CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP054004	Bacteroides fragilis strain FDAARGOS_763 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0	0
NZ_CP054003	Bacteroides fragilis strain FDAARGOS_763 chromosome, complete genome	3 crisprs	PrimPol,RT,csa3,PD-DExK,cas3,WYL,DEDDh	1	3	1
NZ_CP054001	Bacteroides fragilis strain FDAARGOS_763 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0
NZ_CP054002	Bacteroides fragilis strain FDAARGOS_763 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054003_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054003_1

2559117-2559262

Orphan

Consensus_repeat	Method
TCAAATTCACAATATATTGGGAAT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP054003_1

>merge|NZ_CP054003|1|2559117-2559262|CRISPRCasFinder
TCAAATTCACAATATATTGTGAATTTCATGATAAAGGTACATAACTCAAGCCACAAAAAGCTCAAATTCACAATATATTGGGAATTTCCTTGCTTATCAAACAAATACTTACTATTTTTGTTTCAAATTCACAATATATTGGGAAT

>NZ_CP054003|1|1|2559117-2559262|CRISPRCasFinder
TCAAATTCACAATATATTGTGAAT	TTCATGATAAAGGTACATAACTCAAGCCACAAAAAGC
TCAAATTCACAATATATTGGGAAT	TTCCTTGCTTATCAAACAAATACTTACTATTTTTGTT
TCAAATTCACAATATATTGGGAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054003.1\|WP_005775513.1\|2555315_2555804_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|336454
NZ_CP054003.1\|WP_005775498.1\|2567035_2568124_-\|DUF1573-domain-containing-protein	unknown	unknown	gnl\|CDD\|377880
NZ_CP054003.1\|WP_005775504.1\|2559793_2560804_+\|HipA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377920
NZ_CP054003.1\|WP_005804392.1\|2549373_2550369_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133039
NZ_CP054003.1\|WP_005775502.1\|2561741_2562989_-\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|366370
NZ_CP054003.1\|WP_005775500.1\|2564917_2565826_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP054003.1\|WP_005775509.1\|2557407_2557755_+\|DUF2693-domain-containing-protein	unknown	unknown	gnl\|CDD\|371293
NZ_CP054003.1\|WP_005775515.1\|2553968_2555288_-\|UDP-glucose-dehydrogenase	unknown	unknown	gnl\|CDD\|185017
NZ_CP054003.1\|WP_005775512.1\|2555823_2556360_-\|capsular-polysaccharide-transcription-antiterminator-UpgY	unknown	unknown	gnl\|CDD\|193584
NZ_CP054003.1\|WP_005775503.1\|2560806_2561700_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117
NZ_CP054003.1\|WP_005775496.1\|2568394_2574175_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380081
NZ_CP054003.1\|WP_065739719.1\|2551497_2552943_-\|lipopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240532
NZ_CP054003.1\|WP_005775508.1\|2557900_2558773_+\|DUF4373-domain-containing-protein	unknown	unknown	gnl\|CDD\|379546
NZ_CP054003.1\|WP_065739720.1\|2552939_2553824_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NZ_CP054003.1\|WP_005810390.1\|2562960_2563977_-\|DUF4435-domain-containing-protein	unknown	unknown	gnl\|CDD\|373095
NZ_CP054003.1\|WP_005810392.1\|2563998_2564826_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379114
NZ_CP054003.1\|WP_005775519.1\|2548285_2549368_-\|EpsG-family-protein	unknown	unknown	gnl\|CDD\|379716
NZ_CP054003.1\|WP_005775499.1\|2565935_2567027_-\|methylmalonyl-Co-A-mutase-associated-GTPase-MeaB	unknown	unknown	gnl\|CDD\|236515
NZ_CP054003.1\|WP_005775505.1\|2559471_2559801_+\|HipA-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|274416
NZ_CP054003.1\|WP_065739845.1\|2550375_2551485_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740

Protein	Function_ID	Function_description	E-value
NZ_CP054003.1\|WP_005775513.1\|2555315_2555804_-\|transcriptional-regulator	gnl\|CDD\|336454	pfam06603, UpxZ, UpxZ family of transcription anti-terminator antagonists. The UpxZ family of proteins acts to inhibit transcription of heterologous capsular polysaccharide loci in Bacteroides species by interfering with the action of the UpxY family of transcription anti-terminators. As antagonists of polysaccharide locus-specific UpxY transcription anti-terminators, the UpxZ proteins exert a hierarchical level of regulation, insuring that only one of the multiple phase-variable capsular polysaccharide loci per cell characteristic of this genus is transcribed at a time.	4.03244e-61
NZ_CP054003.1\|WP_005775498.1\|2567035_2568124_-\|DUF1573-domain-containing-protein	gnl\|CDD\|377880	pfam07610, DUF1573, Protein of unknown function (DUF1573). These hypothetical proteins, from bacteria such as Rhodopirellula baltica, Bacteroides thetaiotaomicron, and Porphyromonas gingivalis, share a region of conserved sequence towards their N-termini.	3.94268e-42
NZ_CP054003.1\|WP_005775504.1\|2559793_2560804_+\|HipA-domain-containing-protein	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	6.53052e-46
NZ_CP054003.1\|WP_005804392.1\|2549373_2550369_-\|glycosyltransferase	gnl\|CDD\|133039	cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.55009e-26
NZ_CP054003.1\|WP_005775502.1\|2561741_2562989_-\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	5.85447e-25
NZ_CP054003.1\|WP_005775500.1\|2564917_2565826_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	1.5505e-13
NZ_CP054003.1\|WP_005775509.1\|2557407_2557755_+\|DUF2693-domain-containing-protein	gnl\|CDD\|371293	pfam10902, WYL_2, WYL_2, Sm-like SH3 beta-barrel fold. WYL_2 is a family of Sm-like SH3 beta-barrel fold containing domains. WYL is named for three conserved amino acids found in a subset of domains of this superfamily. These residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	2.30109e-29
NZ_CP054003.1\|WP_005775515.1\|2553968_2555288_-\|UDP-glucose-dehydrogenase	gnl\|CDD\|185017	PRK15057, PRK15057, UDP-glucose 6-dehydrogenase; Provisional.	1.28158e-175
NZ_CP054003.1\|WP_005775512.1\|2555823_2556360_-\|capsular-polysaccharide-transcription-antiterminator-UpgY	gnl\|CDD\|193584	cd09895, NGN_SP_UpxY, N-Utilization Substance G (NusG) N-terminal domain in the NusG Specialized Paralog (SP), UpxY. The N-Utilization Substance G (NusG) proteins are involved in transcription elongation and termination. NusG is essential in Escherichia coli and is associated with RNA polymerase elongation and Rho-termination. Paralogs of eubacterial NusG, NusG SP (Specialized Paralog of NusG), are more diverse and often found as the first ORF in operons encoding secreted proteins and LPS (lipopolysaccharide) biosynthesis genes. NusG SP family members are operon-specific transcriptional antitermination factors. UpxY proteins, UpxY proteins, where the x is replaced by the letter designation of the specific polysaccharide (UpaY to UphY), are a family of NusG SP factors that act specifically in transcriptional antitermination of operons from which they are encoded. UpxYs are necessary and specific for transcription regulation of the polysaccharide biosynthesis operon. Orthologs of the NusG gene exist in all bacteria, but their functions and requirements are different. The NusG N-terminal (NGN) domain is similar in all NusG orthologs, but its C-terminal domain and the linker that separate these two domains are different. The domain organization of NusG and its orthologs suggests that the common properties of NusG and its orthologs and paralogs are due to their similar NGN domains.	1.39421e-29
NZ_CP054003.1\|WP_005775503.1\|2560806_2561700_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.24557e-30
NZ_CP054003.1\|WP_005775496.1\|2568394_2574175_-\|hypothetical-protein	gnl\|CDD\|380081	pfam17973, bMG10, Bacterial Alpha-2-macroglobulin MG10 domain. Alpha-2-macroglobulins (A2Ms) are plasma proteins that trap and inhibit a broad range of proteases and are major components of the eukaryotic innate immune system. However, A2M-like proteins were identified in pathogenically invasive bacteria and species that colonize higher eukaryotes. Bacterial A2Ms are located in the periplasm where they are believed to provide protection to the cell by trapping external proteases through a covalent interaction with an activated thioester. This domain is found on the C-terminal region in A2Ms in bacteria. Structure analysis of Salmonella enterica ser A2Ms (SA-A2Ms) show that they are composed of 13 domains, all of which fold as variants of beta sandwiches with the exception of the TED, which consists of 14 alpha helices. Most of the beta sandwich domains appear to serve a structural role and are referred to as the macroglobulin-like (MG) domains. This is the MG10 domain. MG10 is markedly different from the other MG domains in that it has more beta strands and an alpha helix. The position of MG10 is stabilized by, in addition to other hydrogen bonds, the formation of a beta sheet with MG9.	3.00347e-31
NZ_CP054003.1\|WP_065739719.1\|2551497_2552943_-\|lipopolysaccharide-biosynthesis-protein	gnl\|CDD\|240532	cd13127, MATE_tuaB_like, Uncharacterized subfamily of the multidrug and toxic compound extrusion (MATE) proteins. This family might function as a translocase for lipopolysaccharides and participate in the biosynthesis of cell wall components such as teichuronic acid. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. A number of family members are involved in the synthesis of peptidoglycan components in bacteria.	1.77871e-148
NZ_CP054003.1\|WP_005775508.1\|2557900_2558773_+\|DUF4373-domain-containing-protein	gnl\|CDD\|379546	pfam14297, DUF4373, Domain of unknown function (DUF4373). This domain is found in bacteria, eukaryotes and viruses, and is approximately 90 amino acids in length.	4.11373e-29
NZ_CP054003.1\|WP_065739720.1\|2552939_2553824_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NZ_CP054003.1\|WP_005810390.1\|2562960_2563977_-\|DUF4435-domain-containing-protein	gnl\|CDD\|373095	pfam14491, DUF4435, Protein of unknown function (DUF4435). This presumed domain is functionally uncharacterized. This domain is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 285 and 362 amino acids in length. This domain is sometimes associated with AAA domains.	1.26019e-65
NZ_CP054003.1\|WP_005810392.1\|2563998_2564826_-\|AAA-family-ATPase	gnl\|CDD\|379114	pfam13304, AAA_21, AAA domain, putative AbiEii toxin, Type IV TA system. Several members are annotated as being of the abortive phage resistance system, in which case the family would be acting as the toxin for a type IV toxin-antitoxin resistance system.	4.89154e-12
NZ_CP054003.1\|WP_005775519.1\|2548285_2549368_-\|EpsG-family-protein	gnl\|CDD\|379716	pfam14897, EpsG, EpsG family. This family of proteins are related to the EpsG protein from B. subtilis. These proteins are likely glycosyl transferases belonging to the membrane protein GT-C clan.	2.39351e-10
NZ_CP054003.1\|WP_005775499.1\|2565935_2567027_-\|methylmalonyl-Co-A-mutase-associated-GTPase-MeaB	gnl\|CDD\|236515	PRK09435, PRK09435, methylmalonyl Co-A mutase-associated GTPase MeaB.	0
NZ_CP054003.1\|WP_005775505.1\|2559471_2559801_+\|HipA-N-terminal-domain-containing-protein	gnl\|CDD\|274416	TIGR03071, couple_hipA, HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.	4.67223e-46
NZ_CP054003.1\|WP_065739845.1\|2550375_2551485_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.58524e-138

