170983_-\|DUF5633-domain-containing-protein	unknown	unknown	gnl\|CDD\|173412
NZ_CP054000.1\|WP_002840029.1\|166511_166724_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054000.1\|WP_002841046.1\|165900_166452_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP054000.1\|WP_002840422.1\|173165_173606_-\|peroxiredoxin	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	3.73972e-49
NZ_CP054000.1\|WP_002840922.1\|155311_156007_-\|response-regulator-transcription-factor	gnl\|CDD\|225818	COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms].	1.52483e-24
NZ_CP054000.1\|WP_002840044.1\|154638_155304_-\|sensor-histidine-kinase	gnl\|CDD\|340412	cd16935, HATPase_AgrC-ComD-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Staphylococcus aureus AgrC and Streptococcus pneumoniae ComD which are involved in quorum sensing. This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component sensor histidine kinase (HKs) including Staphylococcus aureus AgrC which is an HK of the accessory gene regulator (agr) quorum sensing two-component regulatory system (TCS) AgrC-AgrA. The agr system plays a part in the transition from persistent to virulent phenotype. This family also includes Streptococcus pneumoniae ComD HK of the ComD-ComE TCS, involved in quorum sensing and genetic competence.	3.09711e-33
NZ_CP054000.1\|WP_172884251.1\|167980_168529_-\|M50-family-metallopeptidase	gnl\|CDD\|100078	cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-binding proteins (SREBPs) from membranes of the ER. These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD superfamily. Prokaryotic S2P/M50 homologs have been shown to regulate stress responses, sporulation, cell division, and cell differentiation. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses, and in Bacillus subtilis, the S2P homolog SpoIVFB is involved in the pro-sigmaK pathway of spore formation. Some of the subfamilies within this hierarchy contain one or two PDZ domain insertions, with putative regulatory roles, such as the inhibition of substrate cleavage as seen by the RseP PDZ domain.	1.23338e-08
NZ_CP054000.1\|WP_002841058.1\|162614_163154_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	6.27398e-16
NZ_CP054000.1\|WP_002840743.1\|152756_154559_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	7.02442e-78
NZ_CP054000.1\|WP_002840771.1\|168564_169038_-\|site-2-protease-family-protein	gnl\|CDD\|272878	TIGR00054, Putative_zinc_metalloprotease_slr1821, RIP metalloprotease RseP. Members of this nearly universal bacterial protein family are regulated intramembrane proteolysis (RIP) proteases. Older and synonymous gene symbols include yaeL in E. coli, mmpA in Caulobacter crescentus, etc. This family includes a region that hits the PDZ domain, found in a number of proteins targeted to the membrane by binding to a peptide ligand. The N-terminal region of this family contains a perfectly conserved motif HEXGH as found in a number of metalloproteinases, where the Glu is the active site and the His residues coordinate the metal cation. Membership in this family is determined by a match to the full length of the seed alignment; the model also detects fragments as well matches a number of members of the PEPTIDASE FAMILY S2C. The region of match appears not to overlap the active site domain. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	9.13179e-07
NZ_CP054000.1\|WP_002840850.1\|150937_152773_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.33395e-83
NZ_CP054000.1\|WP_052537213.1\|161774_162440_-\|nitroreductase	gnl\|CDD\|379633	pfam14512, TM1586_NiRdase, Putative TM nitroreductase. Compared with the more traditional NADH oxidase/flavin reductase family, this family is a duplication, consisting of two similar domains arranged as the subunits of the dimeric NADH oxidase/flavin reductase with one conserved active site.	2.18302e-88
NZ_CP054000.1\|WP_002840916.1\|172237_173173_-\|TIGR01212-family-radical-SAM-protein	gnl\|CDD\|224163	COG1242, COG1242, Predicted Fe-S oxidoreductase [General function prediction only].	2.23293e-107
NZ_CP054000.1\|WP_002840817.1\|156089_156953_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	5.7087e-137
NZ_CP054000.1\|WP_002837093.1\|171770_172193_-\|ATP-binding-protein	gnl\|CDD\|214640	smart00382, AAA, ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.	0.00115016
NZ_CP054000.1\|WP_002840804.1\|166803_167952_+\|MFS-transporter	gnl\|CDD\|369468	pfam07690, MFS_1, Major Facilitator Superfamily.	6.46722e-12
NZ_CP054000.1\|WP_002840805.1\|173598_174435_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|319818	cd07516, HAD_Pase, phosphatase, similar to Escherichia coli Cof and Thermotoga maritima TM0651; belongs to the haloacid dehalogenase-like superfamily. Escherichia coli Cof is involved in the hydrolysis of HMP-PP (4-amino-2-methyl-5-hydroxymethylpyrimidine pyrophosphate, an intermediate in thiamin biosynthesis), Cof also has phosphatase activity against the coenzymes pyridoxal phosphate (PLP) and FMN. Thermotoga maritima TM0651 acts as a phosphatase with a phosphorylated carbohydrate molecule as a possible substrate. Escherichia coli YbhA is also a member of this family and catalyzes the dephosphorylation of PLP, YbhA can also hydrolyze erythrose-4-phosphate and fructose-1,6-bis-phosphate. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.88029e-50
NZ_CP054000.1\|WP_002840693.1\|158033_160619_-\|ATP-dependent-chaperone-ClpB	gnl\|CDD\|274529	TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins. [Protein fate, Protein folding and stabilization].	0
NZ_CP054000.1\|WP_002840984.1\|160637_161582_-\|J-domain-containing-protein	gnl\|CDD\|237667	PRK14299, PRK14299, chaperone protein DnaJ; Provisional.	1.69988e-63
NZ_CP054000.1\|WP_002840908.1\|169999_170983_-\|DUF5633-domain-containing-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	5.8627e-11

>NZ_CP054000.1|WP_002840982.1|163392_163845_+|hypothetical-protein
MKQLQAIIPIYVDNIGNAVQLYFNDFTTTSYCSLDCCIKKIARNQLIDITEAKKLIKKSLNITKNPPICFKNGTYCMIKVRKPITKNDGSYGLFNIDSIETIETGSLTLKSNEKITTLESKKSIEDKIQKAKLARLLIDDYTTNLDILTK
>NZ_CP054000.1|WP_002841058.1|162614_163154_-|sigma-70-family-RNA-polymerase-sigma-factor
MKYDEIDYIVNNKILNDKRIYEAFDPLIISSIKNYYDRTDIFQELVDDGKTEIMYAIMEYDASKKVPFNYYLKQRLRFFYLKKNPRKSVQSLNFTNEDGDELMNLIESDENIEKDFEDRLEIKQLYERVRKLPEKQQKIIYENFLREKSAREICKKLNMKQSTFYNTRSKALENLRKMY
>NZ_CP054000.1|WP_052537213.1|161774_162440_-|nitroreductase
MVDILELMNKRHSVRKYIDEEIDSSVKKIIEEKVCEVNRESNLNIKAVFDDKEGFNSKLAKYGKFENVNNFLIMKGVGNDLSEVCGYYGEKLVMELMNLGLGSCWVALTYNKKNIKKYIQPNENLVIVIAFGIPANWGYSRKSKLPRQVSNVNEDSPQWFKDGVDCALNAPTAINQQKFMLTLEGDKVKAKARFAPSAKVDLGIVKYHFEIGSGKDHSIWL
>NZ_CP054000.1|WP_002840984.1|160637_161582_-|J-domain-containing-protein
MEYKDYYKVLGVDKKASSQEIKKAYRKLAKKYHPDLNKGDEKSQEKFKEINEAYEVLGNEDKRKKYDMFGSNYNFQGGQNFDPNAYDFGGFGGFGGFGKNSGSYTYTTGGSGGGFSDFFNAFFSGGQGSGGGFSDIFGGFKGAGRKSQPRQRYDTDISVSLSDIYNGVEKRLGLMIGDKSVNLNLKVPKGILPGKKIKVKGEKFGVDGDIYVKINLVDVYNKLEDHNIIKKVELKPWEAYFGKSINVETISGERIKVKIPKNIKANQRIRIKDKGFVDMKGVKGDLYLEISIVNPTKLNEEQEKLYKQLYELSE
>NZ_CP054000.1|WP_002840693.1|158033_160619_-|ATP-dependent-chaperone-ClpB
MDLNKFTQKSVQAIQDAQNTAIKLGNPEVTDVHLSFALLSDSDSIVAKTIQKIGADYKKIVSAFNQKIDSLPKNDSQSSVYPSTAFQRILLKAEDEAKSMGDSFISVEHIFMSILGEKNTVSAVLLRDFNVNKQNFASNLKDLRGNQKVDSDNPEDTTDVLTKYGRNLTDLAKEGKLDPVIGRDDEIRHSVRILSRRTKNNPVLIGQPGVGKTAIVEGLALRIVNDDVPETLRNKSIFALDMGSLIAGAKFRGEFEERLKAVLKEVADSDGKIIMFIDEIHTLVGAGKSEGAMDAANLLKPMLARGEIRTIGATTLDEYRKYIETDGALERRFQKVLVEEPSVEDTISILRGIKDKYEIYHGIKITDNAVIAAATLSDRYITDRFLPDKAIDLMDEASAMVRTEIDSMPESIDETKRKILQLEIERAALNKEDDEMSKIRLENLEKELQDTKNEFDAMYMEWTQQKSKVDEIKDTKSEIEAVKHEMEEAQRKYDFEKLSELKYGKLVELENKLEELNKKMDEDDSSIIKESVTEDEIAEVVSKWTSIPVTKLVETERDKILNMDKLLHKRVVGQDEAVTAVTDAIIRARSGLKSLNRPIGSFIFLGPTGVGKTELAKALTENMFDDEKNLIRIDMSEYMEKHAVSRLVGAPPGYVGYDEGGQLTEAVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGRLTDNKGRTVDFKNTIIIMTSNIGSMDLIEGIDDHGNISDESRNSVMDELKSRFKPEFLNRIDDIVMFKPLTKDDIYKIIEKQVSLLQKQLEDRQITIEIDESAEDLIIDKAYDVLYGARPVKRFIESNVETKLGRELIKGTVTDKDTVVITNVDGELGIKKK
>NZ_CP054000.1|WP_002840817.1|156089_156953_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKIRKAVIPAAGFGTRMLPASKSVPKEMLPIYDKPTLHHIVKEVVDSGITDILIIISKDKGSIEDYFDVNFELEYELNKKSSEISGEIHELSKMANIYTIRQKKKNGLGDAIKYAESFVGDEPFAILLGDDIIYNTSDELPCIKQMADIYETEESPVLGVQEVSWEDVDKYGIVNGVKTSDRITEVESLVEKPSREEATTNLAILGRYIVTPDIFPILHETKPGKNNEIQLTDALNKLAEKRKMIAYDFIGKRYDVGNKLGFVKATVDFALHDEKIKDELLEFLREK
>NZ_CP054000.1|WP_002840922.1|155311_156007_-|response-regulator-transcription-factor
MNIAIVDDEENIRNLYKKYCEEWADINKIDLKTKLFSSGENFIFNYDEKDLIDILLLDVEMKKINGVELSKRIREKNSDIQIIFISGYPEYIGYGYDVNALNFLIKPIKKEKLFELLDKATNQMNNKEKFIIVKDDGINTKILLKDIFSCISDKNYVDIFAQNKSYRIRMTLTQLLDMLDDRFFKVSRSEIINIEKIAETKKDYVLLEDDSKFLLSNAKFNELNRKIIEFY
>NZ_CP054000.1|WP_002840044.1|154638_155304_-|sensor-histidine-kinase
MRFLSKIRILFSKKDIFEYQQQLLNTHYQEVENMYRDIRKFRHNYRNHLQTLRSFVAENDMESIKNYLDNLDENLHSIAPVIRTGNRMADAILNSKITMATNENIKCIADCKISNILDIKDIDLATIIGNLFDNAIESVRNLPEEDRFIRLYMDMKGNKLYISFTNKTSSEKQEKFGRIFKSTKGENRGLGLISIDEIVDKYDGYINRNSEDNAFTTEILI
>NZ_CP054000.1|WP_002840743.1|152756_154559_-|ABC-transporter-ATP-binding-protein
MKKKYSTNDNIKFMFNLAWNNQKSLIFILIIMAITTAGIDILQLYFTPQIIKMVENSQDFTTIMLTVVVFAVLIFVCSATKESLDLRILPKKIYIRTLMLNQCIEKFLSMDYEMTLDKNVLDLSEKANVNLEGNDKATEHIWLTMKDVLYLLISTSVYLILLARLPIFIILVSIIASLISFLYSKKLKQWKYDNRKTQAKFEKEFNYINSVSSHKHAKDIRMFGLGNWLEDIYDSVFVLYDDFMNKMGNKMLMADFLDCVFNLLRNSVTYYYLINFAVNGKIDASMFLLAFSAQTKFGYDVQRLFNFFSVLFMEAKDIATVREFVDLEEKFKKDGGIELNPDEDITIKFENVGYKYPGSDEFVLKNVNFQVNPQEKVAVVGLNGSGKTTLIKLLIGFLDPTEGRVLVNGIDLRELNRRKYYEIFSAVFQDYSILPETIYMNVTQSKSTDDVKGVEKVLKLAGLYDKVKGFPNGVFNTIEKDIYQDSPVLSGGETQKLLLARALYKNSKFLILDEPTAALDPLAERDLYNKYNELTKNHTSIFISHRMASTRFCDYILLIENKGIEERGTHEELMEKGGTYKYLFDTQAKYYREDYNAKES
>NZ_CP054000.1|WP_002840850.1|150937_152773_-|ABC-transporter-ATP-binding-protein
MQKNLKLFKDTWSVLWKNYKKLIISYTLNCLFSAIFPLISIYASARMIDGIVNKMPVQFVGKWAVIALLSVFFVQIILALTNKIQNTYKDKKYEIFVHILSEKFNELDYKQSQDTDIIGQKSNIEQNTHIGEFGIIRVMYAYDMILESLLAMIGSLVLSYQFLVTKWNAPESFSFLNSAWINVLLIVVVVFLSWISQKFNAKEFEIWNKIAEQGKFGNRVFTFYCWEMKDKSRMLDTRMYRQYNLASNMINECGIFNPGGFFDRIMSTEGVTYKILSEFFSKLQVLLIYLVVVSKSLLGAISIGMLSQYLGSLINFTSNLSKFLEGVAMYKTNTPYAELMMDYLHKKSEFYNGSLTTEKRSDKKYEVEFKNVSFKYPGTDNWVLKNINLKFDLGKKLAIVGQNGCGKTTFVKLLIRFYDVTEGEILLNGINIKKYRYDEYLKIFSVVFQDFNLFAYPLAQNIASGMDYDEEKVVQSLKDVGMYDDVRKWDKGLDTYLYKDIDENGISVSKGQEQKIAIARALYQDSPFLILDEPTASLDPISEAEIYEKLGEIIKDRTAIFISHRLSSCKFSDKIIVFDKGEIAETGDHDSLISKNGMYKKLWDAQAEFYV
>NZ_CP054000.1|WP_002841046.1|165900_166452_+|hypothetical-protein
MSRFLGKIHYIMFDKINYVDEITRKMSELLDENVDLKNIERGALEDLIDTDNIHGWLQVRVAIVEDNLARVLSELKKEGKLEDALEIAYDFGAKEDFSGDASDAFQFMSDKFLDGMPCDMANLPVESNGGEFRWIKRIDVHEQYYIYGESSEIYDEFRRAWMNGLLSRCDLEYVVEDGINIIR
>NZ_CP054000.1|WP_002840029.1|166511_166724_+|hypothetical-protein
MYIREEVLKNANNKEKVSEILENYFKTNANYENEHDRDELRRRGFEELKLIGEIQVYQLLMNSDNDRTTL
>NZ_CP054000.1|WP_002840804.1|166803_167952_+|MFS-transporter
MKTSRKIYAMNLFSNLIFYAPVALLVRTNRGISLSQFFVLQAILSVTCMVCEFPLGVLTDKIGLKKSIVLAQFTMLTARIILLISNNFILFAVEALLEGIAFALNSGTISAYIYKLFGDDNYSNNISKFYNWGTIAFIVSTVMFPFINSRWNINALIWVTIIANVIATVISIFIPDTDNSVETEEQFDLSKTLKLLVHDKTFRVIVLIVSLFNLSFLLINFFYVKIIIDNGYSENIVSPLILAYSGLQLSQTFIIKYLGEQKAWNKVRLFSVIASLFFAGLCVISGKPVVLLMIILPTILSVLGIFIEKIQNNYIDTIGFKNHRATMLSAFSFFADVFEVVFLLANSYISSFNYKYIFVFIAASLLLSAIMLRNDNTVKSVS
>NZ_CP054000.1|WP_172884251.1|167980_168529_-|M50-family-metallopeptidase
MFNTLMIVVISYFVYQISQLLHEMGHAIAYRLAYQSKKWRIEIGRGKQILKTKRFKIHLIPADGACYLDDDYEEWYYKKNFIVFLAGPLVNIILFICMIPFIYDINHSADVGSFYRNIVFITFYINFWKALISLLPKEYENMKVNQTDGLKLLNIIKAMKKKRKSNTIKHTKNPLPSDKGLL
>NZ_CP054000.1|WP_002840771.1|168564_169038_-|site-2-protease-family-protein
MMIELIIKYLIIIVLVFCHEMGHILMCIIFFKCKDWKIDMGLGKVLFETKRLIIRPIIVVGKILPQLDGEYYNSKSKLQKIMIPLGGPLFNLIVLIVTIPLLISEGKMIAGYSHLFQESIKFLLRFNMAQLFWTLLPIYYKRDVPSDGRRIIEIIKN
>NZ_CP054000.1|WP_002840908.1|169999_170983_-|DUF5633-domain-containing-protein
MKFNKKLLVAVLAGTLVLGSGVSTYATADNTNNAKMLQEKVSVEVLNEILNNVDKIIEKLEKDFEAKQLEKNPKLEKLEKNPEVEKLKIEVIKERAVFDKPAVLNTEYAIGMLRHFDEAIEKIKQLKAQPEFDTKEKAEEAAKKDLETELVKNAFDLEEKDGKWHYTLKFKEIEPEKSNNSDKKEKTEEKTAEEKKQAEKEKKVDGLKNSAEKQKEEEKKKEEAKKKEEEEAKKKADEEKKAEEMKAKAKKKAEEFKKNAEKKKVTLVRKSQKVDKTSSDKKVSRPVKTTTDKKKLPKAGIETEVLTLATASLAGVLGVYTSIKKRK
>NZ_CP054000.1|WP_002837093.1|171770_172193_-|ATP-binding-protein
MVKFVVGPKGSGKTKWLIDKANDEKKNNNGNIIFIDSDDKHIFTLDHSVRLIDASTFHISSPESLYGFLAGIMSRDFDIETIYVDGIYSIVDMTEQQLEEFLENLEVLSKEANVKFFIGMNKEKSSLPAKYHEDTVELHA
>NZ_CP054000.1|WP_002840916.1|172237_173173_-|TIGR01212-family-radical-SAM-protein
MTDRYNIYSKYLKEHYGEKVYKLPIKLDLTCPNRDGRLGRGGCIYCHEEGGSFENKEKHLSIREQLEKDKQTIENKYNAHKFISYFQNYSNTYMPLELFRKYVNEAVVENVVAISVSTRPDCIAVEHLEILKQLQQEKHVDIIIELGLQTSNNKTLKIINRQHTVADFIRACLMIKKYGFRICTHVILALPWDDMDDVRETAKLLSVLKVDECKIHSLYIPKHTILAKWYEEGKVQLKSLNEYVNEVCEFLKYLDKDILIQRLVGRMPEEDSVFCNWNTSHWKIQDMIIEKMERENIFQGDNFDEKMGIII
>NZ_CP054000.1|WP_002840422.1|173165_173606_-|peroxiredoxin
MNNLKEFLNEEYYDKYKGKNLVVYIYPKDNTSGCTIEADGFSEVYDEFQKLNTEVVGISKDSEKTHENFRKKQGLKQELISDPERIFLNNFGCVYKGKMYGKEVTKTERSTFVFDKDMNLVKEFRKVKPDENPQEVLDFVRDNLND
>NZ_CP054000.1|WP_002840805.1|173598_174435_-|Cof-type-HAD-IIB-family-hydrolase
MKNNFKAVMIDLDGTLLTDDKKITDFSNQILQKLYDNGIKIIIATGRGLSRAKQLTEKLDFDKIILANNGAIIHSSSNIATDEDLMLESNVVDELSTLSKEYGIRPYFFVENKCALLIQDEEDKNRFVDSVGDIGEIMTVSERNLPIDDCVSMIMIAGKDHIYDIVDLIKTNPNVTYHIHTKYFSKNIRMLEVQNVNTDKYKRAIHVLEHFGIKSDEVVAIGDAHNDLEMIVNSGLGVAMKNSDDILKQNADIITQYTNEEDGLAKFLEELFELRDYE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054000_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054000_2