>NZ_CP054003.1|WP_005775508.1|2557900_2558773_+|DUF4373-domain-containing-protein
MATTYDGINYFPVSVNFMEENAMEVIEVKYGIKGSAIVLKLLCKIYKEGYFIRWDEEQCLIFANKAGREVQTEEVKGIIKILFIKGILDENSYRENGILTSESIQKVWLEATKRRKRELSELPYLIVKPEKENGKPDAPSTPQETQQPELFKEEKTPVNPKNVVHHVAIDAKNACDSGQSKVKESKAEESKEFPPSAPPEGEGEERKEDSAYLQIPGYAFNTMTHNYSGLMDTLKRLSVTDTGEVNSILRLSDYGRKGTTVWRLIANTCWSDIGAKGRYLIAALNKAKRR
>NZ_CP054003.1|WP_005775509.1|2557407_2557755_+|DUF2693-domain-containing-protein
MKRKKRPASQSEAMRLKWKRRIVFEKGYTESCAEWMAERLEALLDHMQYGHAAVAYRKQNGSFQLAKATLIYYEAEFHREYDPTEVEGAVVYWNVDEQRWTTFQVENFIEWRPVV
>NZ_CP054003.1|WP_005775512.1|2555823_2556360_-|capsular-polysaccharide-transcription-antiterminator-UpgY
MEVEKETEIWFAMRATYRRETDAMRLLAKENLGCFVPMQYKISIKKGKKVRVLVPVIHNLIFIHACPSEVKRVKSMVAYLQYITDTRSGKKIIIPDNEMQRFIAVAGTYSDHLLYFQPDELNLSKGTKVRITGGDFEGQEGVFLKVKGARDRRVVIAIQGVIAVAMATIHPDLIEVIK
>NZ_CP054003.1|WP_005775513.1|2555315_2555804_-|transcriptional-regulator
MTLSEEVASLQRAAHDLMYLGMDGSPIYSDDLSRRNGEVYRLTTTLYNSGIKGSTVEEQASVCLALLMGYNASFIDHGEKREHIQEILDRCWDILDTLPASLLKLRLLTACYGEVFDEPLADEARAIIASWNSVSLTTEQQEAINEFQTVVDNPYPWEYVEE
>NZ_CP054003.1|WP_005775515.1|2553968_2555288_-|UDP-glucose-dehydrogenase
MREFNNIKIAVAGTGYVGMSIATLLAQHHEVVAVDVLPEKVEKINQKISPIQDDYIEQYMAEKPLRLSATLDGTAAYSKADFVVIAAPTNYDPVKNYFDTHHIEDVIDLVFSVNPDAVMVIKSTIPVGYCRSLYVKYAQRGVKQLNLLFSPEFLRESKALYDNLYPSRIIVGTPKMMNGNQFDAENEAIRTIANLPMLEQAAKTFAALLQEGAIKADIPTLFMGIKEAEAVKLFANTYLALRVSYFNELDTYAEVKGLDAQSIIEGVGLDPRIGTHYNNPSFGYGGYCLPKDTKQLLANYADIPQNMMTAIVESNRTRKDFIADQVLRKAGYYTASSQWDAKKEQDVVVGVFRLTMKSNSDNFRQSSIQGIMKRIKAKGAQIIIYEPALEDGTSFFGSTVVNDLAKFKQMSDAVIANRYDACLDDVADKVFTRDIFCRD
>NZ_CP054003.1|WP_065739720.1|2552939_2553824_-|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIVLAGGSGTRLYPITKGVSKQLLPIFDKPMIYYPISVLMLAGIREILIISTPYDLPGFQRLLGDGSDFGVRFEYAEQPSPDGLAQAFIIGEKFIGGDSVCLVLGDNIFYGSFFTKMLKEAVVSAELQNKATVFGYWVEDPERYGVAEFDRDGNVLSLEEKPDTPKSNYAVVGLYFYPNRVVEIAKQIKPSSRGELEITSVNQQFLFSQDLKVQVLGRGFAWLDTGTHDSLSEASTFIEVIEKRQGLKIACLEGIAFRQGWIDSKKLRELAYPMLKNQYGKYLLKVIKEIEG
>NZ_CP054003.1|WP_065739719.1|2551497_2552943_-|lipopolysaccharide-biosynthesis-protein
MSESLKHKTFKGVGWSFADNISSSGVSFLVGLVLARLLTPAEYGIMAMIAIFIAISNSIIDSGFSNALIRKTDIKRIDYNTVFFFNLVVGVILYVLLYFCAPSISSFFNEPILIPVTRVIGLVLIINSLGIIQRTIMVREIDFRTQTKISLIASLSSGGIGIVMAFYGYGVWSLVGQQVSRQLLNTVFLWLYSAWRPVCEFSADSFKCLFGFGSKLLLSGLLDTLYKNIYYIVIGRFYSSAQLGQYTRAEQFNTIFSSNLTSVVQRVSYPVLSSIQDEPERLREAYRRVIKATMLISFACMLGLAAVAKPLILLLIGEKWLVSVSYLQIICFAGMLYPLHAINLNILQVKGRSDLFLKLEIIKKIIAVIPIFLGIMYGIEYMLWGSVLISFIAYFLNSYYSAGLIRYPTIDQIKDVFPTFAVSLSVAFVMWIISFLDISIYVMLPLQCFSGLLLSFLVYEKLNLEEYLEIKQLILSCVQKK
>NZ_CP054003.1|WP_065739845.1|2550375_2551485_-|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MDEKLITVTSPLLPSLDDFIPYLEDIWDRKWLTNNGHYHQKLEQALCEYLKVPYISLFTNGTLPLMCALQALRITGEVITTPYSFVATTHSLWWNGIKPVFVDIDPVTCNLDPEKIEAAITPKTTAIMPVHVYGKPCDTVRIQEIADKYGLKVIYDAAHAFGIEVNGKSILESGDMSTLSFHATKVYNTIEGGALVCHDEQTKKRIDYLKNFGFAGETTIVAPGINGKMDEVRSAYGLLNLKQVDSAIEARRKVAVQYRDALKDIPGIRFMEDMPGVRHNYSYFPIFINAEEYGLTRDELYFKLKENDVLGRRYFYPLISEFSTYRGLESAHPDNLPIANRVANSVICLPMHTNLSNADFELVVKLINI
>NZ_CP054003.1|WP_005804392.1|2549373_2550369_-|glycosyltransferase
MNKVPLVSVVCTTYNHEKYIRQTLDGFIIQKTSFPIEIIVHDDASTDSTALIIKEYEKQYPNLFHNIYRLENWYSQKKNIWKYLFQEVARGKYIALCEGDDYWIDPLKLQRQVDFLEAHEDYGLVHTNFCFYSDDTGRVLHNGSKRYNIKNGYIFKELFSGCWIKTLTVCFRKVLVNELPVLTTDCFQGDLFYFYEISLKSKVYFDNYESGVYRVLKESASHNVNYDKMLSFFRSLQRLDYYYADKYNLCGIDRYKLDKKWFIWDLKYFLRIADYDHFCSLTNVHFLSFNRKELGLYICFLFCQIKVFFYAFSLLLRIKCRIFRILKKGII
>NZ_CP054003.1|WP_005775519.1|2548285_2549368_-|EpsG-family-protein
MFLYICTLGLSLIFAILYNVVKYNKKHVLRLLLGILILMLLLLSILRKNTVGGDLINYIPLYDTIAKSSFGEALAIPKYGIIYLFYNKILTLLSPNEFTFMLGTSLVNLLPVFWLIIKYSKIPLLSIFLYVSIGYYTNTFNSVRSSMAIAITICCIPYILERKFYSFLFLYILALCVHLSSFPFILTYWVVNLKLSFKRIISLIVFSYLLSESVSNWIIGYLYLYDPVYDKFESTTGGYSYFFMLFFIFISGYIIYNQNKDKNISKENDLFLRVMLIATCIQPFAFHFMLINRIVLFFSVYIIIFIPNFILYIRPTKIRILGHFIVYVFFILFFIKIIMGINPEYNSNGQMTIPYLFYWE
>NZ_CP054003.1|WP_005775505.1|2559471_2559801_+|HipA-N-terminal-domain-containing-protein
MRQGIVYLNKERVGIITELSSNEYKFRYDDEYFNDPSKPSISLTLTKQQQEYTSHYLFPFFANMLSEGHNRIVQARLLKIDEKDDFGILLATAHTDTAGAVTIKPLDYD
>NZ_CP054003.1|WP_005775504.1|2559793_2560804_+|HipA-domain-containing-protein
MIELTYCPSTLQKGFSTYSPVALKELFNSQKVNHILPYNGMDNNETEQKEFQDNNKHMSISGAQQKYSLVVDNGQMRLSLEQEQATLLLKTKLSEYANKEISPANEHLTMQIASQVYNIPTAANGLCFFQNDEPAYITRRFDIAPNGRKFRKEDFASLAGISKGNKGPNYKYDVLSYEEMADIIKQYVSASSVEVLKFFRLVIFNFLFSNGDAHAKNFSLLETPSGDFILAPAYDLLNTRLHIFDDHVFALQRGLFKENTLNGNDGAVTGKEFIEFGIRIGIPPKRVHKELISFCQKAEQVRDLVEKSFLPNQLKKQYLLHYQMRKDSYLSVGIPT
>NZ_CP054003.1|WP_005775503.1|2560806_2561700_-|helix-turn-helix-domain-containing-protein
MNALQSNIIREITPLSDKDCFYIAERYKTEFTYPIHNHAEFELNFTEKAAGVRRIVGDSAEVISDYDLVLITGKDLEHVWEQHDCHSKEIREITIQFSSDLFFKSFINKNQFDSIRDMLEKAQKGLCFPMSAILKIYPLLDTLASEKQGFYAVIKFLTILYELSLFNEEARTLSSSSFAKIGIHSDSRRVQKVQEYINAHYQEEIRLNQLADMVGMTPVSFSRFFKLRTGKNLSDYIIDIRLGFAARLLVDSTMSIAEICYECGFNNLSNFNRIFKKKKECSPKEFRENYRKKKKLV
>NZ_CP054003.1|WP_005775502.1|2561741_2562989_-|mechanosensitive-ion-channel-family-protein
MEQITEKINNLFVSWGFNSNEVGPIITLILIIGVAFLADLICRHILLKVVAKLVKKTKATWDDIVFDRKVLIYLSHLVPPIIIYVLIPLAIPNVSALDFIRRICMIYIIAVFLRFISAFLSAVYHVYSEREQFRDRPLKGLLQTAQVILFFIGGIVVISVLIDKSPMVLLTGLGASAAILMLVFKDSIMGFVSGIQLSANNMLKVGDWIAMPKYGADGTVIEVTLNTVKVRNWDNTITTIPPYLLVSDSFQNWRGMQESGGRRVKRSINIDMNSVRFCTPEMLAKYKKIQLLTDYVEQTEKVVKEYNKEHHIDNSILVNGRRQTNLGVFRAYLTNYLRSLPDVNKNLTCMVRYLQPTEQGIPVELYFFSAVKEWVPYEGIQADVFDHLLAIIPEFGLRVFQNPTGEDFREWSRRN
>NZ_CP054003.1|WP_005810390.1|2562960_2563977_-|DUF4435-domain-containing-protein
MAISLKDNLTSSYFSAAHKLYSKKARRRIVAYVESYDDVAFWRTLLEEFEDEEHYFQVMLPSATSLAKGKKMVLMNTLNTAELGKSLIACVDSDYDFLLQGATSTSRKINRNKYIFQTYAYAIENYHCYADSLHEVCVQATLNDRHLIDFNEFMKRYSRIVYPLFLWSVWFYRRHDTYTFSMSEFNGCVRLHDVSLRHPERSLEVVRRSVTAKLSELSTRFPQGLEEIDRLSAELERLGVLPDTTYLFVQGHHIMDNVVMKVLTPVCTALRREREQEIKKLAEHNEQFHNELTCYQNSQVNVEVMLRKNSAYKDLYLYQWLKEDIKEFLYGTNNRKDK
>NZ_CP054003.1|WP_005810392.1|2563998_2564826_-|AAA-family-ATPase
MELSANYIKRIEINGLWDRFNIVWDLRPDVNILSGINGVGKTTILNRSVGYLEQLSGEVKSDEKNGVRVFFDNPEATYIPYDVIRSYDRPLIMGDFTARMADKNVKSELDWQLYLLQRRYLDYQVNIGNKMIDLLSSNNEEERGKAATLSVAKRRFQDMVDELFSYTRKKIDRKRNDIAFYQDGELLFPYKLSSGEKQMLVILLTVLVQDNAHCVLFMDEPEASLHIEWQQRLIAMIRELNPNVQIILTTHSPAVIMEGWLDAVTEVSDIATSYK
>NZ_CP054003.1|WP_005775500.1|2564917_2565826_+|DMT-family-transporter
MEIDKNLKGHALAFTANVMWGLMSPIGKSALTEFSALSVTTFRMVGAAAAFWILSAFCKQEQVGHRDMLKIFFASLFALVFNQGIFIFGLSLTSPIDASIVTTTSPIITMIVAAIYLKEPVTNKKVLGIFIGAMGALILILSSQATSAGGGSIWGDLLCMIAQLSFSIYLTVFKGLSQRYSAITINKWMFIYASICYIPFSYQDIAGIEWNSISTAAIYQVLYVVLCGSFIAYICIMTAQKLMRPTVVSMYNYVQPIVASIAAILMGIGSFGWEKGVAIALVFLGVYFVTQSKSKADLEGVS
>NZ_CP054003.1|WP_005775499.1|2565935_2567027_-|methylmalonyl-Co-A-mutase-associated-GTPase-MeaB
MEHPENNEAYKGLVVNAGIEQPSSVNPYLKRKVKKRQLSVNEFVEGIVKGDVTILSQAVTLVESVRPEHQATAQEVIERCLPYSGNSIRVGISGVPGAGKSTSIDVFGLHVLEKGGKLAVLAIDPSSERSKGSILGDKTRMEQLSVHPKSFIRPSPSAGSLGGVARKTRETIILCEAAGFDKIFVETVGVGQSETAVHSMVDFFLLIQLAGTGDELQGIKRGIMEMADGIVINKADGNNIDKAKLAAAQFRNALHLFPAPDSGWTPRVLTYSGFYNLGVKEIWDMVYEYIDFVKGNGYFEYRRNEQSKYWMYESINEQLRDSFYHNAKIESMLQEKEQQVLKGNLTSFVAAKSLLDTYFEDLK
>NZ_CP054003.1|WP_005775498.1|2567035_2568124_-|DUF1573-domain-containing-protein
MKRSLLFIFTLLTITLSAVAQPRISSNKETHHFGQIEWKRPVSVEYTITNTGDKPLVLTNVTTSCACSVANWTKTPIAPGEKGTVGATFDAKALGHFNKSIGIYSNAQPGLVYLNFDGEVVQEIKDFTKTHPYAIGQIRIDRTDIDFPDVHSGEKPVITLGVVNLSDRPYEPVLMHLPPCLKMETNPTVLLKGKKGTITLTLDTKQLMDLGLTQSSVYLARFAGDKVSEENEIPVSAILLPDFSGMTEQDKALAPAIRLSESKIDLSRVLVKKNKARHDIVITNTGKSPLQISKLQVFNPAVGVALKKTILQPGESTRLRVTVLKKNLGKKKRHLRILMITNDPVQPKVEIDVKATSNESHN
>NZ_CP054003.1|WP_005775496.1|2568394_2574175_-|hypothetical-protein
MKIRLICIIVLLSMGMMSWTHAQSYDKLWKQVEQAQQKSLPETIVRLTGEIYKKAEIEKNSPQMLKAYVWQMRFREEITPDSFYVSLNGLEQWVKTTDKPLDRAVLHSLIGSMYADYASQNRWKLNRRTDLEEVTPSNDIREWSKNQFVTKVMSETAVTFQDSLLLLDTSSRSYIPFVELGVTSDYYHHDMYHLLASRAIASLESLSGLGSDSLINARIEGIYRHMMDSYRRTDNPDALLLTNLDYLQWKRRTDPGFRPYHAPEGRIGLTQDPYLGALNKLIAENQSRDICAEVYLLKAQEAVNAGVPASGLQLCDEAISRYPAYHRINALRELKQDILSPDFTVQTPSAVYPGEEFDLKVSFKNLKSFAVQLYAIDLPVRPNAVEVPDETFLKKHGRLLSSVHYVLFPSGDYKMQDSIFHMKALETGLYALRIVPDAEVRSNSAKFLSSTRFKVLTRSLPSKLSEVAVLDDMSGKPIEGVLLSVFDRQNKQLLTATTNAEGKAQFASSGEYRYLTAAKGADTAMPQIYLWGGNYNFTDDTKPVSAVTLLTDRSLYRPGQTVYVKGIAYEQYPDSAHVLAGREYTLTLTDANGQEVGIKKLRTGDFGSFTAEFVLPSVCLNGIFSLNTQNGFRTIRVEDYKRPTFDITFEPVTESYRLGDRVELKGNVKTFSGVPLQDIPVTYTITRSLCSWRMWGVNPVILASDTVRLGADGNFELPVDLKPDTSGSDLDDGDDTSSYYDYKVQVSVTNVAGETQTSEISLRAGKTSLLLFADINGLICKDDSIKATFQVNNLERKPVAVEGSYQLFSISGYEESKAVKDQKVSAQAILSGSFRSNEETLLSDWKTLPSGAYKLVASVTDAQGRKSETEKVVILFALNDKRPPVSMPLWYYEVNTRFDAEHPALFYFGTSEKDAYVLMDVFSGNKHLESKLLHLSDSLVRFEYPYREAYGNGLGITFAFVRKGIVYEQEVSLTKRLPDYTLNIRWDVFRDKLRPGQEEEWKLTIRNPQESPVLAEMLATMYDASLDKIWKADQSLQLYYHLSVPVSHWRRDYADSNYFYFGFRQRSLKVPSFSYDHFVLPPVGYAVAEVLSITNDAAPVTRYARMRGMGAMKQQMKSEAADDVLFESELISVSQDAGAVNQADHPAVNGAADIELRTNFAETAFFYPQLHTNAQGEVSFSFRMPQSLTTWNFRGYAHTQNMMTGQINATAVTSKEFMLTPNLPRFVRVGDHTSIAASVSNLTGKSMSGTVKLVLFNPMTDQVISTQQKKFNAGPGQTVGVDFLFTVTDKYEVLGCRMIAEGGNFSDGEQHLLPVLSNKENLTETLPMPVRGEQTRTFSLADLFNHHSKTATNRRLTVEFTANPAWYAVQALPALSQPRNDDAISWATSWYANTMASYIMNAQPRIRAIFDSWKLGGGTKETFLSNLQKNQEVKNILLSESPWVMEATSESEQKERIATLFDLNNIRNNNAAALLKLQELQLPDGSWSWYKGMDGSPFVTDFIVEQNARIALLTGKPLEGAALNMQRSAFNYLHKEALQEYRSIREAEKNGSKSQGISRSALKYLYLIAISDEKVPASMKEAYTYFLSRVAPSLSQQSVTEKAWSAIILQKVGKVKEAQEFMASLKEYLTRTDDQGMFFDTADSPYTWNNLKVPAHVDVMEAFERVGEDAQVVEEMKMWLLKQKQTQQWDSPVATADAVYALLYNGTNLLDNQGDVRIVLGNEVLETISPAKTTVPGLGYIKKTFTDRKTVDAAEIIVEKRDPGIAWGGVYAQFEESLDKVVRQGSGLDVDKKLYVETIAHNNRQLQPIIGKTQLKVGDKVVVRLTVRLDRTMDFIQLKDQRAACLEPIKVLSGYRNVGDVGCYVAVKDASTDFFFDTLNKGTYVLEYSYRVDRAGSYETGIATIQSAYAPEYAAHSASFRCNISQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054003_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054003_2