438979-439744

TypeII

Consensus_repeat	Method
GATGTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	PILER-CR
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CRISPRCasFinder
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CRT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	PILER-CR

11 spacers

csn2,cas2,cas1,cas9,csa3,PD-DExK

The CRISPR arrays of NZ_CP054000_2

>merge|NZ_CP054000|2|438979-439744|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
GAGGTTTGAGAATGATGTAATTTCATATAGGTATTAAACCAAACTACGTCAGTGGATACTACATGCTAAGTTTGAGAATGATGTAATTTCATATAGGTATTAAACGGGAAAACTGGTCCTGTTGGTCCTAAAGGTGTTTGAGAATGATGTAATTTCATATAGGTATTAAACAGTTATTTGAACATCAGTGCCGAAATCGATGTTTGAGAATGATGTAATTTCATATAGGTATTAAACCACAAAGTGAGTACGATAGTATTTACAGCAGTTTGAGAATGATGTAATTTCATATAGGTATTAAACTGTTCGATGGTAAAGAAGTACGAAGCGAAAGTTTGAGAATGATGTAATTTCATATAGGTATTAAACCGAAAAAAGAGATAATTCTGAAAAAGGACAGTTTGAGAATGATGTAATTTCATATAGGTATTAAACGAACAAAAACGGATATGGTAGCTTATCGTTCGTTTGAGAATGATGTAATTTCATATAGGTATTAAACAATTGTTAGACAATGAAGACTTAACAGAAAGTTTGAGAATGATGTAATTTCATATAGGTATTAAACCGAAAAAAGAGATAATTCTGAAAAAGGACAGTTTGAGAATGATGTAATTTCATATAGGTATTAAACTTCAACTGCATTTCTCAAATTAAAAAATGTGTTTGAGAATGATGTAATTTCATATAGGTATTAAACATTGGCAGATGCTGATATGGGAGAAATGGAGTTTGAAAATGATGTAATTTCATATAGGTATTAAAC

>NZ_CP054000|2|1|438979-439215|PILER-CR
GAGGTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CAAACTACGTCAGTGGATACTACATGC
TAAGTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	GGGAAAACTGGTCCTGTTGGTCCTAAA
GGTGTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	AGTTATTTGAACATCAGTGCCGAAATC
GATGTTTGAGAATGATGTAATTTCATATAGGTATTAAACCACAAAGTGAGTACGATAGTATTTACAGCAGTTTGAGAATGATGTAATTTCATATAGGTATTAAACTGTTCGATGGTAAAGAAGTACGAAGCGAAAGTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CGAAAAAAGAGATAATTCTGAAAAAGGACA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	GAACAAAAACGGATATGGTAGCTTATCGTTC
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	AATTGTTAGACAATGAAGACTTAACAGAAA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CGAAAAAAGAGATAATTCTGAAAAAGGACA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	TTCAACTGCATTTCTCAAATTAAAAAATGT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	ATTGGCAGATGCTGATATGGGAGAAATGGA


>NZ_CP054000|2|2|438982-439744|CRISPRCasFinder
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CAAACTACGTCAGTGGATACTACATGCTAA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	GGGAAAACTGGTCCTGTTGGTCCTAAAGGT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	AGTTATTTGAACATCAGTGCCGAAATCGAT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CACAAAGTGAGTACGATAGTATTTACAGCA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	TGTTCGATGGTAAAGAAGTACGAAGCGAAA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CGAAAAAAGAGATAATTCTGAAAAAGGACA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	GAACAAAAACGGATATGGTAGCTTATCGTTC
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	AATTGTTAGACAATGAAGACTTAACAGAAA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CGAAAAAAGAGATAATTCTGAAAAAGGACA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	TTCAACTGCATTTCTCAAATTAAAAAATGT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	ATTGGCAGATGCTGATATGGGAGAAATGGA
GTTTGAAAATGATGTAATTTCATATAGGTATTAAAC

>NZ_CP054000|2|1|438982-439744|CRT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CAAACTACGTCAGTGGATACTACATGCTAA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	GGGAAAACTGGTCCTGTTGGTCCTAAAGGT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	AGTTATTTGAACATCAGTGCCGAAATCGAT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CACAAAGTGAGTACGATAGTATTTACAGCA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	TGTTCGATGGTAAAGAAGTACGAAGCGAAA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CGAAAAAAGAGATAATTCTGAAAAAGGACA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	GAACAAAAACGGATATGGTAGCTTATCGTTC
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	AATTGTTAGACAATGAAGACTTAACAGAAA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CGAAAAAAGAGATAATTCTGAAAAAGGACA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	TTCAACTGCATTTCTCAAATTAAAAAATGT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	ATTGGCAGATGCTGATATGGGAGAAATGGA
GTTTGAAAATGATGTAATTTCATATAGGTATTAAAC

>NZ_CP054000|2|2|439312-439744|PILER-CR
	CAAACTACGTCAGTGGATACTACATGC
TAAGTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	GGGAAAACTGGTCCTGTTGGTCCTAAA
GGTGTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	AGTTATTTGAACATCAGTGCCGAAATC
GATGTTTGAGAATGATGTAATTTCATATAGGTATTAAACCACAAAGTGAGTACGATAGTATTTACAGCAGTTTGAGAATGATGTAATTTCATATAGGTATTAAACTGTTCGATGGTAAAGAAGTACGAAGCGAAAGTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CGAAAAAAGAGATAATTCTGAAAAAGGACA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	GAACAAAAACGGATATGGTAGCTTATCGTTC
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	AATTGTTAGACAATGAAGACTTAACAGAAA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	CGAAAAAAGAGATAATTCTGAAAAAGGACA
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	TTCAACTGCATTTCTCAAATTAAAAAATGT
GTTTGAGAATGATGTAATTTCATATAGGTATTAAAC	ATTGGCAGATGCTGATATGGGAGAAATGGA
GTTTGAAAATGATGTAATTTCATATAGGTATTAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054000.1\|WP_035137446.1\|446712_446913_+\|HTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|224268
NZ_CP054000.1\|WP_002841804.1\|433054_437101_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP054000.1\|WP_002841796.1\|429256_429658_+\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|197713
NZ_CP054000.1\|WP_002841803.1\|443386_443983_-\|sulfur-carrier-protein-ThiS-adenylyltransferase-ThiF	unknown	unknown	gnl\|CDD\|236320
NZ_CP054000.1\|WP_002837839.1\|442632_443397_-\|thiazole-synthase	unknown	unknown	gnl\|CDD\|234687
NZ_CP054000.1\|WP_002841754.1\|444401_445013_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|239355
NZ_CP054000.1\|WP_002841763.1\|429911_431723_+\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319847
NZ_CP054000.1\|WP_002841756.1\|447848_448814_-\|3-hydroxyacyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|224170
NZ_CP054000.1\|WP_002841787.1\|431769_432081_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054000.1\|WP_172884258.1\|439825_440857_+\|DUF1016-domain-containing-protein	PD-DExK	COG4804_PD-DExK_CAS-I:CAS-III	gnl\|CDD\|377634
NZ_CP054000.1\|WP_002841747.1\|447221_447764_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP054000.1\|WP_002841799.1\|428472_429201_+\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|223417
NZ_CP054000.1\|WP_002841788.1\|441470_442625_-\|2-iminoacetate-synthase-ThiH	unknown	unknown	gnl\|CDD\|236425
NZ_CP054000.1\|WP_002841746.1\|443984_444182_-\|sulfur-carrier-protein-ThiS	unknown	unknown	gnl\|CDD\|340451
NZ_CP054000.1\|WP_002841795.1\|432117_432693_-\|ECF-transporter-S-component	unknown	unknown	gnl\|CDD\|377783
NZ_CP054000.1\|WP_002841783.1\|438279_438927_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd09644_csn2_CAS-II-A	gnl\|CDD\|273841
NZ_CP054000.1\|WP_002841777.1\|429696_429912_+\|cation-transporter	unknown	unknown	gnl\|CDD\|366079
NZ_CP054000.1\|WP_035137451.1\|437977_438283_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP054000.1\|WP_002840658.1\|445192_446713_+\|YifB-family-Mg-chelatase-like-AAA-ATPase	unknown	unknown	gnl\|CDD\|223679
NZ_CP054000.1\|WP_002837820.1\|437100_437973_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694