3335875-3335952

Orphan

Consensus_repeat	Method
TTGCATAACCAAACGCATAACCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054003_2

>merge|NZ_CP054003|2|3335875-3335952|CRISPRCasFinder
TTGCATAACCAAACGCATAACCAATCAGCGCATTTCGTTTTTTTCTTGACAAATTTGCATAACCAAACGCATAACCAA

>NZ_CP054003|2|2|3335875-3335952|CRISPRCasFinder
TTGCATAACCAAACGCATAACCAA	TCAGCGCATTTCGTTTTTTTCTTGACAAAT
TTGCATAACCAAACGCATAACCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054003.1\|WP_005779479.1\|3330495_3330939_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054003.1\|WP_005779518.1\|3344852_3346364_+\|GH3-auxin-responsive-promoter-family-protein	unknown	unknown	gnl\|CDD\|377019
NZ_CP054003.1\|WP_032541675.1\|3330996_3331866_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379165
NZ_CP054003.1\|WP_005779512.1\|3341514_3342777_+\|beta-ketoacyl-ACP-synthase-II	unknown	unknown	gnl\|CDD\|274452
NZ_CP054003.1\|WP_005779510.1\|3341262_3341499_+\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|179197
NZ_CP054003.1\|WP_005779505.1\|3339365_3340409_+\|4-phosphoerythronate-dehydrogenase-PdxB	unknown	unknown	gnl\|CDD\|166874
NZ_CP054003.1\|WP_005779502.1\|3338516_3339233_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|132997
NZ_CP054003.1\|WP_005779475.1\|3328913_3329624_-\|DUF2786-domain-containing-protein	unknown	unknown	gnl\|CDD\|378525
NZ_CP054003.1\|WP_005779500.1\|3337057_3338512_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
NZ_CP054003.1\|WP_005779490.1\|3334474_3334693_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054003.1\|WP_118576682.1\|3335013_3335667_+\|LexA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|119397
NZ_CP054003.1\|WP_032541630.1\|3342781_3343654_+\|ribonuclease-III	unknown	unknown	gnl\|CDD\|274024
NZ_CP054003.1\|WP_005940377.1\|3329632_3329860_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237660
NZ_CP054003.1\|WP_005779487.1\|3334064_3334472_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054003.1\|WP_032541678.1\|3346412_3347504_-\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|173128
NZ_CP054003.1\|WP_005779492.1\|3334689_3334875_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054003.1\|WP_005779485.1\|3331889_3333950_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366234
NZ_CP054003.1\|WP_032537628.1\|3340537_3341164_-\|phosphoribosylglycinamide-formyltransferase	unknown	unknown	gnl\|CDD\|187714
NZ_CP054003.1\|WP_005779516.1\|3343672_3344683_-\|6-phosphofructokinase	unknown	unknown	gnl\|CDD\|235111
NZ_CP054003.1\|WP_005779477.1\|3329871_3330492_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223993

Protein	Function_ID	Function_description	E-value
NZ_CP054003.1\|WP_005779518.1\|3344852_3346364_+\|GH3-auxin-responsive-promoter-family-protein	gnl\|CDD\|377019	pfam03321, GH3, GH3 auxin-responsive promoter.	8.10188e-161
NZ_CP054003.1\|WP_032541675.1\|3330996_3331866_-\|AAA-family-ATPase	gnl\|CDD\|379165	pfam13401, AAA_22, AAA domain.	1.36788e-10
NZ_CP054003.1\|WP_005779512.1\|3341514_3342777_+\|beta-ketoacyl-ACP-synthase-II	gnl\|CDD\|274452	TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein synthase II. 3-oxoacyl-[acyl-carrier-protein] synthase 2 (KAS-II, FabF) is involved in the condensation step of fatty acid biosynthesis in which the malonyl donor group is decarboxylated and the resulting carbanion used to attack and extend the acyl group attached to the acyl carrier protein. Most genomes encoding fatty acid biosynthesis contain a number of condensing enzymes, often of all three types: 1, 2 and 3. Synthase 2 is mechanistically related to synthase 1 (KAS-I, FabB) containing a number of absolutely conserved catalytic residues in common. This model is based primarily on genes which are found in apparent operons with other essential genes of fatty acid biosynthesis (GenProp0681). The large gap between the trusted cutoff and the noise cutoff contains many genes which are not found adjacent to genes of the fatty acid pathway in genomes that often also contain a better hit to this model. These genes may be involved in other processes such as polyketide biosyntheses. Some genomes contain more than one above-trusted hit to this model which may result from recent paralogous expansions. Second hits to this model which are not next to other fatty acid biosynthesis genes may be involved in other processes. FabB sequences should fall well below the noise cutoff of this model. [Fatty acid and phospholipid metabolism, Biosynthesis].	0
NZ_CP054003.1\|WP_005779510.1\|3341262_3341499_+\|acyl-carrier-protein	gnl\|CDD\|179197	PRK00982, acpP, acyl carrier protein; Provisional.	1.16951e-34
NZ_CP054003.1\|WP_005779505.1\|3339365_3340409_+\|4-phosphoerythronate-dehydrogenase-PdxB	gnl\|CDD\|166874	PRK00257, PRK00257, 4-phosphoerythronate dehydrogenase PdxB.	0
NZ_CP054003.1\|WP_005779502.1\|3338516_3339233_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|132997	cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.	0.00160986
NZ_CP054003.1\|WP_005779475.1\|3328913_3329624_-\|DUF2786-domain-containing-protein	gnl\|CDD\|378525	pfam10979, DUF2786, Protein of unknown function (DUF2786). This family of proteins has no known function.	2.82838e-08
NZ_CP054003.1\|WP_032537628.1\|3340537_3341164_-\|phosphoribosylglycinamide-formyltransferase	gnl\|CDD\|187714	cd08645, FMT_core_GART, Phosphoribosylglycinamide formyltransferase (GAR transformylase, GART). Phosphoribosylglycinamide formyltransferase, also known as GAR transformylase or GART, is an essential enzyme that catalyzes the third step in de novo purine biosynthesis. This enzyme uses formyl tetrahydrofolate as a formyl group donor to produce 5'-phosphoribosyl-N-formylglycinamide. In prokaryotes, GART is a single domain protein but in most eukaryotes it is the C-terminal portion of a large multifunctional protein which also contains GAR synthetase and aminoimidazole ribonucleotide synthetase activities.	4.58524e-84
NZ_CP054003.1\|WP_118576682.1\|3335013_3335667_+\|LexA-family-transcriptional-regulator	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	2.83393e-10
NZ_CP054003.1\|WP_032541630.1\|3342781_3343654_+\|ribonuclease-III	gnl\|CDD\|274024	TIGR02191, Ribonuclease_3, ribonuclease III, bacterial. This family consists of bacterial examples of ribonuclease III. This enzyme cleaves double-stranded rRNA. It is involved in processing ribosomal RNA precursors. It is found even in minimal genones such as Mycoplasma genitalium and Buchnera aphidicola, and in some cases has been shown to be an essential gene. These bacterial proteins contain a double-stranded RNA binding motif (pfam00035) and a ribonuclease III domain (pfam00636). Eukaryotic homologs tend to be much longer proteins with additional domains, localized to the nucleus, and not included in this family. [Transcription, RNA processing].	3.91557e-76
NZ_CP054003.1\|WP_005940377.1\|3329632_3329860_-\|hypothetical-protein	gnl\|CDD\|237660	PRK14289, PRK14289, molecular chaperone DnaJ.	0.00959322
NZ_CP054003.1\|WP_005779485.1\|3331889_3333950_-\|hypothetical-protein	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	0.00189943
NZ_CP054003.1\|WP_032541678.1\|3346412_3347504_-\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|173128	PRK14665, mnmA, tRNA-specific 2-thiouridylase MnmA; Provisional.	0
NZ_CP054003.1\|WP_005779500.1\|3337057_3338512_-\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.84844e-36
NZ_CP054003.1\|WP_005779516.1\|3343672_3344683_-\|6-phosphofructokinase	gnl\|CDD\|235111	PRK03202, PRK03202, ATP-dependent 6-phosphofructokinase.	6.27155e-165
NZ_CP054003.1\|WP_005779477.1\|3329871_3330492_-\|hypothetical-protein	gnl\|CDD\|223993	COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones].	0.0002773

>NZ_CP054003.1|WP_118576682.1|3335013_3335667_+|LexA-family-transcriptional-regulator
MKDRIIQIIENKGIAKESFYTKIGMTSASFRGKAKSMPLNSNAIENILSEIPDLNAEWLLTGKGSMLKESSQAIPTPTINYEYKGAPYYNVDFIGGFDLVLNDQTINPDYYINFEPYNKPGVVWCNITGHSMEPELSNGDYIALKEMTDPVQYLPYGEIYAIVTESYRTVKRIGKAEQKDFVRLIPTNKSPEYSPQDIPISMIQKVYAVLGSMHRLF
>NZ_CP054003.1|WP_005779492.1|3334689_3334875_-|hypothetical-protein
MRKRIVVDRGEIKKISKDFKVTSKAVWEALVYRSNSSKARLIRKVALERGGVEIGDQKETV
>NZ_CP054003.1|WP_005779490.1|3334474_3334693_-|hypothetical-protein
MKKVLLLLFGDEFGEYFSLTARQKFYVWYFCLSFCFLCITDDSPVWAIAVVVLNFANAARLIKKVPLNIKED
>NZ_CP054003.1|WP_005779487.1|3334064_3334472_-|hypothetical-protein
MKRVFHVKEDDTIRKSFEDLLDAERTLYSARCPEIVNEMDDTPSLWLSLQPPYAPSQSRSRRFLELDEEPYFRLAGLLELTYRNSTPPELQMQGLTIRIRDNKAYFCISGSISLADLQRLCERCQAGQSPDQCKK
>NZ_CP054003.1|WP_005779485.1|3331889_3333950_-|hypothetical-protein
MEYFNKIVCVTYEELLTVIPKGTLNSLLYRGKIQRVDRGGGLDGYARYSYLSLPERYRIRFEQKYGDPVELIKEQCMKDRLKIDDAARTFFEDYRYDKAGERVSLTERKKEEYTINASVLNELISILNDREGYRKALGGSTKKVWETIIGTSDRLRDSYGHTLPENAARLKDKINQYKKEGYSCLISKKMGNDNTLKITEEAGNQIIALKRSSVPVYTDSQIFVEFNRIADEKGWKQLRSIQSLRQFLNRPDIEPLWYDAVHGELKAHQRYSRKNKTELPSMRDSLWYGDGTKINLYYKDYDKDGKLVVRTTQVYEVIDAYSEVFLGYHISDSEDYEAQYNAYRMAIQVSGHKPYELVHDNQGGHKKLQNSNFFDKIVGHVHRTTAPYSGQSKTIESVFGRFQAEVLHKDWRFTGQNITTKKDTSRPNLERIEANKDKLYTLAELKAAYAAARKEWNESKHFATGTSRMKMYKNSVNPDTPAVGVLDMIEMFWVMTDKPSTYTDNGLKITIKKREFTYEVYEAPGVPDHEFLRSNRGQKFYTMYDPYDHTSVRLYKKDKAGELRFVRTAEPYIVIHRNIQEQTEGEMSFIRRNIEANTEDRIERQVGARIIEQAHGMSMEQQGLKRPKLKGAKSETEREIERRVRRYSQDPEQLSAGKVTKLISNITFDQLNGDIRLNEKKVAGKL
>NZ_CP054003.1|WP_032541675.1|3330996_3331866_-|AAA-family-ATPase
MTQQEKDNIRDVLRVYAAKYSSQKKAAASLNGVSAGTLSAVINGKYENISDDMFRNIIAQITPAAAATGWQLVETNSFQEIWYALSDAQEFKKVRWIVGGAGCGKTTTAAMYAQKNHEVFVILCDEDMRKGDFVREIARKLGFKTCGMRIREILDLAIESIIQMENPLLVFDEGDKLNDNVFHYFINLYNRLEGKCGITFLSTDYIQHRIDCGLNHNRKGYNEIYSRIGRKFFELEPTSCNDVFAICQANGLTDKKQIAKVIDLTEKSEFDLRCVKDAIHREKKVAAAK
>NZ_CP054003.1|WP_005779479.1|3330495_3330939_-|hypothetical-protein
MKQIVLPLASRFPVGHFKRGQLTGFPEKVIKGTKIHTFREDPGKWAYNVELINSHNAELSIRRWIGRPYHTPQLEVKRLKKIGIQQVQMTWDSDIEQPTVFIDGKRILNVEQLAANDGMTLDDFVSWFFKTSNTFEGVIIHFTDFRY
>NZ_CP054003.1|WP_005779477.1|3329871_3330492_-|hypothetical-protein
MARALSVTEAVSMKKETLKLTGAWADAFGEPERIGVWFIWGNSGNGKSSFVMQLCKELAKFGRVAYDSLEEGASLTMQNTLRRFNMAEVNRRFQLLDCEPMSELGERMDKHKSPDFYVIDSFQYTQMSYKEYIKFKEAHRNKLLIFISHADGRNPDGRSAKKVMYDAALKIYVEGFRAFSKGRFFGSVGHFTIWDEGAVRYWGDNA
>NZ_CP054003.1|WP_005940377.1|3329632_3329860_-|hypothetical-protein
MSKNNQVITISPPMFIGEGNQKESISSKGHRCSYCHGNGFFWGEEQRERVKVDCPVCKGSGKLDAVITIEWKPAK
>NZ_CP054003.1|WP_005779475.1|3328913_3329624_-|DUF2786-domain-containing-protein
MEKEVPENILAKIRKLLRLKESAIKIGSEGEAHAAAEAVNRLLTSYNLSLMDVTPEEQKNMISVSESEKITYQDTYGNIWKRDLLRIICEYNFCRILLHGGTTYMVVVGTRENAEVVLSLYNYLRSVFRRLSVERCTEYVATRRGYYRTKKFKRNYIKSYLLGCCTGLRKQFESIRKTAEETGLMLCHSHLIDDYFQSIGTTTHKSKNRNKVNASAYCSGYDDGSKINLNKQINGK
>NZ_CP054003.1|WP_005779500.1|3337057_3338512_-|glycosyltransferase
MAKPLVSVVIPVYNMEEFLEETLDSVLSSDYPNFEVIVMDDGSKDRSLEIAESYKSRYENVRVYTQVNSGVATARNHAISKAGGVYILPVDADNRISKELIHSAVDILESDPEVKVVCPRAEFFGDRSGEWVLPPFSLSLLARKNMMDTCAVYRKSEWERIGGYCAEIVAREDWEFWISMLKDGGKVVKLPEIGLFYRVREQSKRVTDRLLKKHVIDVLNRRHPDFFERELGGPLRYQRSWSRLINRISRIIHPRRVFVGDDFQDLSSFVRVLPVHFENGGTLIYEGRNKLKEFEIHGRKLIVKSYQLPHLINRVVYNSFRASKARRSYQYAQMLRKAGVGSPAPVGFYSTGTWLLFGRSYFVSLKSECPYTYRNLLEETFTGDKEKVLRAIARTTAALHENGFLHKDYSGGNILFRETDKGIEVEIIDLNRMRFGKVDIETGCKNFERLPGTHEMFVILADEYAKVRGFDVDRCLELIEKSHL
>NZ_CP054003.1|WP_005779502.1|3338516_3339233_-|glycosyltransferase-family-2-protein
MKCIHIITPVKDSIELTLQTAEAILKSDFTVPFHYTIYNDFSTDENTKRLKEASLAMGFELINLCEITSHPSPNYLLVLQMAQEKAVAAEAGLLIVESDVIVKKHTLQALFDGARSRKNCGIAAAVTVDENEVINYPYLYAKGKENQVFPEKKHLSFCCSLLTTDFLRAFDFHSLNPEKNWFDVTISHQALEKGFVNYLFTTLTVWHRPHSSRPWKQLKYTNPLKYYWLKFTKGLDKI
>NZ_CP054003.1|WP_005779505.1|3339365_3340409_+|4-phosphoerythronate-dehydrogenase-PdxB
MKVIVDNKIPYIKEAIEQIADEVVYAPGKDFTPELIHDADALIIRTRTHCNRPLLAGSKVKFIATATIGFDHIDTAYCREAGITWTNAPGCNSASVAQYIQSALFILQQTHAMKLHQMTIGIVGVGNVGSKVADVARKLGMRVMLNDLPRAEKEESTMFTTLENIAKECDIITFHVPLYKEGKYKTYHLADKHFFRSLKKGAIVMNTSRGEVIETEALLDALQSGTLSDAVIDVWEHEPDINLKLLEKVIIGTPHIAGYSADGKANATRMSLEALCRFFRIEAGYQIVPPEPENKIISATTYEAASLQIYDPRRDSDALKTHPKLFEQLRGDYPLRREEGAYKINIS
>NZ_CP054003.1|WP_032537628.1|3340537_3341164_-|phosphoribosylglycinamide-formyltransferase
MQSFAHFSLFCALKGLIMEKNIAIFASGSGTNAENIIRYFEGNDSVRVKLVLSNRKDAHVLERAHRLGVPCRAFPKSDWEIAESILDLLREHQIDLIVLAGFLLRIPDALLHAYPNKIINIHPALLPKFGGKGMYGDRVHEAVVMAGESESGITIHYIDEHYDEGSIIFQAKCSVLPGDTPAEVAKKVHALEYEWFPRIIEQTVNTFL
>NZ_CP054003.1|WP_005779510.1|3341262_3341499_+|acyl-carrier-protein
MSEIASRVKAIIVDKLGVEESEVTETASFTNDLGADSLDTVELIMEFEKEFGISIPDDQAEKIGTVQDAVAYIEEHAK
>NZ_CP054003.1|WP_005779512.1|3341514_3342777_+|beta-ketoacyl-ACP-synthase-II
MELKRVVVTGLGAITPVGNTVPEFWENLVNGVSGAGPITHFDASQFKTQFACEVKGFDVTQYIDRKEARKMDLYTQYAVAVAKEAVADSGLDIENEDLNRIGVIFGAGIGGIRTFEEETSNYALHKENGPKYNPFFIPKMISDIAAGQISIMYGFHGPNYATCSACATSTNAIADAFNLIRLGKANVIVSGGSEAAIAAAGVGGFNAMHALSTRNDEPQSASRPFSASRDGFVMGEGGGCLILEELEHAKARGAKIYAEVAGVGMSADAHHLTASHPEGLGAKLVMMNALEDAEMDPKEVDYINVHGTSTPVGDISEAKAIKEVFGEHAFELNISSTKSMTGHLLGAAGAVESIASILAIKNGIVPPTINHAEGDNDENIDYNLNFTFNKAQKREVNVALSNTFGFGGHNACVIFKKYAE
>NZ_CP054003.1|WP_032541630.1|3342781_3343654_+|ribonuclease-III
MLRNKIDKIRLLFCKDRESYFCFYRILGFYPRNIRLYEQALLHKSTAVRSEKGRPLNNERLEFLGDAILDAIVGDIVYQHFEGKREGFLTNTRSKIVQRETLNKLAVEIGLDKLIKYSTRSSSHNSYMYGNAFEAFIGAIYLDRGYECCKQFMQKKIIEPYIDLDKLSRKEVNFKSKLIEWSQKNKMEVSFELIEQFLDKENNPVFQTEVRIEGILGGSGTGYSKKESQQNAAQMALKKIKGDPEFMAGVQEAKVQNNISTGDTPDDPEINQTEESPQVDKITSTENISI
>NZ_CP054003.1|WP_005779516.1|3343672_3344683_-|6-phosphofructokinase
MKIGILTSGGDCPGINATIRGVCKTAINHYGMEVVGIHSGFQGLLTKEVESFTEKSLSGLLNLGGTMLGTSREKPFRKQGIISDVDKPALIQRNIAELGLDCVVCIGGNGTQKTAAKFAAMGINIVSVPKTIDNDIWGTDISFGFDSAVSIATDAIDRLHSTASSHKRVMVIEVMGHKAGWIALYSGMAGGGDVILVPEIPYNIKNIGDTILNRLKKGKPYSIVVVAEGIQTDGRKRAAEYIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATELIANGQFGRMIALKGDEISSVALEEVAGKLKLVTEEHDLVVQGRRMGICFG
>NZ_CP054003.1|WP_005779518.1|3344852_3346364_+|GH3-auxin-responsive-promoter-family-protein
MNITKIISKVFDSRLKAIDLYDTQAGDIQHRVLTRLVKQAENTEWGKKYDYKSIRNYEDFKNRLPIQTYEEVKPYVERLRAGEQNLLWPSEIRWFAKSSGTTNDKSKFLPVSKEALQDIHYRGGKDAAAIYFRMNPDSRFFSGKGLILGGSHSPNLNSNHSLVGDLSAILIQNVSPLINLIRVPSKQIALMDEWETKIEAIANSTIPVDVTNLSGVPSWMLVLIKRILEKTGKQTLEEVWPNLEVFFHGGVAFTPYREQYKQVIHSSKMHYVETYNASEGYFGTQNDFSDPSMLLMIDYGIFYEFIPLEDVEKENPRTYCLEEVELNKNYAMVISTSCGLWRYMIGDTVKFTRKNPYKFVITGRTKHFINAFGEELIVDNAEKGLAKACAETGAQVSEYSAAPVFMDENAKCRHQWLIEFAKMPDSIERFAAVLDTTLKEVNSDYEAKRWKDIALQPLEVIVARKGLFHDWLAQKGKLGGQHKVPRLSNTRDYIEEMIALNKQ
>NZ_CP054003.1|WP_032541678.1|3346412_3347504_-|tRNA-2-thiouridine(34)-synthase-MnmA
MEENKRVLLGMSGGTDSSVAAMLLLEAGYEVTGVTFRFYEFNDSTEYLEDARALATRLGIEHITYDAREIFRKKIVDYFIDEYMAGHTPVPCTLCNNWLKWPLLAKIADEMGIFYLATGHYVRKKWMDGSYYITLAADPDKDQSFFLWGLKQDILQRMLLPMGEMTKPEARAYAAGRGFEKVSKKKDSIGVCFCPLDYRSFLKKHLCDAGGDRSNKIIREVGKGRFLDESGNFIAWHEGYPFYTIGQRRGLGIQLNRAVFVKEIHPETNEVILAPLKSLEKSEMWLKDWNIINESRLLGYDDIIVRIRYRKQENHCSVTITPEGLLHIQLHEPLSAIAEGQAAAFYKDGLLLGGGIITMDDER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054003_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054003_3