Protein	Function_ID	Function_description	E-value
NZ_CP054000.1\|WP_002841804.1\|433054_437101_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	1.29019e-114
NZ_CP054000.1\|WP_035137446.1\|446712_446913_+\|HTH-domain-containing-protein	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	7.24273e-09
NZ_CP054000.1\|WP_002841788.1\|441470_442625_-\|2-iminoacetate-synthase-ThiH	gnl\|CDD\|236425	PRK09240, thiH, 2-iminoacetate synthase ThiH.	0
NZ_CP054000.1\|WP_002841796.1\|429256_429658_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	3.49358e-23
NZ_CP054000.1\|WP_002841803.1\|443386_443983_-\|sulfur-carrier-protein-ThiS-adenylyltransferase-ThiF	gnl\|CDD\|236320	PRK08644, PRK08644, sulfur carrier protein ThiS adenylyltransferase ThiF.	1.65343e-63
NZ_CP054000.1\|WP_002837839.1\|442632_443397_-\|thiazole-synthase	gnl\|CDD\|234687	PRK00208, thiG, thiazole synthase; Reviewed.	1.09664e-136
NZ_CP054000.1\|WP_002841754.1\|444401_445013_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|239355	cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Unlike mammalian GSTs which detoxify a broad range of compounds, the bacterial class Beta GSTs exhibit limited GSH conjugating activity with a narrow range of substrates. In addition to GSH conjugation, they also bind antibiotics and reduce the antimicrobial activity of beta-lactam drugs. The structure of the Proteus mirabilis enzyme reveals that the cysteine in the active site forms a covalent bond with GSH.	1.97351e-25
NZ_CP054000.1\|WP_002841763.1\|429911_431723_+\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|319847	cd07548, P-type_ATPase-Cd_Zn_Co_like, P-type heavy metal-transporting ATPase, similar to Bacillus subtilis CadA which appears to transport cadmium, zinc and cobalt but not copper out of the cell. Bacillus subtilis CadA/YvgW appears to transport cadmium, zinc and cobalt but not copper, out of the cell. Functions in metal ion resistance and cellular metal ion homeostasis. CadA/YvgW is also important for sporulation in B. subtilis, the significant specific expression of the cadA/yvgW gene during the late stage of sporulation, is controlled by forespore-specific sigma factor, sigma G, and mother cell-specific sigma factor, sigma E. This subfamily also includes Helicobacter pylori CadA an essential resistance pump with ion specificity towards Cd(2+), Zn(2+) and Co(2+), and Zn-transporting ATPase, ZiaA(N) in Synechocystis PCC 6803. Transcription of ziaA is induced by Zn under the control of the Zn responsive repressor ZiaR. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP054000.1\|WP_002841756.1\|447848_448814_-\|3-hydroxyacyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|224170	COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism].	2.41782e-67
NZ_CP054000.1\|WP_002841747.1\|447221_447764_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.54525e-20
NZ_CP054000.1\|WP_172884258.1\|439825_440857_+\|DUF1016-domain-containing-protein	gnl\|CDD\|377634	pfam06250, DUF1016, Protein of unknown function (DUF1016). Family of uncharacterized proteins found in viruses, archaea and bacteria.	9.99733e-75
NZ_CP054000.1\|WP_002841799.1\|428472_429201_+\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|223417	COG0340, BirA, Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism].	4.60981e-51
NZ_CP054000.1\|WP_002841746.1\|443984_444182_-\|sulfur-carrier-protein-ThiS	gnl\|CDD\|340451	cd00565, Ubl_ThiS, ubiquitin-like (Ubl) domain found in sulfur carrier protein ThiS. ThiS, also termed Thiamine biosynthesis protein (ThiaminS), is a sulfur carrier protein involved in thiamin biosynthesis in prokaryotes. It has the beta-grasp ubiquitin-like (Ubl) fold with low sequence similarity to ubiquitin (Ub), and is activated in an ATP-dependent manner by sulfurtransferases, similar to the activation mechanism of Ub-activating enzyme E1. ThiS has common evolutionary origin with Ub-related protein modifiers in eukaryotes, a beta-grasp fold as Ub, and is closely related to proteins MoaD and Urm1.	2.57066e-13
NZ_CP054000.1\|WP_002841795.1\|432117_432693_-\|ECF-transporter-S-component	gnl\|CDD\|377783	pfam07155, ECF-ribofla_trS, ECF-type riboflavin transporter, S component. This family is the substrate-binding component (S component) of the energy coupling-factor (ECF)-type riboflavin transporter. It is a transmembrane protein which binds riboflavin, and is responsible for riboflavin-uptake by cells.	6.91769e-27
NZ_CP054000.1\|WP_002841783.1\|438279_438927_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|273841	TIGR01866, CRISPR-associated_Csn2_family_protein, CRISPR type II-A/NMEMI-associated protein Csn2. CRISPR loci appear to be mobile elements with a wide host range. This model represents a protein found only in CRISPR-containing species, near other CRISPR-associated proteins (cas), as part of the NMENI subtype of CRISPR/Cas loci. The species range so far for this subtype is animal pathogens and commensals only. This protein is present in some but not all NMENI CRISPR/Cas loci.	1.41325e-44
NZ_CP054000.1\|WP_002841777.1\|429696_429912_+\|cation-transporter	gnl\|CDD\|366079	pfam00403, HMA, Heavy-metal-associated domain.	4.08793e-07
NZ_CP054000.1\|WP_035137451.1\|437977_438283_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	9.54367e-24
NZ_CP054000.1\|WP_002840658.1\|445192_446713_+\|YifB-family-Mg-chelatase-like-AAA-ATPase	gnl\|CDD\|223679	COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP054000.1\|WP_002837820.1\|437100_437973_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	1.59717e-99