4756774-4756866

Orphan

Consensus_repeat	Method
TCCTGCAAGGCTTCGGCTGTACGGTTCAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054003_3

>merge|NZ_CP054003|3|4756774-4756866|CRISPRCasFinder
TCCTGCAAGGCTTCGGCTGTACGGTTCAGGTATGCTTTACATTCACGTGCGTAAACGCTTATATCCTGCAAGGCTTCGGCTGTACCGTTCAGG

>NZ_CP054003|3|3|4756774-4756866|CRISPRCasFinder
TCCTGCAAGGCTTCGGCTGTACGGTTCAGG	TATGCTTTACATTCACGTGCGTAAACGCTTATA
TCCTGCAAGGCTTCGGCTGTACCGTTCAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054003.1\|WP_005780977.1\|4756927_4757803_-\|fimbrillin-family-protein	unknown	unknown	gnl\|CDD\|372499
NZ_CP054003.1\|WP_005780917.1\|4762199_4762832_-\|CatB-related-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100040
NZ_CP054003.1\|WP_005780989.1\|4745663_4746641_-\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381615
NZ_CP054003.1\|WP_005780975.1\|4757999_4758884_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225509
NZ_CP054003.1\|WP_005780981.1\|4754745_4755528_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054003.1\|WP_032536584.1\|4764420_4765401_+\|IS982-like-element-IS1187-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP054003.1\|WP_032541807.1\|4751230_4752739_+\|TolC-family-protein	unknown	unknown	gnl\|CDD\|367035
NZ_CP054003.1\|WP_050418577.1\|4746859_4747162_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054003.1\|WP_005780969.1\|4760261_4761011_-\|subclass-B1-metallo-beta-lactamase-CfiA14	unknown	unknown	gnl\|CDD\|293860
NZ_CP054003.1\|WP_005780992.1\|4738373_4738745_+\|DUF2809-domain-containing-protein	unknown	unknown	gnl\|CDD\|378530
NZ_CP054003.1\|WP_032541810.1\|4738863_4744737_+\|DUF3320-domain-containing-protein	unknown	unknown	gnl\|CDD\|379066
NZ_CP054003.1\|WP_005780965.1\|4764093_4764369_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054003.1\|WP_032541809.1\|4744726_4745626_-\|ion-transporter	unknown	unknown	gnl\|CDD\|366146
NZ_CP054003.1\|WP_032541803.1\|4762828_4763275_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP054003.1\|WP_005780973.1\|4759012_4759699_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319817
NZ_CP054003.1\|WP_032541806.1\|4755868_4756699_-\|fimbrillin-family-protein	unknown	unknown	gnl\|CDD\|372499
NZ_CP054003.1\|WP_032536584.1\|4761183_4762164_+\|IS982-like-element-IS1187-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP054003.1\|WP_032541808.1\|4747358_4751093_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|226220
NZ_CP054003.1\|WP_005780971.1\|4759708_4760035_-\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NZ_CP054003.1\|WP_005780983.1\|4752775_4754422_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|379862

Protein	Function_ID	Function_description	E-value
NZ_CP054003.1\|WP_032541809.1\|4744726_4745626_-\|ion-transporter	gnl\|CDD\|366146	pfam00520, Ion_trans, Ion transport protein. This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.	6.60879e-33
NZ_CP054003.1\|WP_005780917.1\|4762199_4762832_-\|CatB-related-O-acetyltransferase	gnl\|CDD\|100040	cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.	1.3433e-67
NZ_CP054003.1\|WP_005780989.1\|4745663_4746641_-\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381615	cd16894, MltD-like, Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	7.84442e-62
NZ_CP054003.1\|WP_005780975.1\|4757999_4758884_-\|hypothetical-protein	gnl\|CDD\|225509	COG2961, ComJ, Protein involved in catabolism of external DNA [General function prediction only].	0.000713374
NZ_CP054003.1\|WP_032536584.1\|4764420_4765401_+\|IS982-like-element-IS1187-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	7.52675e-15
NZ_CP054003.1\|WP_032541807.1\|4751230_4752739_+\|TolC-family-protein	gnl\|CDD\|367035	pfam02321, OEP, Outer membrane efflux protein. The OEP family (Outer membrane efflux protein) form trimeric channels that allow export of a variety of substrates in Gram negative bacteria. Each member of this family is composed of two repeats. The trimeric channel is composed of a 12 stranded all beta sheet barrel that spans the outer membrane, and a long all helical barrel that spans the periplasm.	1.29529e-19
NZ_CP054003.1\|WP_005780992.1\|4738373_4738745_+\|DUF2809-domain-containing-protein	gnl\|CDD\|378530	pfam10990, DUF2809, Protein of unknown function (DUF2809). Some members in this family of proteins are annotated as yjgA however currently no function for the protein is known.	1.2106e-23
NZ_CP054003.1\|WP_032541810.1\|4738863_4744737_+\|DUF3320-domain-containing-protein	gnl\|CDD\|379066	pfam13195, DUF4011, Protein of unknown function (DUF4011). This family of proteins is found in archaea and bacteria. Many members are annotated as being putative DNA helicase-related proteins.	3.54795e-61
NZ_CP054003.1\|WP_005780969.1\|4760261_4761011_-\|subclass-B1-metallo-beta-lactamase-CfiA14	gnl\|CDD\|293860	cd16302, CcrA-like_MBL-B1, Bacteroides fragilis CcrA and related metallo-beta-lactamases, subclass B1; MBL-fold metallo-hydrolase domain. MBLs (class B of the Ambler beta-lactamase classification) are a diverse group of metallo-enzymes that are capable of catalyzing the hydrolysis of a wide range of beta-lactam antibiotics. MBLs have been divided into three subclasses B1, B2 and B3, based on sequence/structural relationships and substrates, with the B1 and B2 MBLs being most closely related to each other. This subgroup of MBLs belongs to the B1 subclass. B1 enzymes are most active with two zinc ions bound in the active site, and have a broad-spectrum substrate profile.	2.67925e-125
NZ_CP054003.1\|WP_032541803.1\|4762828_4763275_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.61085e-41
NZ_CP054003.1\|WP_005780973.1\|4759012_4759699_+\|HAD-family-hydrolase	gnl\|CDD\|319817	cd07515, HAD-like, uncharacterized family of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The haloacid dehalogenase-like (HAD) hydrolases are a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members include 2-L-haloalkanoic acid dehalogenase (C-Cl bond hydrolysis), azetidine hydrolase (C-N bond hydrolysis); phosphonoacetaldehyde hydrolase (C-P bond hydrolysis), phosphoserine phosphatase and phosphomannomutase (CO-P bond hydrolysis), P-type ATPases (PO-P bond hydrolysis) and many others. Members are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.00878e-48
NZ_CP054003.1\|WP_032541806.1\|4755868_4756699_-\|fimbrillin-family-protein	gnl\|CDD\|372499	pfam13149, Mfa_like_1, Fimbrillin-like. A family of putative fimbrillin proteins found by clustering human gut metagenomic sequences. Analysis of structural comparisons shows this family to be part of the FimbA (CL0450) superfamily of adhesin components or fimbrillins.	4.92355e-24
NZ_CP054003.1\|WP_005780977.1\|4756927_4757803_-\|fimbrillin-family-protein	gnl\|CDD\|372499	pfam13149, Mfa_like_1, Fimbrillin-like. A family of putative fimbrillin proteins found by clustering human gut metagenomic sequences. Analysis of structural comparisons shows this family to be part of the FimbA (CL0450) superfamily of adhesin components or fimbrillins.	6.70706e-13
NZ_CP054003.1\|WP_032536584.1\|4761183_4762164_+\|IS982-like-element-IS1187-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	7.52675e-15
NZ_CP054003.1\|WP_032541808.1\|4747358_4751093_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|226220	COG3696, COG3696, Putative silver efflux pump [Inorganic ion transport and metabolism].	5.61363e-158
NZ_CP054003.1\|WP_005780971.1\|4759708_4760035_-\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	4.55295e-23
NZ_CP054003.1\|WP_005780983.1\|4752775_4754422_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|379862	pfam16576, HlyD_D23, Barrel-sandwich domain of CusB or HlyD membrane-fusion. HlyD_D23 is the combined domains 2 and 3 of the membrane-fusion proteins CusB and HlyD, which forms a barrel-sandwich. CusB and HlyD proteins are membrane fusion proteins of the CusCFBA copper efflux system in E.coli and related bacteria. The whole molecule hinges between D2 and D3. Efflux systems of this resistance-nodulation-division group - RND - have been developed to excrete poisonous metal ions, and in E.coli the only one that deals with silver and copper is the CusA transporter. The transporter CusA works in conjunction with a periplasmic component that is a membrane fusion protein, eg CusB, and an outer-membrane channel component CusC in a CusABC complex driven by import of protons.	9.86387e-87

>NZ_CP054003.1|WP_032541806.1|4755868_4756699_-|fimbrillin-family-protein
MKQALLTLMGWMLLSQGCSYGVADDCLPPEEPVPIRMAIAEEKLPTRAPVTTIDASNLSSVGIYAVREGSTAGQYPWTPTPFALNLTPSGISGNQISFNPKLYYPLGGKRVIFYGYYPRTTTTATTGNNYITAPDNGIAPTYHFTLTGTEDVMYAVSTPTGSTSTSPVSLTFNHVLTQLRLNTSLLGSLSGIKLVGVSNKGTLNIGSGAVTYDSSVTDIALTIPLLGSVTDAVMVPAGVASYKVEVVLLLSLLKRTYLVKPTSGTFQPGVIYTISL
>NZ_CP054003.1|WP_005780981.1|4754745_4755528_+|hypothetical-protein
MTKKHRKESLDALFREKVLLEMLKVAGVGMWTYSTETGKLRYIGFADTIHRHDELQYVDPLDYLKLMNGEDAQIVTQFMAALHAGRPPQEGIRYKVHGNGEDFYLENHVVTCQPLGNGFYYLKGYVKNITAQVMEMNRLHIGKERTEQADRLRSAFFSHVSRELRGPLQAMEELASRMVNAGSREEREECFRQIQESKRAAMKMADALHTVSQLPASTYEPYHSPMRLCLMYRDLLAENGCIHNSEDGEQEANFLSLLFS
>NZ_CP054003.1|WP_005780983.1|4752775_4754422_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MKKISDILRKKQVLYPLIAFAGFILGWLLFSPSSSSGTTEGILSEPPIHDTHGSSHDLVQDESGVWTCSMHPQIRQDKPGKCPICGMDLIPLKKNVASGSDDAIDPNAIRMSEEAMALADVQTTRVSRSNPVKQVRLYGKIIPDERSLQSQTAYVGGRIERLNIEFTGETVRAGQTLATLYSPELFTAQQELLEAIHMQQPALVQAAREKLRLWNLTDAQIDAIRDSGQASPMVEIKSNTSGIVIAKRINQGDYVSQGSVLFDIANLSHVWAVFDAFEADLPFLTKGDLVEFTLSAFPGKKFSGRISFIDPIINATTRTARVRVDVANSAQEMKPEMYATARVFAPLKGYKDQIIVPQTAILWTGKRAVVYVRQPGTDIPTFLMREITLGPSLGGAYVVLDGLSDGEEIVTNGVFSIDASAQLEGKRSMMNENGSGTAPMVGHGGHNMSGTHDSHAGSQNNEHTMFTVHGSCGMCKERIETAAKRVPGVRTADWDQEKQMIHLQFDPSKTSADAVAKAIAKVGHDTDKYKADKAVYDTLPGCCKYRDK
>NZ_CP054003.1|WP_032541807.1|4751230_4752739_+|TolC-family-protein
MMNRKYKYPLVIAINILLCPAVIPVSARQFASPTEGQQPVDSLSVYLEQAARNNPQVNADFMLYKASLEKIPQAGAFSDPELEIGLFIKPMETLMGKQVADFTLMQMFPWFGTRKAARGEASEMARMAYEQFRDTRNNLWYEVKAQWYQLCNLNEQYRTMKTNIHLLCQLEQLALNRFSASSAQATSLSVSSSSSAAKSISSMPLASASGNDMAGMGGMGNAASAIASGTSIGTSSGGMSGMGGGSMGSTATGSMSDVLRIQMERAELEDNLATLQSARLTAEARFNALLNRPSDVPVHVPDSLTQRFYRIDEHILIDSILTHNPMITMLEAEGEAFRAKAKMERRMSYPMIGIGLQYSLVNKVADPMGMPDMNGKDMVMPMLKISLPLFRRKYNAQQRESHNYRVASELKRDNIQNQLQAEYINVRQQLDDAARKVLLYEQQYSLSLSTWQLMVREFSAGRQSLTDVIQVERQMLDYKLKKSEAIAAYNTMVAAMEKLIAR
>NZ_CP054003.1|WP_032541808.1|4747358_4751093_+|efflux-RND-transporter-permease-subunit
MINKIIRYFLENRVITMLLLALVVVWGVSTAPFNWHGGIVPRNPIPVDAIPDIGDNQQIVATEWMGRSPKDIQDQITYPLTTSLLGIPGVKTIRSSSMFGMSFIYIIFEDDIEFYWSRSRILEKLNSLPPGTLPEDVQPTLGPDATALGQIYWYTLEGRDPKTGRPTGGWNAEELRTIQDFYVKYSLSAAEGVSEVASAGGFVKEYQLELNPDAMYSFNVSVMDVMNAVKKSNLDIGAETMEVNKVEYLIRGLGYVKNVADIENTVVTVREGVPVRISDIAFVNIGPGTRRGGLDKEGVEAVGGVVIARYGSNPLEVIDNVKEKIHEMDAGLPQKTLADGTVSKVTVVPFYDRTGLIKETIGTLESSLSHEILICIIVIIVLVLNLRASVVIASMLPIAVLATFILMRYTGIEANIVALSGIAIAIGVMVDVGVVFVESIIRYMEMPENRGITKGKALAGLIYKAVSEVSGAIATAMITTIVSFLPVFAMQAQEGKMFSPLAYTKTYALASAFVLGLILLPTLAYFLFSVRIDSKMIRRGMNYVLIGMGVALCSIYGSIPALGLTAVGVNNLLAGRWKNSKIANYVNIAIALLVALFYLSEEWLPMGPARGLTVNVLFVAGCVAIILAMLWALVIFYERILRWCLANRWKFMMIPVATVVCGFFIWRGVGQEFMPSLNEGSFLLMPTSMPHAGIEQNLDYVEKLDKRLAAIPEVETAIGKWGRVNSALDPAPVQMFENTINYRPEYILDEDGRRARFRVDGDGAFVLKDGGTYNPADGFRLLPADSLVADPRGDYFRQWRPEIKNANDIWQQIVNVTHLPGLTSAPKLQPIEARLVMLSTGMRAPMGVKVYGPTLEDIEQGGKLIEQALKSSPSVIPSSVFYDRAVGAPYLEIKLNRESMARYGVAVGDLQEVLGAAVGGMALTRTVEGRERFPIRLRYARELRDSPEALSMLLVPTATGAQVPLKELADIEYSRGAQMIQSENTFLVGYVIFDKLSGRAEVDVVHEAGAMLDAKVKSGELVLPKGVSYKFAGNYEQQQRATDRLMIVVPLALLIVLLVLYFQFRTVTASLIHFSGVFVAFAGGFILLWLYGQPWFMNFSIVGENMRDLFQMHPINLSVAVWVGFIALFGVATDDGVLMGTYIHHVFLERDPRTRHDIREAVVEAGLKRVRPAAMTTATTLIALLPVLTSTGKGADIMVPMAIPTFGGMLIQSMTMFVVPVLQCWWREAVERRREKKWKGAYGE
>NZ_CP054003.1|WP_050418577.1|4746859_4747162_+|hypothetical-protein
MGRMADVEWGSASACTMCGQKKTSDCCKDEAHYIKLAVDQDVNHVVVTNLVPVVTELLPVLYAGFLSLEVEDTCQSFIAFDSPPKQTGVPLFVYHCTYLI
>NZ_CP054003.1|WP_005780989.1|4745663_4746641_-|lytic-transglycosylase-domain-containing-protein
MKHISINYIFTTALALGAGISIPVLVGSTCLSEQHSVQSEVPYCVTPPTVPEQAIFDGDTIDLRRYDRRERMDREMMSFTYMHSTTMLMLKRANRYFPIIEPLLKANGIPDDFKYLMVIESSLNPIARSPAGAAGLWQFMPATAREFGLEVNDNVDERYHIEKATAAACRYFKQAYAKYGDWMAVSAAYNAGQGRISSQLDKQLADHAMDLWLVEETSRYMFRLLAVKEVFGNPQRFGFLLKREHLYPVIPYKEVTVNTEISDLSDFAQKQGITYAQLRDANPWLRGSSLKNKTGKKYVIHIPTQEGMNYDPKKTVPYERKWVID
>NZ_CP054003.1|WP_032541809.1|4744726_4745626_-|ion-transporter
MKSNSWLYRFLHNQALKRKLYVIIFESDTPAGKAFDVALIICILLSILLAIIESLQGLPSWLSAPFIVLEYLFTAFFTFEYVTRIYCSPQPRKYIFSFFGIIDLLATLPLYLAFFLPGARYLLIIRAFRIIRVFRIFKLFNFWLEGERLLTSLKESSKKIAVFFLFVVILVVAIGTLMYMIEGTQPNTQFNNIPNSIYWAIVTMTTVGYGDITPATALGKFLSACVMLIGYTIIAVPTGIVSVSMMKEYKKLKDLQCPNCHKTGHEENATYCKYCGHKLKNEETPQQESQTNGPRRTTS
>NZ_CP054003.1|WP_032541810.1|4738863_4744737_+|DUF3320-domain-containing-protein
MSQENPSSKLDVEFIYLPVVNYSMQQNRIPVVRLFSIKNNTEHPLADLKVSLIFEPEFAAASPVMIERLSPGEMIKITTLNLLLDPSFFIRQTERFSGAIGLIVSCDEEVVFQSKYPIDILAFDQWGGIQVLPELLSAFVVPNHPILTGIISRTASILKEWSGSSSLDAYQSCNPNRVKIQLAALYEAVKEQHIAYCTPPASFGDAGQRIRLSDNVLSGKLGTCLDMSLLYASCAEAMGLHPLLVVIQGHALVGCWLIDGTFPDAVNDDPSLLTKRTADGINEIILLEATCMNDGKNVTFDAAVGLANGKMLAVNDFICFIDVARSRFAHILPLPQRIMHGKAWSVNPEMIQTPEDESHVSYSNAPEEIKQYDWGNQDCYVEVTKQLLWERKLLDLSLRNNFLNLRITRNALQVISADVDKMEDAFSDGTEFQILGKPSDWDNPLYDFGLYGALTESDPMLGLIKQELTQKRLRTYLNEQDLKKSLTYLYRSSRVALEENGANTLYLALGLLRWYETEHSERPRYAPILLLPVEMIRKSVSKGYIIRAREEESMLNITLLEMLRQNFGIIISGLESLPKDENGADVKRVFSIFRKAVMNEKRWDVEEQAILGTFSFSKFIMWNDIHSNAEELSKNKIVGSLMSGKMEWEVADVDASAIELDHTLTPADIALPVSADSSQLEAVYEAVSEKSFILHGPPGTGKSQTITNIIANALYQGKRVLFVAEKMAALSVVQKRLTNIGLAPFCLELHSNKARKTDVLRQLKESTEIFRYKEPEEFKEESERLFKMRQQINGYVEALHRVYPCGISVYEAVTRYSSIDEKEEIMIPAFLLTTLTKERLNEWNHAVEELVGVGKVSGHSYHHPLTGINIKEYSSQLKEETDKLLKEYITLLQVMEKKVEKCFSIYGIGNKYTEKLLESLVRFIRILMQLPGMTANLVLMTEPNENVEKIRRIIEHGRKRDAVYSLLKQSFEDAFFTFPAQQELAEWKEITQSWFLPRWLKQRKFCKEMSLFSLQGRIGKEQVLPVLQQLLSYQQEKQEVDSKSSWLQNLFGAKAHSGEEQWADIEAMSEGLLQLNRLLMGLAEDASSVRLVKEKLAEQLSEGYSSFRQMNKEQLEGVVQDWEREKQLEESMLQLLGVSKEVLHVSEDNWLAGALHQCEIWAKNTDKLKDWYRWLNVSRRFEACGLESVFTAYTERNLPTERMMNIYLKGFYRSFTEYAIGTEQVLQFFSGELFNDSILRFRELNEQYQELIKKELYAKLASNIPSFVYAAAQSSEVGILQKCIRSNGRGVPIRKLFDSIPNLLPRMCPCMLMSPMSVAQYIDVNHDKFDLVVFDEASQMPTCEAVGAIARGNHVVVVGDPKQMPPTSFFTSNSVDEEHIEMEDLESILDDCLALSMPSKYLLWHYRSKHESLIAFSNSQYYDNKLLTFPSPDDLAAKVTLVSVEGYYDKGKSRQNQAEAQAVVDEIVRRLSDPELSRQSIGVVTFSSVQQTLIEDMLSDVVMQNADLENLAFNREEPVFIKNLENVQGDERDVILFSVGYGPDINGRVSLNFGPLNRDGGERRLNVAVSRARYEMKVFSTLKADQIDLKKTSSVGVAGLKYFLEYAGKGTGVLNHSNAMASESIDIGTLVASKLRERGYQVKTKIGCSGFRVDVGVVDPDNSSRYLLGILCDGENYRAAKTARDREIVQSSVLKMLGWNICKVWTMDWWENSQKVIDRIEGELEKARCSKSEIPASVSLPVPVLNQGQKAGLLCSAQPCLVNVPEQVIREGVKSVESEIYETASLVSVNLSSWDFMMPRREPRIRKQLDEIMHTEAPISRSLLINRIFSAYGILRKTARLIAWMDDILSRTPYYKQEVDGLTFYWNTKEEAEAYTKFRIDSKREVADLPPREVANAALSILEQQIALPLTDLMKITAQLLGYARFGLNVETAMRRGVQMLLDREEAKIEGDKILMK
>NZ_CP054003.1|WP_005780992.1|4738373_4738745_+|DUF2809-domain-containing-protein
MNKRLFYLIGFAIILAVEIIIGMYVHDRFVRPYMGDALVVVLTYCFIRIFIPKGLSQLPFYVFAFACFIEVLQYFQLVDVLGITNPVTRIILGSTFDLKDIVSYAGGYVFVLLVERFWGKKGK
>NZ_CP054003.1|WP_005780977.1|4756927_4757803_-|fimbrillin-family-protein
MKKLMFAVIACAMALSGCSSEDDCTTVNPQPEENATEIKLNAGILGVATRAPVSTNDNITASFVASTTDGDYTTNAWNSTVTFVASPTPTSALSFSPARYYPVNSSTIYIKGYYPAGTLTGKSVTLAADGTEDVMITAQASGTKATATPLSFIFNHLLTQLQFKFVSGTGYPASGVNVTSLVIKQQKAPATLDLNTAAMTYTTKDLTLSGTFPITTAGATVSNYPMVKSGEALSVAVTTSDGVTYPETAISITTEAGKSHLITLTFTPKEITAAISVTAWQVGGQGSSSLQ
>NZ_CP054003.1|WP_005780975.1|4757999_4758884_-|hypothetical-protein
MTYTHFGKQADVLKHLLLCELLRIEKPRVYVETNAACAQYALEKTPEQEYGIYHFLKKAGTAGKECIPERAEYHHPKGALHRSAYYQQESEAMQANRYIGSPGLAMNILGDTARYIFFDIESEPLENVSQYAATKGLKECINLFNRDSIEGTLELLSSLPASSFFHIDPYEIDKPGRNGRTYLDVFTEAAKAGMRCFLWYGYMTLEDKRHLEELIAQSLPEANIRNATGVELTLKMIKEDIAESNPGVLGSGVLGANLFEESNAVIQKYAAWLEEIYKDAKYKNLDGSVYLTQR
>NZ_CP054003.1|WP_005780973.1|4759012_4759699_+|HAD-family-hydrolase
MQEIKVIAFDADDTLWDNQVFYDEVESEFCRLLSEYGTAEEISSRLFDIEMENMDIYKYGAKPFTLSMVEAAVTISRNRVPAEVIGRIVEMGKELLEMPIRLLGGVTEALETLKDDYKLVVATKGDLLDQERKLQRSGIAHYFDHTEIMTDKAPEDYQRLISSLDVAPQSFLMVGNSLKSDVLPVLSLGGQAIHVPAEAMWKHEEIHPSGKEYLMIRSLAELPEVLRG
>NZ_CP054003.1|WP_005780971.1|4759708_4760035_-|multidrug-efflux-SMR-transporter
MNWIILTIAGCFEVLFTFCMGKVKETTGTEMYLWFTGFLIATFISMLLLVKATQNLPIGTAYAVWTGIGAVGTVLVGILVFREPASFWRLFFIVMLISSIIGLKMVSH
>NZ_CP054003.1|WP_005780969.1|4760261_4761011_-|subclass-B1-metallo-beta-lactamase-CfiA14
MKTVFILISMLFPVAVMAQKSVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSKP
>NZ_CP054003.1|WP_032536584.1|4761183_4762164_+|IS982-like-element-IS1187-family-transposase
MSKKLYMSLIFSNLVVIKTLSSNHRMYNLYAKFVKILEICKQFSENLVNDSGNVPRRGPVPKFSDLEVVALSLTAETESIDSEKWLFDYKLQEYKDSIPNLISRRQFNDRRKKTSGLCEELRKRIAMEMDGGEEQFFVDSKPIEVCRVARGKRCKMGRAGNFSQAPDFGFCASQNTYYFGYKLHALCGLSGVIHSYDLSKASVADLHYMKDVKHTYHDCSIYGDKGYIGADVQLDLFETAHIRLECPYRLNQKDWKPTFIPFAKARKRIETIFSQLTDQFLVIRNYAKITNGLFARIIGKISALTILQYVNFINDKPIGRIKYALN
>NZ_CP054003.1|WP_005780917.1|4762199_4762832_-|CatB-related-O-acetyltransferase
MNAKTYPRTNDSQTIYLNTVIRNPNITVGDYTIYNDFVNDPTLFEKNNVLYHYPINGDRLIIGKFCSIACGAKFLFNSANHSLKSLSGYTFPLFFEEWDLDKKDVASAWDNKGDIVIGNDVWIGYEAVIMAGVHIGDGAIIASRAVVTKDVPPYTIVGGTPAKEIRPRFDRETILRLQNLRWWDWEVEKIRQALPAIMKGDIEGLAAVAG
>NZ_CP054003.1|WP_032541803.1|4762828_4763275_-|GNAT-family-N-acetyltransferase
MEIKKLTQSEKRMAMDLAWEVFIEFEGPDYPQEGTDHFRSFIDNTEMVGEMEVYGAFDGNILAGMIALRSSGSHISLFFVRKTYQQRGIGKRLFETAIRNGHAETITVNSSPYAVGIYHKLGFTAVAGEKTENGIRFTPMEYKSELKS
>NZ_CP054003.1|WP_005780965.1|4764093_4764369_-|hypothetical-protein
MSFSGFVFDMIRRNKENRDLLTLRRERMKDLQGKMYRKGTLQNPNITVEELEKIEKATREKEKAETQYYLRSTLIFLAVLAVLALLLWWIF
>NZ_CP054003.1|WP_032536584.1|4764420_4765401_+|IS982-like-element-IS1187-family-transposase
MSKKLYMSLIFSNLVVIKTLSSNHRMYNLYAKFVKILEICKQFSENLVNDSGNVPRRGPVPKFSDLEVVALSLTAETESIDSEKWLFDYKLQEYKDSIPNLISRRQFNDRRKKTSGLCEELRKRIAMEMDGGEEQFFVDSKPIEVCRVARGKRCKMGRAGNFSQAPDFGFCASQNTYYFGYKLHALCGLSGVIHSYDLSKASVADLHYMKDVKHTYHDCSIYGDKGYIGADVQLDLFETAHIRLECPYRLNQKDWKPTFIPFAKARKRIETIFSQLTDQFLVIRNYAKITNGLFARIIGKISALTILQYVNFINDKPIGRIKYALN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MN694663	Marine virus AFVG_250M439, complete genome	59307-59336	6	0.8
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250021	Prevotella phage Lak-B2, complete genome	324017-324046	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250024	Prevotella phage Lak-B5, complete genome	318039-318068	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250028	Prevotella phage Lak-B9, complete genome	322929-322958	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250023	Prevotella phage Lak-B4, complete genome	325643-325672	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250025	Prevotella phage Lak-B6, complete genome	321231-321260	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250022	Prevotella phage Lak-B3, complete genome	321246-321275	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250027	Prevotella phage Lak-B8, complete genome	324335-324364	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250026	Prevotella phage Lak-B7, complete genome	323393-323422	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	MK250020	Prevotella phage Lak-B1, complete genome	322912-322941	8	0.733
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	NZ_CP038614	Arsenophonus nasoniae strain FIN plasmid pArsFIN2, complete sequence	144859-144888	9	0.7
NZ_CP054003_2	2.1\|3335899\|30\|NZ_CP054003\|CRISPRCasFinder	3335899-3335928	30	NZ_CP038614	Arsenophonus nasoniae strain FIN plasmid pArsFIN2, complete sequence	147758-147787	9	0.7

1. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MN694663 (Marine virus AFVG_250M439, complete genome) position: , mismatch: 6, identity: 0.8

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tcattttttttcatttttttcttgacaaat	Protospacer
*** . . ****.*****************

2. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250021 (Prevotella phage Lak-B2, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

3. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250024 (Prevotella phage Lak-B5, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

4. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250028 (Prevotella phage Lak-B9, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

5. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

6. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250025 (Prevotella phage Lak-B6, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

7. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250022 (Prevotella phage Lak-B3, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

8. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

9. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

10. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to MK250020 (Prevotella phage Lak-B1, complete genome) position: , mismatch: 8, identity: 0.733

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
tggttcaatttcatttttttcttcacaaat	Protospacer
* . .  *****.********** ******

11. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to NZ_CP038614 (Arsenophonus nasoniae strain FIN plasmid pArsFIN2, complete sequence) position: , mismatch: 9, identity: 0.7

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
aattgatatttcttttttttcttgaaaaat	Protospacer
     ..***** ************ ****

12. spacer 2.1|3335899|30|NZ_CP054003|CRISPRCasFinder matches to NZ_CP038614 (Arsenophonus nasoniae strain FIN plasmid pArsFIN2, complete sequence) position: , mismatch: 9, identity: 0.7

tcagcgcatttcgtttttttcttgacaaat	CRISPR spacer
aattgatatttcttttttttcttgaaaaat	Protospacer
     ..***** ************ ****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