>NZ_CP054000.1|WP_002841783.1|438279_438927_+|type-II-A-CRISPR-associated-protein-Csn2
MNIKYDLLNEPFFIDYGDICNITIENKIEYRRIIENIYNQEKIELYDDEKLITKYKVIENSAILDFADKKITTKIIKDLIEIISDEKHYEQKINLNSSIVNFINDITLDYPYMLEIGDEINFESLLKVVPIKPSVDYTDFLDKFVSFLDIYQNVLKIDVFFTINLLQYFTEEELKELSDYIKIKNICIINYDNILVDSNYISKKLLFDNDLCRVL
>NZ_CP054000.1|WP_035137451.1|437977_438283_+|CRISPR-associated-endonuclease-Cas2
MRTIVFFDLPTISLDDKKRYRAFRKFLLSEGFMMLQESVYCKLSLNQTNANTLKDRIEKNKPSMEIVQILTITEKQFQSMEYIVGENKSSMLDTDEGLIIL
>NZ_CP054000.1|WP_002837820.1|437100_437973_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRTVLISGRAKLDLKLNNLVIRKEEIVKIHIPEIAVLIIDSTMVSFTTALIEKLIAEKVKIIFCGKDHNTIGEIVNYYNKHNSPLMIRKQISWQNNSKQKTWREITKEKINRQALLLKFIGNENANLLLEYKSQVQDGDVSNREGHAAKVYFNSLFGKDFSRSQDNPTNAMLNFGYSILLSIFTREITSSGYLTQLGIFHENQFNYYNLSSDLMEPLRPMIDNIVYFYEPEKFDKEEKIATLKIMDEEVFIGKTRYTLLNAVNEYCKSVFLALEKGEEQLIKFIDYEL
>NZ_CP054000.1|WP_002841804.1|433054_437101_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKSEKKYYIGLDVGTNSVGWAVTDEFYNILRAKGKDLWGVRLFEKAKTAADTRTFRSGRRRNDRKGVRLQILREIFEDEIKKVDKDFYDRLDESKFWAEDKKVSGKYSLFNDKNFSDKQYFEKFPTIFHLRKYLMEEHGKVDIRYYFLAINQMMKRRGHFLIDGQISHVTDDKPLKQQLILLINDLLKIELEEEFMDSIFEILADVNEKKTEKKNILKELINAQDFNKQEGKILYSIFESIVTGKAKIKNIISDEDILEKIKEDNKEDFVLTGDSYEENLQYFEEVLQENITLFNTLKSAYDFVILQSILKGKSTLSDAQVERYDEHKKDLEILKKVIKKYDEDGKLFKQVFKEDNGNGYVSYIGYYLNKNKKITAKKKISNIEFTKYVKGILEKQCDCEDEDVKYLLGKIEQENFLLKQISSINSVIPHQIHLFELDKILENLAKYYPSFNNKKEEFTKIEKIRKTFTFRIPYYVGPLNDYHKNNGGNAWIFRNKGEKIRPWNFEKIVDLHKSEEEFIKRMLNQCTYLPEETVLPKSSILYSEYMVLNELNNLRINGKPIDTDVKLKLIEELFKKKTKVTLKSIRDYMIRNNFADKEDFDNSEKNLEIVSNMKSYIDFNNILGDKFELEMVEDLIEKITIHTGNKKLLKKYIEETYPDLSSSQIQKIINLKYKDWGRLSRKLLDGITGTNIETGEIDTVINFLRNSSDNLMQIIGSQNYSFNNDIDKLRKKYIPQEISYEVVENLYVSPSVKKMIWQVIRITEEITKVMGYDPDKIFIEMAKSEEGKKTTISRKNKLLALYKAIKKDERDSQYEKLLTGLNKLDDSDLRSRKLYLYYTQMGRDMYTGEKIDLDKLFDSTHYDKDHIIPQSMKKDDSIINNLVLVNKNANQTTKGNIYPVPSSIRNNPKIYNYWKYLMEKEFISKEKYNRLIRNTPLTNEELGGFINRQLVETRQSTKAIKELFEKFYKKSKIIPVKAILASDLRKDMNTLKSREVNDLHHAHDAFLNIVAGDVWNREFTSNPINYVKENREGDKVKYSLSKYFTRPRKSKGKVIWTPEKGRKLIVDTLNKPSVLISNESHVKKGELFNATIAGKKDYKKGKIYLPLKKDDRLQDVSKYGGYKAINGAFFFLVEHTKSKKRIRSIELFPLHLLSKFYEDKNTVLDYAINVLQLQDPKIIIDKINYRTEIIIDNFSYLISTKSNDGSITVKPNEQMYWRVDEISNLKKIENKYKKDAILTEEDRKIMESYIDKIYQQFKAGKYKNRRTTDTIIEKYEIIDLDTLDNKQLYQLLVAFISLSYKTSNNAVDFTVIGLGTECGKPRITNLPDNTYLVYKSITGIYEKRIRIK
>NZ_CP054000.1|WP_002841795.1|432117_432693_-|ECF-transporter-S-component
MKIKTHKLVQCAVLAALCFITFTYLQIKVPVPGGDFTSIHFGNVFLVLAALLLGGLYGGLAGAIGMTIADIMDPVYILVAPKTFVLKLCIGLIVGAIAHKSKKINESNDNKYILKWAVIASCAGMLFNVFADPFVGYFYKLYVLGQPQQIASALAKISAGVTFFNAIVTVIVANILYMAVRPVLKRSHLLD
>NZ_CP054000.1|WP_002841787.1|431769_432081_+|hypothetical-protein
MKIVGYVFLGIFAIALIYGIYSISTILAIAKIRKNVNSEKVWQTISQNNRQPVALDRILMRKNNRKFTKKEQEMILKRISTCRKCILIGLLALILAIVFIAIG
>NZ_CP054000.1|WP_002841763.1|429911_431723_+|cadmium-translocating-P-type-ATPase
MNKEIKLTIASAVFFVIGFFIREPHARLAAFAVSYLIVGIPVIKLAFLNLKNGQLFDEHFLMMIATLGAFFVGEYAEGVAVMLFYQIGEIFQDKAVGKSRESIKELMDIAPTFANLKTEDGYDKVDPYDVNVGDIIVVKPGEKVPLDCVVVDGSSMVDTKALTGESVPITVAKGEELLSGYIVMDKVLNAKVTKDFENSAVTKILDLVENASSQKSKQEKFITKFARVYTPVVVLVAAALAILMPLILKQPFQTWLYRALTFLVISCPCALVISIPLSFFSGIGASSKAGILVKGSNYIEKLAETDTVVMDKTGTLTQGVFKVVEAKSVGFSDEEMLQYVASAEKSSNHPIAQSIIDFYGNKEYLNLDSAENIAGQGINAVINGKQILAGNAKLLKDVEFEPIDTTDTVVYVAIDGKFAGYIRIADEIKQDSAQAIVDMKNVGIKKTYMLTGDNDSVAKSVAENLKIDEYKSKLLPQDKVEIVKGLIEKGRKVAFVGDGINDAPVLALSDVGISMGQIGSDAAIEASDVVIMTDELTKIAQAIKISKKTLKIAKQNAYFAIGVKIIVLILSALGLTNMWAAIFADVGVTVLAILNSFRAMRVS
>NZ_CP054000.1|WP_002841777.1|429696_429912_+|cation-transporter
MKRRYTLENLGCANCAAKMEEKIKELDGVNSVTVNFITTKMVLDVEDDKFDSVLAQAKDIIKSIEPYVEVK
>NZ_CP054000.1|WP_002841796.1|429256_429658_+|helix-turn-helix-transcriptional-regulator
MNKYSYVHIKDVRGIDKINDEKCEVTLIHEDNVKKAINELPDDELIADLSDMFKIFGDQTRVKILMALESGELCVCDIAAVMDMSQSAISHQLRVLKQSNIVKTRRQGKVVYYSISDDHVKEIFDIAIVHVQE
>NZ_CP054000.1|WP_002841799.1|428472_429201_+|biotin--[acetyl-CoA-carboxylase]-ligase
MDTEKIKEQTGINKVIFKKEVTSTNDEILNEKQDDTLMIAFFQSKGKGRYGRKFFSPENGLYFSYLVNEEMTFQQSQFITPIMGIAVSYAIDEVFGVNTSIKWVNDILLEKKKICGILTECKVEKNICHDIVVGVGINVYKSDFPEDIKDTAGFIEEKDDTDKREDLVIKIMQNFKRFWNEDRDSLVEKYRKKATFIGNEIKVHKNGDYVKAVAMNINDDFSLKVKYDNGTIEDLNIGEIFL
>NZ_CP054000.1|WP_172884258.1|439825_440857_+|DUF1016-domain-containing-protein
MNNKNNIDRVHDDVFNSIKILMDKARNEVAREVNNILVQTYWEIGRIIVEDEQGHSERAEYGRELLKDLSKRLTKEYGRGFSVSNLQFMRRFFQEYEIQQTVSVKLTWSHYCELLSISDEKKRSFYEKESINANWSVRELKRQIKTSLFERLLLSSGEENKEKVLDLALKGNEINKPDDLVKDPYVFEFLGLPEEKPMMESDLEKALIDHIEKFLLELGKGFMYVGSQQRVTLGNIHYYVDMVFYNKILRSYVLIELKTSKLMPEAVGQINMYLNYYKSEVNDEMDNEPIGIILCTDKDGVQAEYALGNLSNKIFASKYTLYIPNIEELEEQVEKVIEKYKEK
>NZ_CP054000.1|WP_002841788.1|441470_442625_-|2-iminoacetate-synthase-ThiH
MEDFKYFNNMQDIHSDIYDKISEKLNEVKSVNVTADDVRRTLGKIKNNEALDHFDYYNMLSNAAIDFIEELGEISQKLRLQYFGNNVYLFSPLYIANYCENSCKYCGFRAKSDIVRAKLTMDEIESEMKQMRREKIEDVLILTGESQKYSSVDYICDAVKLAKKYFRVVGVEVYPTNVEDYKKLHEAGCDFVTAFQETYNPTNYKFYHPTGHKSCFPYRLDTQERAIMGGIRGVGFGALFGLSDGLEDCFCLGMHANLLQKKYPHAEISISFPRIRPTKNEEDLNIKEVPETKLMQFIIATRIFLPFAQITISTRESNEFRNLSLLMGATKISASVDTGIGRRNDEKDKGDEQFLINDTRTVDQVEKDLKKYNLYPVYSDYIDV
>NZ_CP054000.1|WP_002837839.1|442632_443397_-|thiazole-synthase
MEDKLILGGKSFDSRFILGSGKYDPNLIKACVESAGCEMITVALRRANTDDTKNILNFIPENVTIIPNTSGARNADEAIRIARLAREMGCGNFVKIEIMRDSKYLLPDNVETLKATKVLADEGFVVMPYMYPDLNFARDLKEAGASCIMPLGSPIGSNKGLATRDFIQIIINEIDLPVIVDAGIGKPSQACEAMEMGASAIMANTAIATSGDINKMAEAFALAIKAGRLAHIAKPGRVLETGADPSSPLRDFFK
>NZ_CP054000.1|WP_002841803.1|443386_443983_-|sulfur-carrier-protein-ThiS-adenylyltransferase-ThiF
MENIFKRQIPEHTLIFRKSKILILGCGGLGTNLCFMLAKSGVGHIKIVDYDTVEYSNLNRQIYRPTDVGKYKVDAFKEICDEFLPFANISVENIKITENNIDELTDGYDIVLEALDDEYAKSLVLEHFIGTDKKLVSVSGIGGVKKLDMKIKKMNNIVVCGDFETKTDIGLYYPNVIMAASTQAIIALNWLLEENNGR
>NZ_CP054000.1|WP_002841746.1|443984_444182_-|sulfur-carrier-protein-ThiS
MITVNSVKYPFEENSSLRKVLEDLNFNVELTVCEVNKNLVKKVDYDNFIVTDNDEIEVFSFVGGG
>NZ_CP054000.1|WP_002841754.1|444401_445013_+|glutathione-S-transferase-family-protein
MKLYYAPGTCAVACWIALEWAGADYEVEKVQLGTDEYRKINPLGAVPALDIGEGVVRSELAAILRYVLHKYPEKDLGADESPEDKFQFDEIMAFMTGDFHPAFEALFVPAGLTTSTDEAEIDKIKQKSFETIDKMMTHLDRLIGDGDHVYKNKKTVLDAYVYVLTRWSELTPKSWKEYPNINRVSKAIEKDEVVQEIMKKSQE
>NZ_CP054000.1|WP_002840658.1|445192_446713_+|YifB-family-Mg-chelatase-like-AAA-ATPase
MYSKVKTCCLEGLNGYVVECECDLANGLRSFNIVGLPDASIKESKERVRSAIENTGIRFPVKRITINLAPANLRKEGSQLDLAIAMAILQSMGVVEDFSEKWAFIGELSLDGRLNPVNGSLCMVLSLKDLGYERVYIPKQNAQECSMVKGIEKVCVESLDEIIRILNGEQELKILDDIDIMQQEIHYDVDFSDIKGQKFLKRAMEISAAGFHNLLMIGPPGSGKTMSAMRLSTILPDMSFDEIMETTKIYSVAGLLGEKNIVTTRPFRSPHHTASQVSLIGGGRVPKPGEISLAHNGALFLDELPEFSKSTIEVLRQPLETKNITITRVNASLSYPANFLFVAGMNPCPCGYYGDPNHECTCSQNQIANYLNKVSRPILDRIDIHVEVSPVKLDELTTDEQCDTSEQIKKRVEAAREIQKQRFKNEKITTNSQMNTRQIRKYCKLNDELNSIIQLAFDKYKFSARSFDKILKISRTIADLDGKENIEAKHLMEAIRYRTVDQKYWG
>NZ_CP054000.1|WP_035137446.1|446712_446913_+|HTH-domain-containing-protein
MGQHVARVHAQDNAQKDAHAQDDAHKMTPKERRQEIIKILEENPEISTLELSKIFSVSRSTISRDL
>NZ_CP054000.1|WP_002841747.1|447221_447764_+|GNAT-family-N-acetyltransferase
MKIQLESFADKYKEKIWRDGFYEKSPEWAKFNGPYFEDYIHYETLESFEKSGIWKYLQQPNCKAILVDGVVVGMVSQNWVDEKTRWMEIGIVIYDENYWNKSIGTKALKLWTSEVFNDNPQIEHLGLTTFSGNPRMMKAAEKIGFIQEARIRKVRYWKGTYYDSMKYGVTRDEWEKLSQK
>NZ_CP054000.1|WP_002841756.1|447848_448814_-|3-hydroxyacyl-CoA-dehydrogenase-family-protein
MARKFEKACVIGGGVIGSSFTLLFAMGKMDVILYNLDENEENKSKKIIEKYVDELIEKNVVSEDKQTIMARIRYTTDKKEAIEFADIVEECIPENYDVKKEFVKVFEKYAKPDCVLCSATSGLLITKIAEDAKHPERIFGAHPYNPPHLIPLIEISQGEKSDPEIADALRELFVRLGKKPIVIRNEVPGFIANRLQAVVLREMMDLVDKGVVSMEDCETALTFGPAIRWAIMGPGQIFELGGGEHGLQGLLDHIGPSMETWLEDAATWTKFTDDIKKKTVDGIHEAIKNRPQDIGNTHETLAKYRDGMLVEILRLHKDYKI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054000_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054000_3

589624-589722

Orphan

Consensus_repeat	Method
TTTTGTCAGTGTCTTCTTTTTTGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054000_3

>merge|NZ_CP054000|3|589624-589722|CRISPRCasFinder
CTTGTTGTGTGTCTTCTTTTTTGTCAGTGTCTTCTTTTTTGTCAGTGTCTTCTTTTTTATCTTCTTTTTGTTCTGTTTTATCAGTGTCTTCTTTTTTGT

>NZ_CP054000|3|3|589624-589722|CRISPRCasFinder
CTTGTTGTGTGTCTTCTTTTTTGT	CAGTGTCTTCTTTTTTGTCAGTGTCTTCTTTTTTATCTTCTTTTTGTTCTG
TTTTATCAGTGTCTTCTTTTTTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054000.1\|WP_002841475.1\|601294_602605_+\|polysaccharide-biosynthesis-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|240548
NZ_CP054000.1\|WP_002841895.1\|586940_587516_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|225095
NZ_CP054000.1\|WP_002841222.1\|595876_597340_+\|4-alpha-glucanotransferase	unknown	unknown	gnl\|CDD\|237738
NZ_CP054000.1\|WP_002841212.1\|594138_595875_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP054000.1\|WP_002841405.1\|602625_603126_+\|DNA-deoxyinosine-glycosylase	unknown	unknown	gnl\|CDD\|381682
NZ_CP054000.1\|WP_002837471.1\|598195_598834_+\|thiamine-phosphate-synthase	unknown	unknown	gnl\|CDD\|234590
NZ_CP054000.1\|WP_002841322.1\|591856_592351_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054000.1\|WP_002841293.1\|592412_594161_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP054000.1\|WP_002841306.1\|597399_598203_+\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|180561
NZ_CP054000.1\|WP_141562157.1\|580692_581607_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP054000.1\|WP_002841890.1\|579726_580578_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP054000.1\|WP_002841894.1\|582313_583606_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054000.1\|WP_002841893.1\|578900_579740_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP054000.1\|WP_002841904.1\|584356_585091_+\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143587
NZ_CP054000.1\|WP_002841902.1\|588552_588795_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_CP054000.1\|WP_002841891.1\|583853_584357_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225695
NZ_CP054000.1\|WP_172884264.1\|589959_590886_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP054000.1\|WP_172884263.1\|581549_582143_-\|transposase	unknown	unknown	gnl\|CDD\|225511
NZ_CP054000.1\|WP_002841901.1\|578047_578914_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP054000.1\|WP_002841344.1\|590965_591742_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|132848

Protein	Function_ID	Function_description	E-value
NZ_CP054000.1\|WP_002841475.1\|601294_602605_+\|polysaccharide-biosynthesis-C-terminal-domain-containing-protein	gnl\|CDD\|240548	cd13143, MATE_MepA_like, Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Streptococcus aureus MepA. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. This subfamily includes Streptococcus aureus MepA and Vibrio vulnificus VmrA and functions most likely as a multidrug efflux pump.	4.12973e-95
NZ_CP054000.1\|WP_002841895.1\|586940_587516_+\|Fic-family-protein	gnl\|CDD\|225095	COG2184, Fic, Protein involved in cell division [Cell division and chromosome partitioning].	1.78756e-43
NZ_CP054000.1\|WP_002841222.1\|595876_597340_+\|4-alpha-glucanotransferase	gnl\|CDD\|237738	PRK14508, PRK14508, 4-alpha-glucanotransferase; Provisional.	0
NZ_CP054000.1\|WP_002841212.1\|594138_595875_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.27773e-149
NZ_CP054000.1\|WP_002841405.1\|602625_603126_+\|DNA-deoxyinosine-glycosylase	gnl\|CDD\|381682	cd10032, UDG-F6_HDG, Uracil DNA glycosylase family 6, includes hypoxanthine-DNA glycosylase and similar proteins. Uracil DNA glycosylase family 6 hypoxanthine-DNA glycosylase (HDG) lacks any detectable UDG activity; it excises hypoxanthine, a deamination product of adenine, from double-stranded DNA. Uracil-DNA glycosylase (UDGs) initiates repair of uracils in DNA. Uracil in DNA can arise as a result of misincorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	2.23395e-67
NZ_CP054000.1\|WP_002837471.1\|598195_598834_+\|thiamine-phosphate-synthase	gnl\|CDD\|234590	PRK00043, thiE, thiamine phosphate synthase.	1.53716e-78
NZ_CP054000.1\|WP_002841293.1\|592412_594161_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	9.63515e-163
NZ_CP054000.1\|WP_002841306.1\|597399_598203_+\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	gnl\|CDD\|180561	PRK06427, PRK06427, bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed.	4.72767e-132
NZ_CP054000.1\|WP_141562157.1\|580692_581607_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.47809e-42
NZ_CP054000.1\|WP_002841890.1\|579726_580578_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	5.21582e-62
NZ_CP054000.1\|WP_002841893.1\|578900_579740_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	2.48036e-82
NZ_CP054000.1\|WP_002841904.1\|584356_585091_+\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143587	cd07197, nitrilase, Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes. This superfamily (also known as the C-N hydrolase superfamily) contains hydrolases that break carbon-nitrogen bonds; it includes nitrilases, cyanide dihydratases, aliphatic amidases, N-terminal amidases, beta-ureidopropionases, biotinidases, pantotheinase, N-carbamyl-D-amino acid amidohydrolases, the glutaminase domain of glutamine-dependent NAD+ synthetase, apolipoprotein N-acyltransferases, and N-carbamoylputrescine amidohydrolases, among others. These enzymes depend on a Glu-Lys-Cys catalytic triad, and work through a thiol acylenzyme intermediate. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. These oligomers include dimers, tetramers, hexamers, octamers, tetradecamers, octadecamers, as well as variable length helical arrangements and homo-oligomeric spirals. These proteins have roles in vitamin and co-enzyme metabolism, in detoxifying small molecules, in the synthesis of signaling molecules, and in the post-translational modification of proteins. They are used industrially, as biocatalysts in the fine chemical and pharmaceutical industry, in cyanide remediation, and in the treatment of toxic effluent. This superfamily has been classified previously in the literature, based on global and structure-based sequence analysis, into thirteen different enzyme classes (referred to as 1-13). This hierarchy includes those thirteen classes and a few additional subfamilies. A putative distant relative, the plasmid-borne TraB family, has not been included in the hierarchy.	5.94768e-23
NZ_CP054000.1\|WP_002841902.1\|588552_588795_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	4.20303e-05
NZ_CP054000.1\|WP_002841891.1\|583853_584357_+\|hypothetical-protein	gnl\|CDD\|225695	COG3153, COG3153, Predicted acetyltransferase [General function prediction only].	2.5255e-09
NZ_CP054000.1\|WP_172884264.1\|589959_590886_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	9.1448e-27
NZ_CP054000.1\|WP_172884263.1\|581549_582143_-\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.15512e-07
NZ_CP054000.1\|WP_002841901.1\|578047_578914_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	8.3806e-74
NZ_CP054000.1\|WP_002841344.1\|590965_591742_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|132848	cd07209, Pat_hypo_Ecoli_Z1214_like, Hypothetical patatin similar to Z1214 protein of Escherichia coli. Patatin-like phospholipase similar to Z1214 protein of Escherichia coli. This family predominantly consists of bacterial patatin glycoproteins and some representatives from eukaryotes and archaea. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates.	8.7332e-62

>NZ_CP054000.1|WP_002841902.1|588552_588795_-|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MKINTKNLVSITEANQNFSKVARLVDEQGSAVILKNNNPKYVIIKYTEFESEQNADDEYITEISKRILKQNKKAYKELSK
>NZ_CP054000.1|WP_002841895.1|586940_587516_+|Fic-family-protein
MGRFIDEELLSKRRAIELWDKGLINNFEVGTYKGLQEIHAFLFQDIFDFAGKTRDVNLSKGNFRFANLLYLESNLAIIERMPEGSFDEIIEKYVEMNVAHPFREGNGRATRIWLDLMLKKNLNKCIDWTMVDRSDYLSAMERSPVNSLEIKHLLKNVLTDKVDDRGVYLRGIQQSYVYEDLDRYDIEDIEE
>NZ_CP054000.1|WP_002841904.1|584356_585091_+|carbon-nitrogen-hydrolase-family-protein
MKISLCAVEQRLNDKEFNLKQIEKYAREEALNGADMCVFGESFLQGFECLSFVYKDDVGVPVTQNSNEIAEIRRIARENEVAISLGYIENDHGAFYSSQMTVTKRGDILNNYRRMSPGWKEPSACSDYREGDKLYLFKMDGVSFSTLICGDFWDEDLYTYISMIDSDILLWPVFVDFSVIDWYKNEFEDYKKQSQLVPMPVLFVNSFVDEDDRAKGGAYVFYQGKVVEELEPGEAGVLRYEYKK
>NZ_CP054000.1|WP_002841891.1|583853_584357_+|hypothetical-protein
MRNRLYNADDYDRCCDLLRDSNMRYSFSEKSDAKLFEDIVASESFCEDCTFVLEDGDAICGIVMFTKCRVRKFDGLLLSIFYIDDEHLSDDNVDLLVGNAVNDVMGLGVKFVCVMGEPSVFTRFGFTRARDYGILCPFYIEDDYFMARCEDGFKTRGELSYAKEFFE
>NZ_CP054000.1|WP_002841894.1|582313_583606_+|hypothetical-protein
MTKKSVELEESEALEELVNKYKEKIENVDAINEFPGEYNPWKGKNFDEFLDDFFEALKNDDKEFSWLKIDEDLYNELKDKKGKAVSIDYGIPSHVRGDIENGTLFLCLVNPNIDVKVAMCEAVGKQDKEDIKKYIFDISSKGGILYKEIVELKGMKNLIGLEESDEDKNKEKNKKGYYTANYLNVILSAIDDYKNKDEKEYEDLKKAVKAFKRFTRTLKNDDENKPKNDKNIKNEDLKNFVEKSKKIVNLEAFPFRSSTPNFAIDEDNAKDRFANCLVNSNSNVSMLSARIIIWKILEYIINPKDNVKPVFIFRRFNRAWRPSIENVLRKDFFEKDKDDSVKEDKAINIAIDNIIKKLHEEFFYTIGPKDQDNMLKMSKNIYKNDVNMYKEYKEEEYKEEEYKEKENDRKNKKEVFSKLITDALTSQKRQ
>NZ_CP054000.1|WP_172884263.1|581549_582143_-|transposase
MAKYSTEFKMKVVKEYLETNISYKSLLEKYKLSHHEIVKRWVNAYKSQGYEGLKVKRENTQYTLEFKLNVVNLYLTGEMSYQSLANNLKINNPSIITRWVTEYREKGIEGLRPKKRGRPSKMTKTPKKSKDTKLELSSKSTNEEDNSLNEAQLKEKIKKLEERNYWLQLENDAIKKKIELSQMTDTEIRQLLKQLRS
>NZ_CP054000.1|WP_141562157.1|580692_581607_-|IS3-family-transposase
MVSNDRYRNKTIAETIEVLRNKYKLKDLLKYFNIPKSTYMYWQKRLNKPNKDIEIEKKILKIRKDNPNYGYRRITAMLKRAGLIINKKKVQRLVQKLKLQVKSYSRKSRKYSSYKGQVGKISDNKIKRNFKVEKPYTKITTDTSEFKYLEKDKTGTYQIKKLYLNPYLDMYNSEIISYEISKYPTIEPILKALDKAIKITNKSKEKRIFHSDQGWAYQTNQYTSRLETNGITQSMSRKGNCLDNSPMENFFGILKQEIYYGRKFYSYEHLKQTIEDFIKYYNEERIKEKLGYLSPVEYRKKNAA
>NZ_CP054000.1|WP_002841890.1|579726_580578_+|class-C-sortase
MRSSRKFGYVILFVGIGLLTFCLSNLSYKIFSQDKKMDDFLRTQGEMSTELSERIDKYNSNVNVDETGLVDPFNSEDIELESSKVIDENGIFGYLEIPKINFKKPIYLGASYNHLAKGVGQLDGTSIPVGGKGRRSVLAGHRGWYGDIMLLKVGQLYSNDVVYVHHHGKTLTYKVVGREYISPSDWDRLKPVEDKDMLTILSCDPMYPPFTRRILINSVRVDENSGKATTDATNKNNAATMNTKSNSSSKTVDYVLLALTIVAWIVLIVNIRKFVLDIRRHGK
>NZ_CP054000.1|WP_002841893.1|578900_579740_+|class-C-sortase
MKKSKLKENLKYVLIFLVGFAVAMYPLISRLYYRIEANSAVHDFDTAAKKIDKKEIDRRIRLAQIYNKTLDPSKLADPYSEKEKKNAISEYARMLEVKEKIGHVEIPKINQDLPIYAGTSEEVLQKGVGHLEGTSLPVGGKGTHAVLTAHRGLPTAKLFTDLNKMKKGDVFYIHNIKEVLAYKVIDVFVVEPSDFDKVLVVEGKDYCTLLTCTPYMINSHRLLVRAERTEYNPAAVEKDLVSQVTGKYKIYLIISLIIIAILLWYYIRQRRRKKNNEIK
>NZ_CP054000.1|WP_002841901.1|578047_578914_+|class-C-sortase
MWKKIKHNFVFILIFLLGFGVMMYPVISRLYYRVDSTNQVKEFDKAVKGLSKEELDKRLALAKGYNDSLNNVVSKDPYDKKNQEEGRKAYARMLEVKEKIGHVEIPKINQDLPMYAGTSEDVLQIGIGHLEGTSLPIGGNNTHAVLTAHSGLPTAKLFTDLKMMKIGDKFYVHNIFGTLAYQVDQIKIVEPSNFNDLLIVKGHDYCTLLTCTPIMINSHRLLVRGHRVPYVPAVDEALIADNKASYIYRYLFYVSLVIIAILLYLIYRQRKAKKKLKELDVEDKHEEV
>NZ_CP054000.1|WP_172884264.1|589959_590886_-|YdcF-family-protein
MYALLLISAILLIIAATDNFISMFTATSTILFVISAISLIFTPHSNVILNIIIAINVITNLFILAIISYRLYQKAKVKANIALHLSASLLYIAMIAINLFKIFDLYKYIIGMNSYLSLMVLSHLLGNLIIKYQKIATDFDYIIVLGGSMKGIELSDLIKQRMLKSFAYYRTNKSIMIFSGGKSNGDIEESVAMKNFAVQNNIQDTDILLEKLAMNTMQNIEYVKTLIQQQDAEYDRKKVCVITNNFHAFRTKLICNKMKVNWTIIPAESNLNSKINTYLIELLAAIYLDIVLHIIMLLIITIIIGILV
>NZ_CP054000.1|WP_002841344.1|590965_591742_+|patatin-like-phospholipase-family-protein
MRGLVLEGGGARGCYQIGAYKALVEMGIDFDYVVGTSIGAINAAMICQGDWEIAYKLWENLTYDDVISLKDNDVNSIMKQSLSLDNAKDKLGLAKDFFDNKGFGVEPLNELLSEYIDEKKVRESKMKLGLNTVDVEQRRVLNLFIEDIPQGHLRDYLRASSNLLVFKQEKIDGKKLIDGGYMENNPYKMIDDVCDEIVLVSLKPYLLTNKLKKNPKYTIIKTWDRDFPKVLEFEKEKMRYGLKLGYDDTMKVYGKISE
>NZ_CP054000.1|WP_002841322.1|591856_592351_+|hypothetical-protein
MSIKINNEVVEMMLYFWQSASEGQKVAESFIIDVANRDEMKLIYNDKFDEEAVRRVLSSITNKELLNGGSPEEKRFWNNNMWMMEDMGVVEAMVDPIKHLNLDDVETDKKELIFVPGHIEEHYDFGDKLVVNFFKVSVDIFGGTGAVTMDGEDFREHIIKLLQK
>NZ_CP054000.1|WP_002841293.1|592412_594161_+|ABC-transporter-ATP-binding-protein
MLKRYKWFIDYYKKSYIIAIIALIFDYAFKLILPYMIGNVADNIFNKNVTAENLKINLGICLVASVLCYVVSVVWNLNVFRGDDTIRYLVTTKLYDKYLKQSPEFFEKNSTGSLMGKATNDPYALGDFAGYGLMSLFDSTFYPILIVIVMIVTTDFRLTLLSVLPLPILVVVSNKIGNKLNTTFEESQKSFDRMNDQTLETVSGVRVVRANNLKDFQRKKFQDRADDLYEKNMATAKLIAWYGPIQKPIEVMTYVLAISYGTYLIRTGSITVGRLMSFMFYLNLLIWPMIGMGDFISVKKQADASMDRIQEVWDYKEDIVNKPDAVDLKENPTIEFRNLSFKYPSSKENVLEKISFTIEPGKTLGVLGKTGSGKTTLLKQFLRFYDVEDGEILLNDKNLTDYTVESVRERMGYVPQNHMIFSKTIGENIKLTNKDATDEELMEAIRMSDFEKDLDKLVNGADTLCGEKGISLSGGQKQRIALSRALIKNPDILIMDDCMSAVDGTTEKNILDNFRKIRSGKTNIIATHRISQVKAADEIIVLENGRIVERGNHDSLMKQDGWYKEQYLRQTVESAYEKECDE
>NZ_CP054000.1|WP_002841212.1|594138_595875_+|ABC-transporter-ATP-binding-protein
MRKSVTNRIIKYSLNEKKNLAIGMVFTVLMTVFEIIGPIILAYIINNLLTGEKLVYNIRKLALVLCLYAVVFFVDSLWKYNSTVYLEKTANKIARRMQMDVYDHIQKMPISFYDNLPAGKVVSRITNDTKTVKSFYQMVLAQLMVSIIVSIFMIAMVLITDTKIGIIVCLFFPIMFYIFKKFLQKSRFAFTNMRKYISEENAKINETIGNIEIIKAFNLEDDFSKDYETSAKNVYDYGYMVTKAYGTMSYNVSELLRNFANITILGFYAYNVLTGNTDVKLGSMYLTMEYTTRTFSYISNCVQRMGSLEQSFSAAEHVFELLDTEVEEFPEREIGDIKGDVKFENVDFSYIENEPVLKDLSLDIKSGESVAFVGFTGSGKTTIINLLLGFYKPQKGTITIDGKNFNDYSVDSIRENISLVPQDPVLFMGDVKSNIRLDKDFTDEEVEKALRDIGADRLIDFRNGLDEEVKDNGASFSAGEKQLIAFARSYITNPKILILDEATANIDTQTEAVIQYAIDKLKQNRTTFIIAHRLSTIKNVDCIYVLDKGVVVEKGTHEELLANGKIYTRMYREQNKKG
>NZ_CP054000.1|WP_002841222.1|595876_597340_+|4-alpha-glucanotransferase
MSDNRKAGILCPVFSLSSKYGIGSFGESAYGFVRFLKKSKQTYWQILPLVPISSDGNSPYLSPSTFAGNFMYIDIDKLIEDGLLSESDVRGYKFEDDFVDYDYVAKTKDEILRKAFERNKDLKIIDTENFSERELVRGFCLFQALKKYFNGKSWLDFPDGIKYRKKKSVDYYENLLKDEIEYNVFVQCLFYKQYFELKDYANDLGIKIFGDLPIYVSKESSDMWQNPDMFMVNEDLSPKLVAGVPPDRFSETGQYWGNPVYDWDYCEKTGFDWWFKRLKHNLKMYDVIRLDHFRGFEAFWAIDASESTAENGRWIKAKGDEFFEILKKENLIDRVVAEDLGLITDDVINLRDRFGFKGMKVMQFAFDVNEESDYLPHNVGENCVYYTGTHDNQTLRGFVNSRSSDELDYIKNYVNSDDVEMSLIKVAYMTNSCLCMCQMQDFLGLDDDYRTNTPNTLGNWTWRMKKDWLTDELAEKISAITKLYNRD
>NZ_CP054000.1|WP_002841306.1|597399_598203_+|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase
MKKVLTIAGSDCSGGAGIQADIKTMSAHGVYAMSVIVSVVAENTFEVVSIEDLPDEIIKDQIDCIYNDMGTDAVKIGMLSNKRIMSCVRDKLLEYKPENVVLDPVMYAKHGACLMQEDAIDLLIEDLIALCTCITPNIPEAERISGMKIDGVDDMKKAAVIIRNMGAKYVLVKGGHHVGDAIDILYDGENFHEFVNEKIDTKNTHGTGCTLSSAIASNLALGKSIYDSVKLSKEYITNAIKHDLHIGKGNGPTNHFYKFFEGELKNE
>NZ_CP054000.1|WP_002837471.1|598195_598834_+|thiamine-phosphate-synthase
MNKQFNLGLNLVTNKQTLKGRDLTETIEIALKNGADSVRLREKNMDTRSIMQEAFKIKEITQRMGKLLIVNDRVDIAKACDVDGVHLGQKDMPIKYAREMLGDDKIIGISCHTLEQALEAQEAGADYIGVGAIFPTFTGDDFVRVTIDTLKEISEKIHVPITAIGGINKNNIRMIFDSNVDSVSLTSAVFSTGDVAASTQELKQKFDMILKK
>NZ_CP054000.1|WP_002841475.1|601294_602605_+|polysaccharide-biosynthesis-C-terminal-domain-containing-protein
MKKYKTLREFGKYVFLNIFAQIAFSCYTLMDTYFVSWKLKADGLSALNIAFPMFCIINGMGLMIGIGGGIKYSIFKSKDRDDDANTIFTNAVVLGISLACLFVISGMFFSDKLVRFLGADDCIFEMTNTYLRVMMLFAPAFFMNNILQCFVRNDRNPRLSMAAMVIGSISNVILDYVFIFPMNMGIFGAIFATGLAPIISMIVTFPYIISRNNGFHLNKNIFDFHSIREIVSKGMFALLTEATSASVMFTFNMIILGISGNVGVAAFSIITVISLVVTAIYTGLSQGIQPLISHYYGKNDAENVGKILKYAIVVQIMLSILIYGAIYFNADILAAFYNKANDVLLQDYAVSGMKIYFVACFFIGFNIVVSTYFTSTERSIKSQVISFARGFVIIIPTVLILSKIFAMTGVWAAYPVSEFIVCMMAIVLFFREKRVI
>NZ_CP054000.1|WP_002841405.1|602625_603126_+|DNA-deoxyinosine-glycosylase
MKGNYETIVHPLKPLYDENSKILILGSFPSVKTREYGFFYGHPQNRFWKLMEKLFDVDLNVSIEERKKFLLEHNIAVYDSIYKCDIIGSSDSSIKNVVPSNLKEIVDCANIKHVFCNGTASYKCYEKYHAKNLGVDCTKLPSTSPANARYRLDDLVDEWKVVLEYL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP054000_2	2.1\|439018\|27\|NZ_CP054000\|PILER-CR	439018-439044	27	MN694155	Marine virus AFVG_250M1019, complete genome	7430-7456	5	0.815
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KM224879	Vibrio phage ICP2_2013_A_Haiti, complete genome	25263-25292	5	0.833
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	AP014014	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C103A-MedDCM-OCT-S38-C6, * SEQUENCING IN PROGRESS *	33254-33283	5	0.833
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	AP014015	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C103A-MedDCM-OCT-S41-C32, * SEQUENCING IN PROGRESS *	33303-33332	5	0.833
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KJ019107	Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome	13958-13987	6	0.8
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KJ019111	Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome	13958-13987	6	0.8
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KJ019155	Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome	13958-13987	6	0.8
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KJ019085	Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome	13958-13987	6	0.8
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KJ019091	Synechococcus phage ACG-2014f isolate Syn7803US26, complete genome	13958-13987	6	0.8
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KJ019144	Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome	13958-13987	6	0.8
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	MN694049	Marine virus AFVG_250M506, complete genome	33528-33557	6	0.8
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	MN693878	Marine virus AFVG_250M440, complete genome	7052-7081	6	0.8
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	MN694645	Marine virus AFVG_250M761, complete genome	28789-28818	6	0.8