784517 : 847285

unidentified_phage(11.11%)

protease,integrase,plate,transposase

attL 804610:804625|attR 831172:831187

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005777415.1\|784517_785648_+\|integrase	site-specific integrase	H7BUI8	unidentified_phage	5.3e-16	28.1
WP_004310192.1\|785781_786555_+	hypothetical protein	NA	NA	NA	NA
WP_004322056.1\|786731_787130_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005777412.1\|787107_788214_+	AAA family ATPase	NA	NA	NA	NA
WP_004310189.1\|788320_789208_+	toprim domain-containing protein	NA	NA	NA	NA
WP_005777409.1\|789444_789897_+	hypothetical protein	NA	NA	NA	NA
WP_004310187.1\|789898_790222_+	DUF4134 domain-containing protein	NA	NA	NA	NA
WP_007481835.1\|790282_790573_+	DUF4134 family protein	NA	NA	NA	NA
WP_004289323.1\|791114_792926_+	maturase	A0A0U4J920	Pseudomonas_phage	2.5e-31	31.1
WP_007481836.1\|792950_793145_+	DUF4134 family protein	NA	NA	NA	NA
WP_004310185.1\|793156_793450_+	hypothetical protein	NA	NA	NA	NA
WP_005777401.1\|793560_796272_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_005777399.1\|796271_796910_+	hypothetical protein	NA	NA	NA	NA
WP_005777397.1\|796914_799446_+	hypothetical protein	NA	NA	NA	NA
WP_004322064.1\|799442_800168_+	hypothetical protein	NA	NA	NA	NA
WP_004310179.1\|800372_801143_+	site-specific DNA-methyltransferase	A0A2C9CYT3	Yersinia_phage	1.2e-56	45.6
WP_005777394.1\|801211_801982_+	DUF5045 domain-containing protein	NA	NA	NA	NA
WP_005777392.1\|801996_802698_+	hypothetical protein	NA	NA	NA	NA
WP_005777390.1\|803041_804340_+	ATP-binding protein	NA	NA	NA	NA
WP_032541540.1\|804344_804947_+	RloB domain-containing protein	NA	NA	NA	NA
804610:804625	attL	NA	NA	NA	NA
WP_005777385.1\|806831_810815_-	Eco57I restriction-modification methylase domain-containing protein	NA	NA	NA	NA
WP_005777383.1\|810821_811838_-	hypothetical protein	NA	NA	NA	NA
WP_005777381.1\|812089_813301_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_005777379.1\|813306_814095_-	hypothetical protein	NA	NA	NA	NA
WP_032541434.1\|814091_815144_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_005777375.1\|815140_815491_-	hypothetical protein	NA	NA	NA	NA
WP_005777373.1\|815667_816387_-	hypothetical protein	NA	NA	NA	NA
WP_005777371.1\|816421_816733_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_032541432.1\|816906_818097_-	hypothetical protein	NA	NA	NA	NA
WP_005777367.1\|818107_819478_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_004310176.1\|820157_820547_+	hypothetical protein	NA	NA	NA	NA
WP_004310175.1\|820553_821168_+	conjugative transposon protein TraK	NA	NA	NA	NA
WP_004310174.1\|821180_821552_+	hypothetical protein	NA	NA	NA	NA
WP_004310173.1\|821566_822049_+	N-6-adenine-methyltransferase	B5TR99	Bacteroides_phage	4.5e-57	61.0
WP_004310172.1\|822059_823205_+	conjugative transposon protein TraM	NA	NA	NA	NA
WP_004322067.1\|823217_823553_+	hypothetical protein	NA	NA	NA	NA
WP_004322068.1\|823602_824202_+	hypothetical protein	A0A0K0KVF7	Prochlorococcus_phage	4.3e-49	56.1
WP_004310170.1\|824214_825060_+	conjugative transposon protein TraN	NA	NA	NA	NA
WP_004310169.1\|825056_825569_+	hypothetical protein	NA	NA	NA	NA
WP_004310168.1\|825590_826247_+	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_004310167.1\|826260_826998_+	hypothetical protein	NA	NA	NA	NA
WP_004310166.1\|827001_829188_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_004310164.1\|829697_829970_-	hypothetical protein	NA	NA	NA	NA
WP_004322070.1\|829977_830253_-	hypothetical protein	NA	NA	NA	NA
WP_008659497.1\|830761_832501_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	3.3e-17	33.5
831172:831187	attR	NA	NA	NA	NA
WP_005777345.1\|832549_832786_+	hypothetical protein	NA	NA	NA	NA
WP_005777343.1\|833070_834390_+	ATP-binding protein	NA	NA	NA	NA
WP_004310159.1\|834460_834715_-	hypothetical protein	NA	NA	NA	NA
WP_005777339.1\|834721_835477_-	ParA family protein	Q8JL10	Natrialba_phage	7.6e-19	30.2
WP_005777338.1\|835712_836126_-	single-stranded DNA-binding protein	A0A139ZPL3	Marinitoga_camini_virus	3.7e-07	30.4
WP_005777334.1\|836802_837543_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005777331.1\|837987_838446_-	hypothetical protein	NA	NA	NA	NA
WP_005777329.1\|838458_839178_-	hypothetical protein	NA	NA	NA	NA
WP_004310152.1\|839581_840961_-	type VI secretion system contractile sheath protein TssC	NA	NA	NA	NA
WP_004310151.1\|840973_841441_-	hypothetical protein	NA	NA	NA	NA
WP_032536584.1\|841638_842619_+\|transposase	IS982-like element IS1187 family transposase	NA	NA	NA	NA
WP_004310150.1\|842644_843067_+	GPW/gp25 family protein	NA	NA	NA	NA
WP_005777323.1\|843074_844850_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_005777322.1\|844846_847285_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	1.1e-69	27.5

DBSCAN-SWA_2

2874224 : 2887907

Riemerella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005778768.1\|2874224_2878349_+	hypothetical protein	H7BUR2	unidentified_phage	3.4e-12	23.3
WP_005778769.1\|2878375_2878885_+	hypothetical protein	F5A3A1	Riemerella_phage	9.1e-08	29.6
WP_139018701.1\|2878859_2880095_+	LamG domain-containing protein	F5A3A0	Riemerella_phage	2.4e-22	35.9
WP_005778772.1\|2880079_2884477_+	hypothetical protein	F5A399	Riemerella_phage	2.0e-127	39.7
WP_005778773.1\|2884480_2884873_+	hypothetical protein	NA	NA	NA	NA
WP_005778775.1\|2884955_2885228_+	hypothetical protein	NA	NA	NA	NA
WP_171810372.1\|2885379_2886537_+	hypothetical protein	A0A2P9HXN3	Yersinia_phage	4.9e-17	27.9
WP_005778778.1\|2886896_2887907_+	reverse transcriptase	H7BW04	unidentified_phage	9.1e-92	52.7

DBSCAN-SWA_3

4764420 : 4841877

Liberibacter_phage(25.0%)

protease,integrase,transposase

attL 4813122:4813143|attR 4814768:4814789

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032536584.1\|4764420_4765401_+\|transposase	IS982-like element IS1187 family transposase	NA	NA	NA	NA
WP_005782781.1\|4765660_4765918_-	hypothetical protein	NA	NA	NA	NA
WP_032541919.1\|4766069_4767065_+	hypothetical protein	NA	NA	NA	NA
WP_005782778.1\|4767094_4768051_-	homocysteine S-methyltransferase family protein	NA	NA	NA	NA
WP_005782777.1\|4768179_4769208_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_005782776.1\|4769378_4770659_+	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	NA	NA	NA	NA
WP_032541918.1\|4770854_4771967_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_005821496.1\|4772522_4773335_+	DUF4469 domain-containing protein	NA	NA	NA	NA
WP_005782772.1\|4773505_4775716_+	PAS domain-containing hybrid sensor histidine kinase/response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	3.2e-33	31.0
WP_005782771.1\|4775975_4776176_+	hypothetical protein	NA	NA	NA	NA
WP_005782770.1\|4776211_4777585_-	TolC family protein	NA	NA	NA	NA
WP_005782769.1\|4777894_4781104_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.7e-49	22.4
WP_005782767.1\|4781181_4782300_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_005782765.1\|4782450_4783302_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_005782762.1\|4783677_4783911_-	hypothetical protein	NA	NA	NA	NA
WP_005782761.1\|4784326_4785820_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.7e-57	33.3
WP_171810387.1\|4785954_4786854_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_171810386.1\|4787042_4788674_+	PAS domain-containing protein	A0A1V0SGX0	Hokovirus	3.0e-28	36.3
WP_005821486.1\|4788785_4790399_-	serine hydrolase	NA	NA	NA	NA
WP_005782753.1\|4790792_4791464_+	isochorismatase family protein	NA	NA	NA	NA
WP_005782752.1\|4791647_4792562_-	hypothetical protein	NA	NA	NA	NA
WP_005782748.1\|4792775_4793660_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005782746.1\|4793799_4795335_-	acyl-CoA carboxylase subunit beta	NA	NA	NA	NA
WP_005782744.1\|4795352_4795853_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_032541926.1\|4795859_4797374_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_005782741.1\|4797909_4800168_+	cation:proton antiporter	NA	NA	NA	NA
WP_005782739.1\|4800920_4802132_+	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_005782737.1\|4802155_4803322_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.9e-29	29.1
WP_005782735.1\|4803420_4804398_-	hypothetical protein	NA	NA	NA	NA
WP_005782733.1\|4804514_4805117_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005782731.1\|4805257_4806037_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_005782727.1\|4807202_4807523_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005782726.1\|4807640_4809014_+	ATP-binding protein	NA	NA	NA	NA
WP_005782724.1\|4809050_4810544_+	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	9.5e-114	43.1
WP_005782722.1\|4810549_4812088_+	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	9.5e-117	46.2
4813122:4813143	attL	NA	NA	NA	NA
WP_005782719.1\|4813260_4814244_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	2.9e-34	30.2
WP_139018719.1\|4814245_4815421_+	restriction endonuclease subunit S	NA	NA	NA	NA
4814768:4814789	attR	NA	NA	NA	NA
WP_005782715.1\|4815453_4818384_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	2.2e-175	36.8
WP_005782712.1\|4818407_4820228_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_005782710.1\|4820281_4823908_+	hypothetical protein	NA	NA	NA	NA
WP_005782708.1\|4824028_4824556_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_005782706.1\|4824560_4825772_-	hypothetical protein	NA	NA	NA	NA
WP_032541915.1\|4825768_4826188_-\|protease	metalloprotease	NA	NA	NA	NA
WP_139018718.1\|4826171_4826405_-	hypothetical protein	NA	NA	NA	NA
WP_005782697.1\|4826502_4827573_-	AAA family ATPase	NA	NA	NA	NA
WP_005782695.1\|4827575_4827950_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005782694.1\|4828049_4828823_-	hypothetical protein	NA	NA	NA	NA
WP_171810385.1\|4830030_4830189_+	hypothetical protein	NA	NA	NA	NA
WP_005782689.1\|4830478_4831708_+	ATP-binding protein	NA	NA	NA	NA
WP_005782686.1\|4832525_4833107_+	metallophosphoesterase	A0A292GAJ3	Xanthomonas_phage	2.2e-26	38.3
WP_005782684.1\|4833112_4833880_+	metallophosphoesterase	A0A1X6WFZ0	Pacmanvirus	3.2e-20	29.9
WP_005782682.1\|4834244_4835519_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_005782680.1\|4835526_4835904_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_032541913.1\|4836248_4836782_-	hypothetical protein	NA	NA	NA	NA
WP_005782676.1\|4837255_4837819_+	hypothetical protein	NA	NA	NA	NA
WP_005782673.1\|4837839_4838148_+	hypothetical protein	NA	NA	NA	NA
WP_139018720.1\|4838151_4838400_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_005782671.1\|4838584_4839874_+	ATP-binding protein	NA	NA	NA	NA
WP_172885980.1\|4840572_4840842_+	hypothetical protein	NA	NA	NA	NA
WP_005782665.1\|4841028_4841877_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	E9P639	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.5e-26	30.1

Anti-CRISPR protein detection

Acr_ID: NZ_CP054003.1|WP_004291533.1|4303243_4303660_-|PcfK-like-family-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP054003.1|WP_004291533.1|4303243_4303660_-|PcfK-like-family-protein

4303243_4303660_-

138 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|40	0.5571428571428572	0.9855072463768116	0.9929078014184397

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054003

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information