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	NZ_CP037949	Erwinia sp. QL-Z3 plasmid unnamed1, complete sequence	139361-139390	6	0.8
NZ_CP054000_2	2.11\|439481\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439481-439510	30	NZ_KX711616	Bacillus subtilis strain 72 plasmid pBS72, complete sequence	85655-85684	6	0.8
NZ_CP054000_2	2.11\|439481\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439481-439510	30	MN334766	Serratia phage PCH45, complete genome	22697-22726	6	0.8
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	MN693878	Marine virus AFVG_250M440, complete genome	7052-7081	6	0.8
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	MN694645	Marine virus AFVG_250M761, complete genome	28789-28818	6	0.8
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	NZ_CP037949	Erwinia sp. QL-Z3 plasmid unnamed1, complete sequence	139361-139390	6	0.8
NZ_CP054000_2	2.13\|439613\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439613-439642	30	NC_001942	Mycoplasma phage MAV1, complete genome	11737-11766	6	0.8
NZ_CP054000_2	2.13\|439613\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439613-439642	30	AF074945	Mycoplasma arthritidis bacteriophage MAV1, complete genome	11737-11766	6	0.8
NZ_CP054000_2	2.2\|439084\|27\|NZ_CP054000\|PILER-CR	439084-439110	27	MN694049	Marine virus AFVG_250M506, complete genome	33528-33554	7	0.741
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	MN693383	Marine virus AFVG_25M295, complete genome	19898-19927	7	0.767
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	176683-176712	7	0.767
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	177309-177338	7	0.767
NZ_CP054000_2	2.6\|439150\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439150-439179	30	LN713926	Pseudomonas fluorescens SBW25 plasmid pQBR57, complete sequence	118400-118429	7	0.767
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	KC954775	UNVERIFIED: Cronobacter phage S13, complete genome	111386-111415	7	0.767
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	NC_028773	Cronobacter phage S13, complete genome	111386-111415	7	0.767
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	MN694782	Marine virus AFVG_250M435, complete genome	9201-9230	7	0.767
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	MN304819	Phage 33_17, complete genome	15493-15522	7	0.767
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	NC_014305	Erwinia billingiae Eb661 plasmid pEB170, complete sequence	67099-67128	7	0.767
NZ_CP054000_2	2.11\|439481\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439481-439510	30	NC_031034	Bacillus phage SalinJah, complete genome	89856-89885	7	0.767
NZ_CP054000_2	2.11\|439481\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439481-439510	30	ACSJ01000017	Clostridium phage D-1873 CLG.Contig173, whole genome shotgun sequence	33202-33231	7	0.767
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	KC954775	UNVERIFIED: Cronobacter phage S13, complete genome	111386-111415	7	0.767
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	NC_028773	Cronobacter phage S13, complete genome	111386-111415	7	0.767
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	MN694782	Marine virus AFVG_250M435, complete genome	9201-9230	7	0.767
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	MN304819	Phage 33_17, complete genome	15493-15522	7	0.767
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	NC_014305	Erwinia billingiae Eb661 plasmid pEB170, complete sequence	67099-67128	7	0.767
NZ_CP054000_2	2.13\|439613\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439613-439642	30	NZ_LN614828	Legionella fallonii LLAP-10 plasmid II, complete sequence	99224-99253	7	0.767
NZ_CP054000_2	2.4\|439018\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439018-439047	30	MN694155	Marine virus AFVG_250M1019, complete genome	7430-7459	8	0.733
NZ_CP054000_2	2.6\|439150\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439150-439179	30	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	834464-834493	8	0.733
NZ_CP054000_2	2.6\|439150\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439150-439179	30	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	3226-3255	8	0.733
NZ_CP054000_2	2.6\|439150\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439150-439179	30	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	274947-274976	8	0.733
NZ_CP054000_2	2.6\|439150\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439150-439179	30	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	3235-3264	8	0.733
NZ_CP054000_2	2.6\|439150\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439150-439179	30	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	3236-3265	8	0.733
NZ_CP054000_2	2.6\|439150\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439150-439179	30	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	3236-3265	8	0.733
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	NZ_CP020746	Bacillus mycoides strain Gnyt1 plasmid unnamed3, complete sequence	23503-23532	8	0.733
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	NZ_CP046263	Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence	21392-21421	8	0.733
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	MN480762	Streptococcus salivarius strain NU10 plasmid pSsal-NU10, complete sequence	96493-96522	8	0.733
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	398212-398241	8	0.733
NZ_CP054000_2	2.11\|439481\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439481-439510	30	NZ_CP010015	Bacillus sp. YP1 plasmid pBUYP1, complete sequence	61255-61284	8	0.733
NZ_CP054000_2	2.11\|439481\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439481-439510	30	MH552500	CrAssphage sp. isolate ctcc615, complete genome	67026-67055	8	0.733
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	NZ_CP020746	Bacillus mycoides strain Gnyt1 plasmid unnamed3, complete sequence	23503-23532	8	0.733
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	NZ_CP046263	Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence	21392-21421	8	0.733
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	MN480762	Streptococcus salivarius strain NU10 plasmid pSsal-NU10, complete sequence	96493-96522	8	0.733
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	398212-398241	8	0.733
NZ_CP054000_2	2.13\|439613\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439613-439642	30	GU233956	Bacillus phage 11143, partial sequence	679-708	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	CP025574	Escherichia coli strain E-1246 plasmid pE1246_1, complete sequence	70701-70730	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NZ_KY706108	Escherichia coli strain pAA-ST131 plasmid ESBL20150001, complete sequence	90140-90169	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NZ_KX129782	Escherichia coli strain S38 plasmid pS38, complete sequence	132789-132818	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NC_011752	Escherichia coli 55989 plasmid 55989p, complete sequence	29723-29752	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NZ_CP043186	Escherichia coli O16:H48 strain PG20180171 plasmid pPG20180171.1-IncN, complete sequence	10405-10434	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	CP042952	Escherichia coli strain D8-1 plasmid pD8-1_1, complete sequence	48486-48515	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	CP051693	Escherichia coli strain SCU-318 plasmid pSCU-318-1, complete sequence	15544-15573	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NC_019000	Escherichia coli plasmid pHUSEC41-2, complete sequence	32068-32097	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NZ_CP025850	Escherichia coli strain 600468 plasmid p600468_158, complete sequence	35531-35560	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NZ_CP017721	Salmonella enterica subsp. enterica serovar Minnesota strain CFSAN017963 plasmid pCFSAN017963_01, complete sequence	224029-224058	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NZ_CP043224	Salmonella enterica subsp. enterica serovar Bredeney strain SA20114778WT plasmid pET1.2-IncN, complete sequence	10220-10249	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NZ_CP043184	Escherichia coli O16:H48 strain PG20180172 plasmid pPG20180172.1-IncN, complete sequence	10404-10433	8	0.733
NZ_CP054000_2	2.14\|439679\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439679-439708	30	NZ_CP043188	Escherichia coli O16:H48 strain PG20180170 plasmid pPG20180170.1-IncN, complete sequence	10405-10434	8	0.733
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	174216-174245	9	0.7
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	172820-172849	9	0.7
NZ_CP054000_2	2.5\|439084\|30\|NZ_CP054000\|CRISPRCasFinder,CRT	439084-439113	30	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	174842-174871	9	0.7
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	NZ_CP045204	Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence	38799-38828	9	0.7
NZ_CP054000_2	2.9\|439348\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439348-439377	30	MT773554	Myoviridae sp. isolate BML_2 genomic sequence	111764-111793	9	0.7
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	NZ_CP045204	Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence	38799-38828	9	0.7
NZ_CP054000_2	2.12\|439547\|30\|NZ_CP054000\|CRISPRCasFinder,CRT,PILER-CR	439547-439576	30	MT773554	Myoviridae sp. isolate BML_2 genomic sequence	111764-111793	9	0.7

1. spacer 2.1|439018|27|NZ_CP054000|PILER-CR matches to MN694155 (Marine virus AFVG_250M1019, complete genome) position: , mismatch: 5, identity: 0.815

caaactacgtcagtggatactacatgc	CRISPR spacer
tgtcctacgtcggtggatactacatgc	Protospacer
..  *******.***************

2. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KM224879 (Vibrio phage ICP2_2013_A_Haiti, complete genome) position: , mismatch: 5, identity: 0.833

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtgcaacagggcctgttggtcctaaaggt	Protospacer
** . *** ** ******************

3. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to AP014014 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C103A-MedDCM-OCT-S38-C6, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.833

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggagatactggtcctgatggtcctcaaggt	Protospacer
**..* ********** ******* *****

4. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to AP014015 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C103A-MedDCM-OCT-S41-C32, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.833

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggagatactggtcctgatggtcctcaaggt	Protospacer
**..* ********** ******* *****

5. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KJ019107 (Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome) position: , mismatch: 6, identity: 0.8

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtgctactggtcctcttggtcctaatggt	Protospacer
** .  ********* ********** ***

6. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KJ019111 (Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome) position: , mismatch: 6, identity: 0.8

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtgctactggtcctcttggtcctaatggt	Protospacer
** .  ********* ********** ***

7. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KJ019155 (Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome) position: , mismatch: 6, identity: 0.8

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtgctactggtcctcttggtcctaatggt	Protospacer
** .  ********* ********** ***

8. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KJ019085 (Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome) position: , mismatch: 6, identity: 0.8

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtgctactggtcctcttggtcctaatggt	Protospacer
** .  ********* ********** ***

9. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KJ019091 (Synechococcus phage ACG-2014f isolate Syn7803US26, complete genome) position: , mismatch: 6, identity: 0.8

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtgctactggtcctcttggtcctaatggt	Protospacer
** .  ********* ********** ***

10. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KJ019144 (Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome) position: , mismatch: 6, identity: 0.8

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtgctactggtcctcttggtcctaatggt	Protospacer
** .  ********* ********** ***

11. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to MN694049 (Marine virus AFVG_250M506, complete genome) position: , mismatch: 6, identity: 0.8

gggaaaactggtcctgttggtcctaaaggt---	CRISPR spacer
ggtaaaactggtcctgttggttt---aggtgca	Protospacer
** ******************..   ****

12. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN693878 (Marine virus AFVG_250M440, complete genome) position: , mismatch: 6, identity: 0.8

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
ataaaaaggagataattatgaaaaaggtaa	Protospacer
  *****.********* *********  *

13. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN694645 (Marine virus AFVG_250M761, complete genome) position: , mismatch: 6, identity: 0.8

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
ataaaaaggagataattatgaaaaaggtaa	Protospacer
  *****.********* *********  *

14. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037949 (Erwinia sp. QL-Z3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
ggaaaaaacatataattctgaaaatagaaa	Protospacer
 ******* * ************* .** *

15. spacer 2.11|439481|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX711616 (Bacillus subtilis strain 72 plasmid pBS72, complete sequence) position: , mismatch: 6, identity: 0.8

aattgttagacaatgaagacttaacagaaa	CRISPR spacer
aagaatcagacaatgaagacttaatcgaaa	Protospacer
**  .*.*****************. ****

16. spacer 2.11|439481|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN334766 (Serratia phage PCH45, complete genome) position: , mismatch: 6, identity: 0.8

aattgttagacaatgaagacttaacagaaa	CRISPR spacer
atttgtaagacaatgaacacttaacgttaa	Protospacer
* **** ********** *******.  **

17. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN693878 (Marine virus AFVG_250M440, complete genome) position: , mismatch: 6, identity: 0.8

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
ataaaaaggagataattatgaaaaaggtaa	Protospacer
  *****.********* *********  *

18. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN694645 (Marine virus AFVG_250M761, complete genome) position: , mismatch: 6, identity: 0.8

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
ataaaaaggagataattatgaaaaaggtaa	Protospacer
  *****.********* *********  *

19. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037949 (Erwinia sp. QL-Z3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
ggaaaaaacatataattctgaaaatagaaa	Protospacer
 ******* * ************* .** *

20. spacer 2.13|439613|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NC_001942 (Mycoplasma phage MAV1, complete genome) position: , mismatch: 6, identity: 0.8

ttcaactg--catttctcaaattaaaaaatgt	CRISPR spacer
--catttggacatttctaaaattaaaaaatga	Protospacer
  ** .**  ******* *************

21. spacer 2.13|439613|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to AF074945 (Mycoplasma arthritidis bacteriophage MAV1, complete genome) position: , mismatch: 6, identity: 0.8

ttcaactg--catttctcaaattaaaaaatgt	CRISPR spacer
--catttggacatttctaaaattaaaaaatga	Protospacer
  ** .**  ******* *************

22. spacer 2.2|439084|27|NZ_CP054000|PILER-CR matches to MN694049 (Marine virus AFVG_250M506, complete genome) position: , mismatch: 7, identity: 0.741

gggaaaactggtcctgttggtcctaaa	CRISPR spacer
ggtaaaactggtcctgttggtttaggt	Protospacer
** ******************.. ..

23. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to MN693383 (Marine virus AFVG_25M295, complete genome) position: , mismatch: 7, identity: 0.767

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtcctgctggtcctgttggtcctgtaggt	Protospacer
**    .*****************. ****

24. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 7, identity: 0.767

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtcctgctggtcctgctggtcctcaaggt	Protospacer
**    .*********.******* *****

25. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 7, identity: 0.767

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
ggtcctgctggtcctgctggtcctcaaggt	Protospacer
**    .*********.******* *****

26. spacer 2.6|439150|30|NZ_CP054000|CRISPRCasFinder,CRT matches to LN713926 (Pseudomonas fluorescens SBW25 plasmid pQBR57, complete sequence) position: , mismatch: 7, identity: 0.767

agttatttgaacatcagtgccgaaatcgat	CRISPR spacer
cccgttttgaacctcagtgccgaattcgat	Protospacer
  .  ******* *********** *****

27. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to KC954775 (UNVERIFIED: Cronobacter phage S13, complete genome) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
acaaaaaagatattattctgaaaaaggcag	Protospacer
  ******** ** *************  .

28. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NC_028773 (Cronobacter phage S13, complete genome) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
acaaaaaagatattattctgaaaaaggcag	Protospacer
  ******** ** *************  .

29. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN694782 (Marine virus AFVG_250M435, complete genome) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
taaaaaaaaagataattctgagaaaggttg	Protospacer
..******.************.***** ..

30. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN304819 (Phage 33_17, complete genome) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
aaaaaaaagaaataattatgaaaaagaatt	Protospacer
 .********.****** ********.*.

31. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NC_014305 (Erwinia billingiae Eb661 plasmid pEB170, complete sequence) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
ggaaaaaacatataattctgaaaataaaaa	Protospacer
 ******* * ************* ..* *

32. spacer 2.11|439481|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NC_031034 (Bacillus phage SalinJah, complete genome) position: , mismatch: 7, identity: 0.767

aattgttagacaatgaagacttaacagaaa	CRISPR spacer
ttgtggaagacaaagaagagttaacagaaa	Protospacer
   **  ****** ***** **********

33. spacer 2.11|439481|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to ACSJ01000017 (Clostridium phage D-1873 CLG.Contig173, whole genome shotgun sequence) position: , mismatch: 7, identity: 0.767

aattgttagacaatgaagacttaacagaaa	CRISPR spacer
aattgttagataatgaatacttagtaatac	Protospacer
**********.****** *****..*. *

34. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to KC954775 (UNVERIFIED: Cronobacter phage S13, complete genome) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
acaaaaaagatattattctgaaaaaggcag	Protospacer
  ******** ** *************  .

35. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NC_028773 (Cronobacter phage S13, complete genome) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
acaaaaaagatattattctgaaaaaggcag	Protospacer
  ******** ** *************  .

36. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN694782 (Marine virus AFVG_250M435, complete genome) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
taaaaaaaaagataattctgagaaaggttg	Protospacer
..******.************.***** ..

37. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN304819 (Phage 33_17, complete genome) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
aaaaaaaagaaataattatgaaaaagaatt	Protospacer
 .********.****** ********.*.

38. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NC_014305 (Erwinia billingiae Eb661 plasmid pEB170, complete sequence) position: , mismatch: 7, identity: 0.767

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
ggaaaaaacatataattctgaaaataaaaa	Protospacer
 ******* * ************* ..* *

39. spacer 2.13|439613|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LN614828 (Legionella fallonii LLAP-10 plasmid II, complete sequence) position: , mismatch: 7, identity: 0.767

ttcaactgcatttctcaaattaaaaaatgt	CRISPR spacer
taaacttggatttctcatattaaaaaatga	Protospacer
*  * .** ******** ***********

40. spacer 2.4|439018|30|NZ_CP054000|CRISPRCasFinder,CRT matches to MN694155 (Marine virus AFVG_250M1019, complete genome) position: , mismatch: 8, identity: 0.733

caaactacgtcagtggatactacatgctaa	CRISPR spacer
tgtcctacgtcggtggatactacatgcatg	Protospacer
..  *******.***************  .

41. spacer 2.6|439150|30|NZ_CP054000|CRISPRCasFinder,CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 8, identity: 0.733

agttatttgaacatcagtgccgaaatcgat	CRISPR spacer
ctcctgttgaagatcagtgccgaattcgat	Protospacer
  ..  ***** ************ *****

42. spacer 2.6|439150|30|NZ_CP054000|CRISPRCasFinder,CRT matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 8, identity: 0.733

agttatttgaacatcagtgccgaaatcgat	CRISPR spacer
gtcggtgtgaacatcagtgccaacatcgat	Protospacer
. . .* **************.* ******

43. spacer 2.6|439150|30|NZ_CP054000|CRISPRCasFinder,CRT matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 8, identity: 0.733

agttatttgaacatcagtgccgaaatcgat	CRISPR spacer
gtcggtgtgaacatcagtgccaacatcgat	Protospacer
. . .* **************.* ******

44. spacer 2.6|439150|30|NZ_CP054000|CRISPRCasFinder,CRT matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 8, identity: 0.733

agttatttgaacatcagtgccgaaatcgat	CRISPR spacer
gtcggtgtgaacatcagtgccaacatcgat	Protospacer
. . .* **************.* ******

45. spacer 2.6|439150|30|NZ_CP054000|CRISPRCasFinder,CRT matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 8, identity: 0.733

agttatttgaacatcagtgccgaaatcgat	CRISPR spacer
gtcggtgtgaacatcagtgccaacatcgat	Protospacer
. . .* **************.* ******

46. spacer 2.6|439150|30|NZ_CP054000|CRISPRCasFinder,CRT matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 8, identity: 0.733

agttatttgaacatcagtgccgaaatcgat	CRISPR spacer
gtcggtgtgaacatcagtgccaacatcgat	Protospacer
. . .* **************.* ******

47. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020746 (Bacillus mycoides strain Gnyt1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
agaagaaagagataattttgaaaaaattag	Protospacer
 ***.************.*******.   .

48. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046263 (Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence) position: , mismatch: 8, identity: 0.733

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
agcaaaaagaggtaattctgtaaaagtcat	Protospacer
 * ********.******** *****

49. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN480762 (Streptococcus salivarius strain NU10 plasmid pSsal-NU10, complete sequence) position: , mismatch: 8, identity: 0.733

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
tgaaaaaagaaataattcttaaaacatcta	Protospacer
.*********.******** **** .  .*

50. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
agaaaaaaaagacaattctgaaaagagggt	Protospacer
 *******.***.***********..*.

51. spacer 2.11|439481|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010015 (Bacillus sp. YP1 plasmid pBUYP1, complete sequence) position: , mismatch: 8, identity: 0.733

aattgttagacaatgaagacttaacagaaa	CRISPR spacer
cgaaagtagacaatccagacttaacagaaa	Protospacer
 .  . ********  **************

52. spacer 2.11|439481|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MH552500 (CrAssphage sp. isolate ctcc615, complete genome) position: , mismatch: 8, identity: 0.733

aattgttagacaatgaagacttaacagaaa	CRISPR spacer
gtgaagtagacgatgaagagttaacagaaa	Protospacer
.   . *****.******* **********

53. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020746 (Bacillus mycoides strain Gnyt1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
agaagaaagagataattttgaaaaaattag	Protospacer
 ***.************.*******.   .

54. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046263 (Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence) position: , mismatch: 8, identity: 0.733

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
agcaaaaagaggtaattctgtaaaagtcat	Protospacer
 * ********.******** *****

55. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MN480762 (Streptococcus salivarius strain NU10 plasmid pSsal-NU10, complete sequence) position: , mismatch: 8, identity: 0.733

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
tgaaaaaagaaataattcttaaaacatcta	Protospacer
.*********.******** **** .  .*

56. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
agaaaaaaaagacaattctgaaaagagggt	Protospacer
 *******.***.***********..*.

57. spacer 2.13|439613|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to GU233956 (Bacillus phage 11143, partial sequence) position: , mismatch: 8, identity: 0.733

ttcaactgcatttctcaaattaaaaaatgt	CRISPR spacer
ataccatgcatttcactaattaaaaaatga	Protospacer
 *    ******** * ************

58. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to CP025574 (Escherichia coli strain E-1246 plasmid pE1246_1, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

59. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KY706108 (Escherichia coli strain pAA-ST131 plasmid ESBL20150001, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

60. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX129782 (Escherichia coli strain S38 plasmid pS38, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

61. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NC_011752 (Escherichia coli 55989 plasmid 55989p, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

62. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043186 (Escherichia coli O16:H48 strain PG20180171 plasmid pPG20180171.1-IncN, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

63. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to CP042952 (Escherichia coli strain D8-1 plasmid pD8-1_1, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

64. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to CP051693 (Escherichia coli strain SCU-318 plasmid pSCU-318-1, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

65. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NC_019000 (Escherichia coli plasmid pHUSEC41-2, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

66. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025850 (Escherichia coli strain 600468 plasmid p600468_158, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

67. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017721 (Salmonella enterica subsp. enterica serovar Minnesota strain CFSAN017963 plasmid pCFSAN017963_01, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

68. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043224 (Salmonella enterica subsp. enterica serovar Bredeney strain SA20114778WT plasmid pET1.2-IncN, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

69. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043184 (Escherichia coli O16:H48 strain PG20180172 plasmid pPG20180172.1-IncN, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

70. spacer 2.14|439679|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043188 (Escherichia coli O16:H48 strain PG20180170 plasmid pPG20180170.1-IncN, complete sequence) position: , mismatch: 8, identity: 0.733

attggcagatgctgatatgggagaaatgga	CRISPR spacer
cagtacagatggtgatatgggacaaatggt	Protospacer
    .****** ********** ******

71. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 9, identity: 0.7

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
atcgttcctggtcctgttggtcctactggt	Protospacer
.  .   ******************  ***

72. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 9, identity: 0.7

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
atcgttcctggtcctgttggtcctactggt	Protospacer
.  .   ******************  ***

73. spacer 2.5|439084|30|NZ_CP054000|CRISPRCasFinder,CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 9, identity: 0.7

gggaaaactggtcctgttggtcctaaaggt	CRISPR spacer
atcgttcctggtcctgttggtcctactggt	Protospacer
.  .   ******************  ***

74. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045204 (Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence) position: , mismatch: 9, identity: 0.7

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
aaaaaaatgagataaatctgaaaaaaccgc	Protospacer
 .***** ******* *********.

75. spacer 2.9|439348|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MT773554 (Myoviridae sp. isolate BML_2 genomic sequence) position: , mismatch: 9, identity: 0.7

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
gaataaaagagataattctgacaaatccgg	Protospacer
 .* ***************** ***    .

76. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045204 (Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence) position: , mismatch: 9, identity: 0.7

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
aaaaaaatgagataaatctgaaaaaaccgc	Protospacer
 .***** ******* *********.

77. spacer 2.12|439547|30|NZ_CP054000|CRISPRCasFinder,CRT,PILER-CR matches to MT773554 (Myoviridae sp. isolate BML_2 genomic sequence) position: , mismatch: 9, identity: 0.7

cgaaaaaagagataattctgaaaaaggaca	CRISPR spacer
gaataaaagagataattctgacaaatccgg	Protospacer
 .* ***************** ***    .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

997164 : 1060278

Streptococcus_phage(43.18%)

capsid,tail,holin,terminase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002841518.1\|997164_997974_+	phage antirepressor Ant	B5TRA6	Bacteroides_phage	5.1e-61	48.3
WP_002841583.1\|997976_998138_+	hypothetical protein	NA	NA	NA	NA
WP_002841521.1\|998112_998340_+	hypothetical protein	NA	NA	NA	NA
WP_002841577.1\|998362_998659_+	hypothetical protein	NA	NA	NA	NA
WP_002841584.1\|998655_998877_+	hypothetical protein	NA	NA	NA	NA
WP_002841516.1\|998964_1000905_+	AAA family ATPase	A0A1L2K2K3	Aeribacillus_phage	1.7e-86	34.6
WP_002841570.1\|1000909_1001767_+	recombinase RecT	A0A1L2JY28	Aeribacillus_phage	5.8e-47	39.1
WP_002841529.1\|1001776_1002499_+	MBL fold metallo-hydrolase	A0A0H4TGC9	Bacillus_phage	1.3e-44	41.4
WP_002841548.1\|1002508_1002940_+	single-stranded DNA-binding protein	Q938M7	Temperate_phage	1.1e-25	47.7
WP_002841512.1\|1002949_1003804_+	hypothetical protein	A0A1Q1PVU4	Staphylococcus_phage	2.2e-30	40.4
WP_002841531.1\|1003781_1004129_+	DUF1064 domain-containing protein	A0A2P1JTY5	Anoxybacillus_phage	5.1e-18	48.5
WP_002841549.1\|1004125_1004329_+	hypothetical protein	NA	NA	NA	NA
WP_002841569.1\|1004325_1004811_+	hypothetical protein	B3GVZ0	Streptococcus_phage	6.2e-14	31.1
WP_002841561.1\|1004807_1005149_+	hypothetical protein	NA	NA	NA	NA
WP_002841539.1\|1005160_1005568_+	hypothetical protein	NA	NA	NA	NA
WP_035137399.1\|1005712_1006051_+	HNH endonuclease	Q7Y4J1	Streptococcus_phage	5.4e-41	68.4
WP_035137403.1\|1006195_1007443_+	hypothetical protein	A0A141E171	Streptococcus_phage	1.4e-142	63.5
WP_172884322.1\|1008263_1008671_+	hypothetical protein	NA	NA	NA	NA
WP_002841519.1\|1008673_1008862_+	hypothetical protein	NA	NA	NA	NA
WP_172884273.1\|1008934_1010332_+\|terminase	terminase	A0A1P8BKB3	Lactococcus_phage	1.8e-167	59.7
WP_002841522.1\|1010409_1010883_+	DUF4355 domain-containing protein	A0A141E167	Streptococcus_phage	3.0e-21	38.6
WP_002841525.1\|1010884_1011775_+\|capsid	phage major capsid protein	A0A1B1IMW9	Lactococcus_phage	5.0e-102	62.7
WP_100198852.1\|1011771_1012035_+	hypothetical protein	NA	NA	NA	NA
WP_002841581.1\|1012039_1012474_+	hypothetical protein	M1Q0V8	Streptococcus_phage	6.1e-37	59.5
WP_035137398.1\|1012418_1012754_+	hypothetical protein	A0A1B1IMZ5	Lactococcus_phage	2.3e-28	54.7
WP_002841567.1\|1012746_1012983_+	hypothetical protein	M1NS01	Streptococcus_phage	1.3e-14	55.1
WP_002841590.1\|1012979_1013318_+	hypothetical protein	A0A0B5A5W0	Streptococcus_phage	8.4e-18	41.7
WP_002841486.1\|1013329_1013899_+	hypothetical protein	A0A1B1IMT2	Lactococcus_phage	3.2e-46	51.1
WP_002841503.1\|1013908_1014187_+	hypothetical protein	A0A1P8BMR6	Lactococcus_phage	1.0e-16	49.4
WP_002841566.1\|1014201_1014579_+	hypothetical protein	A0A1P8BMT6	Lactococcus_phage	1.1e-18	41.3
WP_002841591.1\|1014568_1015084_+	hypothetical protein	A0A1P8BMM1	Lactococcus_phage	3.3e-50	63.4
WP_002841488.1\|1015354_1015831_+	HNH endonuclease	A0A0B5A545	Streptococcus_phage	1.9e-31	49.4
WP_002841513.1\|1015934_1017326_+	hypothetical protein	Q9F4J3	Streptococcus_phage	9.4e-31	61.9
WP_002841509.1\|1017325_1019062_+\|tail	phage tail family protein	D0R0F0	Streptococcus_phage	2.0e-06	44.3
WP_002841523.1\|1019055_1023486_+\|tail	phage tail protein	A0A286QS09	Streptococcus_phage	1.9e-56	61.0
WP_002841534.1\|1023497_1025345_+	hypothetical protein	J7KC14	Streptococcus_phage	5.7e-07	23.6
WP_002841593.1\|1025344_1025626_+	hypothetical protein	NA	NA	NA	NA
WP_002841565.1\|1025753_1026095_+	hypothetical protein	NA	NA	NA	NA
WP_002841547.1\|1026087_1027047_+	glycosyl hydrolase family 25	A0A1W6JQH9	Corynebacterium_phage	6.3e-10	25.1
WP_002841517.1\|1027048_1027252_+\|holin	phage holin	A0A075EHP3	Siphovirus	6.1e-16	62.9
WP_002841514.1\|1027643_1028081_+	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	2.3e-15	38.0
WP_002841579.1\|1028080_1028542_+	hypothetical protein	NA	NA	NA	NA
WP_172884274.1\|1028771_1030274_-	recombinase family protein	A0A0A7RTP8	Clostridium_phage	9.7e-66	36.3
WP_002841575.1\|1030396_1031419_-	Abi family protein	M1PS09	Streptococcus_phage	6.2e-64	42.8
WP_002841540.1\|1031546_1031963_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002841535.1\|1031955_1032429_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172884275.1\|1032517_1032730_+	hypothetical protein	NA	NA	NA	NA
WP_002841560.1\|1032776_1032926_+	hypothetical protein	NA	NA	NA	NA
WP_172884272.1\|1033183_1033336_+	hypothetical protein	NA	NA	NA	NA
WP_002839400.1\|1033332_1033539_-	hypothetical protein	NA	NA	NA	NA
WP_002841501.1\|1033616_1033802_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002841506.1\|1033816_1034053_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002841518.1\|1034052_1034862_+	phage antirepressor Ant	B5TRA6	Bacteroides_phage	5.1e-61	48.3
WP_002841583.1\|1034864_1035026_+	hypothetical protein	NA	NA	NA	NA
WP_002841577.1\|1035249_1035546_+	hypothetical protein	NA	NA	NA	NA
WP_002841584.1\|1035542_1035764_+	hypothetical protein	NA	NA	NA	NA
WP_002841570.1\|1037793_1038651_+	recombinase RecT	A0A1L2JY28	Aeribacillus_phage	5.8e-47	39.1
WP_002841548.1\|1039390_1039822_+	single-stranded DNA-binding protein	Q938M7	Temperate_phage	1.1e-25	47.7
WP_172884276.1\|1040996_1041179_+	hypothetical protein	NA	NA	NA	NA
WP_002841569.1\|1041195_1041681_+	hypothetical protein	B3GVZ0	Streptococcus_phage	6.2e-14	31.1
WP_002841561.1\|1041677_1042019_+	hypothetical protein	NA	NA	NA	NA
WP_172884277.1\|1045508_1045682_+	hypothetical protein	NA	NA	NA	NA
WP_172884278.1\|1047113_1047317_+	hypothetical protein	NA	NA	NA	NA
WP_035137398.1\|1049215_1049551_+	hypothetical protein	A0A1B1IMZ5	Lactococcus_phage	2.3e-28	54.7
WP_002841590.1\|1049775_1050114_+	hypothetical protein	A0A0B5A5W0	Streptococcus_phage	8.4e-18	41.7
WP_002841486.1\|1050125_1050695_+	hypothetical protein	A0A1B1IMT2	Lactococcus_phage	3.2e-46	51.1
WP_172884279.1\|1050995_1051346_+	hypothetical protein	A0A1P8BMT6	Lactococcus_phage	1.1e-17	42.2
WP_002841591.1\|1051361_1051877_+	hypothetical protein	A0A1P8BMM1	Lactococcus_phage	3.3e-50	63.4
WP_002841488.1\|1052146_1052623_+	HNH endonuclease	A0A0B5A545	Streptococcus_phage	1.9e-31	49.4
WP_002841513.1\|1052726_1054118_+	hypothetical protein	Q9F4J3	Streptococcus_phage	9.4e-31	61.9
WP_002841509.1\|1054117_1055854_+\|tail	phage tail family protein	D0R0F0	Streptococcus_phage	2.0e-06	44.3
WP_002841523.1\|1055847_1060278_+\|tail	phage tail protein	A0A286QS09	Streptococcus_phage	1.9e-56	61.0

DBSCAN-SWA_2

1161910 : 1170056

Anomala_cuprea_entomopoxvirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002842284.1\|1161910_1162525_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.5e-14	28.6
WP_002842282.1\|1162601_1164707_+	ribonuclease R	Q0GXV6	Lactococcus_phage	6.5e-76	37.0
WP_002842278.1\|1164719_1165169_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.5e-33	49.3
WP_172884283.1\|1165177_1166914_+	fibronectin/fibrinogen-binding protein	M1HQM6	Paramecium_bursaria_Chlorella_virus	2.0e-09	41.3
WP_002838464.1\|1166983_1167859_+	YicC family protein	NA	NA	NA	NA
WP_035137439.1\|1167866_1168118_+	DUF370 domain-containing protein	NA	NA	NA	NA
WP_002839418.1\|1168119_1168707_+	guanylate kinase	A0A0M5KCK5	Mollivirus	4.3e-09	32.0
WP_002838258.1\|1168699_1168897_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_002841682.1\|1168889_1170056_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	4.6e-39	30.9

DBSCAN-SWA_3

1266015 : 1273823

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002841991.1\|1266015_1266678_-	hypothetical protein	A7KV15	Bacillus_phage	1.6e-20	31.6
WP_002841987.1\|1266664_1266904_-	hypothetical protein	NA	NA	NA	NA
WP_172884288.1\|1266903_1268487_-	AAA family ATPase	A7KV18	Bacillus_phage	7.7e-21	35.4
WP_002841999.1\|1268486_1269437_-	metallophosphoesterase	A7KV18	Bacillus_phage	1.3e-34	30.6
WP_002841978.1\|1269473_1270559_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	8.5e-120	61.0
WP_002841996.1\|1270628_1271165_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_002841977.1\|1271166_1273389_-	DNA translocase FtsK 4TM domain-containing protein	A0A218M9A2	Mycobacterium_phage	1.0e-79	46.6
WP_002841986.1\|1273391_1273823_-	dUTP diphosphatase	A0A146JCY5	Tokyovirus	1.7e-39	52.8

DBSCAN-SWA_4

1323405 : 1338669

Bacillus_phage(44.44%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002842210.1\|1323405_1326024_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.8e-166	41.7
WP_002842239.1\|1326037_1326646_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	8.9e-26	31.3
WP_002842240.1\|1326645_1327092_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_002838433.1\|1327091_1329263_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	U5J9N6	Bacillus_phage	3.0e-15	39.4
WP_172884292.1\|1329327_1331070_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	9.2e-84	33.7
WP_002838251.1\|1331136_1331445_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	3.9e-06	38.1
WP_002842245.1\|1331468_1332608_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.1e-88	46.6
WP_002842237.1\|1332600_1333638_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_002842216.1\|1333647_1334655_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	9.6e-09	28.8
WP_002842254.1\|1334663_1335260_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_002842206.1\|1335268_1335763_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_002838293.1\|1335880_1336618_+	3-oxoacyl-ACP reductase FabG	A0A127AWG8	Bacillus_phage	5.9e-08	31.5
WP_002842228.1\|1336610_1337330_+	response regulator transcription factor	NA	NA	NA	NA
WP_002842262.1\|1337319_1338669_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.1e-23	30.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054000

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection