CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP054046	Yersinia massiliensis strain 2011N-4075 plasmid unnamed1, complete sequence	0 crisprs	csa3	1
NZ_CP054047	Yersinia massiliensis strain 2011N-4075 plasmid unnamed2, complete sequence	0 crisprs	NA	1
NZ_CP054048	Yersinia massiliensis strain 2011N-4075 chromosome, complete genome	1 crisprs	DEDDh,cas3,WYL,csa3,DinG,cas4	6

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7705 : 76645

Escherichia_phage(37.5%)

transposase,integrase

attL 59915:59931|attR 72048:72064

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019213468.1\|7705_8401_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	9.1e-43	43.6
WP_042807144.1\|8892_9531_-	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_019212798.1\|9819_10560_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_050875729.1\|10617_12996_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_019213442.1\|13156_13798_-	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_019213441.1\|14282_14921_-	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_019213439.1\|15663_16089_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	4.3e-51	72.1
WP_019213438.1\|16101_17391_-	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	5.1e-172	73.7
WP_019213437.1\|17439_19191_-	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_011817072.1\|19208_19571_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_019213436.1\|19617_19971_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	3.7e-24	47.8
WP_019213468.1\|20332_21028_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	9.1e-43	43.6
WP_172986711.1\|21064_21394_-	hypothetical protein	A0A1B2LRT6	Wolbachia_phage	7.7e-08	37.8
WP_172986712.1\|21414_22032_-	hypothetical protein	NA	NA	NA	NA
WP_172986713.1\|22058_22799_-	molybdopterin-guanine dinucleotide biosynthesis protein MobC	NA	NA	NA	NA
WP_172986714.1\|22806_24591_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_172986715.1\|25263_25554_-	hypothetical protein	NA	NA	NA	NA
WP_172986716.1\|25572_25986_-	H-NS histone family protein	NA	NA	NA	NA
WP_172986743.1\|26014_26218_-	hemolysin expression modulator Hha	NA	NA	NA	NA
WP_172986717.1\|26225_26522_-	hypothetical protein	NA	NA	NA	NA
WP_172986718.1\|26591_27617_-	YadA-like family protein	NA	NA	NA	NA
WP_172986719.1\|27714_28020_-	conjugal transfer protein	NA	NA	NA	NA
WP_172986720.1\|28433_28859_-	hypothetical protein	NA	NA	NA	NA
WP_172986721.1\|28845_29871_-	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
WP_172986744.1\|29942_31115_-	TriI protein	NA	NA	NA	NA
WP_172986745.1\|31138_32014_-	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
WP_172986722.1\|32142_32826_-	type IV secretion system protein	NA	NA	NA	NA
WP_172986723.1\|32800_32947_-	hypothetical protein	NA	NA	NA	NA
WP_172986724.1\|32995_34015_-	type IV secretion system protein	NA	NA	NA	NA
WP_172986725.1\|34026_34266_-	EexN family lipoprotein	NA	NA	NA	NA
WP_050116472.1\|34314_34569_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_050116471.1\|34565_34817_-	YoeB-YefM toxin-antitoxin system antitoxin YefM	NA	NA	NA	NA
WP_172986726.1\|34883_35597_-	type IV secretion system protein	NA	NA	NA	NA
WP_172986727.1\|35671_38419_-	VirB3 family type IV secretion system protein	NA	NA	NA	NA
WP_172986728.1\|38437_38728_-	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_172986729.1\|38731_39343_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_172986730.1\|39774_40002_-	hypothetical protein	NA	NA	NA	NA
WP_172986731.1\|40287_40596_-	hypothetical protein	NA	NA	NA	NA
WP_172986732.1\|40723_41710_-	replication initiation protein	A0A222YYK1	Escherichia_phage	3.4e-19	27.0
WP_172986733.1\|42780_42996_-	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_172986734.1\|43016_43643_-	AAA family ATPase	A2I303	Vibrio_virus	6.3e-51	55.3
WP_172986735.1\|43694_43931_-	hypothetical protein	NA	NA	NA	NA
WP_172986736.1\|44246_45227_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	7.8e-56	42.5
WP_172986737.1\|45254_45503_-	hypothetical protein	NA	NA	NA	NA
WP_172986738.1\|45985_48148_-	DNA topoisomerase 3	NA	NA	NA	NA
WP_172986739.1\|48194_48413_-	hypothetical protein	NA	NA	NA	NA
WP_019213468.1\|48475_49171_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	9.1e-43	43.6
WP_172986746.1\|50273_54506_-	inverse autotransporter beta domain-containing protein	NA	NA	NA	NA
WP_019213434.1\|54690_55386_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.7e-42	44.0
WP_145579294.1\|56155_58756_+	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	1.8e-99	56.4
WP_019213431.1\|58870_59488_+	response regulator transcription factor	NA	NA	NA	NA
WP_042807111.1\|59752_60103_-	hypothetical protein	NA	NA	NA	NA
59915:59931	attL	NA	NA	NA	NA
WP_019213429.1\|60177_60873_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.5e-42	43.9
WP_019213427.1\|61781_62420_+	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_019213426.1\|62903_63539_+	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_019213425.1\|63737_64187_+	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PK80	Moraxella_phage	3.9e-10	26.8
WP_019213424.1\|64405_65101_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.1e-43	43.6
WP_081578887.1\|65177_65894_-\|integrase	tyrosine-type recombinase/integrase	I3WFA4	Macacine_betaherpesvirus	3.1e-22	54.8
WP_019213422.1\|66372_66690_-	CcdB family protein	NA	NA	NA	NA
WP_019213421.1\|66689_66935_-	type II toxin-antitoxin system CcdA family antitoxin	NA	NA	NA	NA
WP_019213420.1\|67415_68111_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	9.1e-43	43.6
WP_019213419.1\|68314_68776_+	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	4.5e-30	48.6
WP_042807110.1\|68775_69351_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	4.0e-52	59.0
WP_172986740.1\|69661_70630_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.4e-09	29.1
WP_019213416.1\|70667_71000_-	hypothetical protein	NA	NA	NA	NA
WP_019213415.1\|70996_71704_-	ParA family protein	A0A0A8IL09	Aurantimonas_phage	5.3e-38	41.5
WP_019213414.1\|72131_73388_-	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	1.9e-139	56.6
72048:72064	attR	NA	NA	NA	NA
WP_019213413.1\|73395_73815_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	7.4e-32	51.9
WP_019213411.1\|74384_74621_+	hypothetical protein	NA	NA	NA	NA
WP_019213410.1\|74680_76645_+	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	6.6e-30	31.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP054047

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20331 : 28569

Klebsiella_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172986766.1\|20331_20895_-	helix-turn-helix transcriptional regulator	A0A248SLB9	Klebsiella_phage	4.2e-06	42.0
WP_172986767.1\|20994_21399_-	plasmid partitioning/stability family protein	NA	NA	NA	NA
WP_172986768.1\|21405_22383_-	StbA family protein	A0A222YXF2	Escherichia_phage	5.0e-71	44.7
WP_172986769.1\|22639_23140_-	hypothetical protein	NA	NA	NA	NA
WP_049615233.1\|23567_23897_-	HigA family addiction module antidote protein	B0VK57	Azospirillum_phage	8.5e-07	36.4
WP_172986770.1\|23908_24199_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_172986771.1\|24336_25158_-	N-6 DNA methylase	A0A2K9V411	Faecalibacterium_phage	1.9e-23	32.9
WP_172986772.1\|25534_25960_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	4.9e-31	51.6
WP_120806773.1\|25959_27216_+	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	1.3e-132	55.1
WP_145544398.1\|27674_27902_-	hypothetical protein	NA	NA	NA	NA
WP_172986821.1\|27951_28569_-	dna-binding plasmid partition protein	A0A219Y918	Aeromonas_phage	7.9e-22	36.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP054048

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054048_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054048_1

4143976-4144059

Orphan

Consensus_repeat	Method
CGTGGGAGGGATATCCAATGACACTAT	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP054048_1

>merge|NZ_CP054048|1|4143976-4144059|CRISPRCasFinder
CGTGGGAGGGATATCCAATGACACTATAATTAATGATAGTGGGGCTCAGAATGTCATCGTGGGAGGGATATCCAATGGCACTAT

>NZ_CP054048|1|1|4143976-4144059|CRISPRCasFinder
CGTGGGAGGGATATCCAATGACACTAT	AATTAATGATAGTGGGGCTCAGAATGTCAT
CGTGGGAGGGATATCCAATGGCACTAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054048.1\|WP_108087673.1\|4139385_4140270_+\|copper-homeostasis-membrane-protein-CopD	unknown	unknown	gnl\|CDD\|224195
NZ_CP054048.1\|WP_050080596.1\|4146616_4146883_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054048.1\|WP_050080601.1\|4151150_4151540_+\|ASCH-domain-containing-protein	unknown	unknown	gnl\|CDD\|226838
NZ_CP054048.1\|WP_108087671.1\|4135287_4135947_-\|exodeoxyribonuclease-X	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|181186
NZ_CP054048.1\|WP_155489872.1\|4147310_4147448_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054048.1\|WP_019210237.1\|4138094_4138604_+\|non-heme-ferritin	unknown	unknown	gnl\|CDD\|224445
NZ_CP054048.1\|WP_108087674.1\|4140367_4140709_+\|YebY-family-protein	unknown	unknown	gnl\|CDD\|371203
NZ_CP054048.1\|WP_049607057.1\|4148534_4148729_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054048.1\|WP_019210224.1\|4148928_4149177_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054048.1\|WP_155410999.1\|4136030_4136183_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054048.1\|WP_050080599.1\|4149261_4149897_+\|glutathione-transferase	unknown	unknown	gnl\|CDD\|185068
NZ_CP054048.1\|WP_050080589.1\|4138997_4139384_+\|CopC-domain-containing-protein-YobA	unknown	unknown	gnl\|CDD\|225247
NZ_CP054048.1\|WP_108088266.1\|4141323_4141725_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP054048.1\|WP_108087672.1\|4137467_4137701_-\|DNA-polymerase-III-subunit-theta	unknown	unknown	gnl\|CDD\|182872
NZ_CP054048.1\|WP_005272441.1\|4150165_4150399_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054048.1\|WP_049607063.1\|4151653_4151896_-\|DUF1480-family-protein	unknown	unknown	gnl\|CDD\|369328
NZ_CP054048.1\|WP_050080592.1\|4142552_4142873_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054048.1\|WP_050285736.1\|4136465_4137422_+\|prolyl-aminopeptidase	unknown	unknown	gnl\|CDD\|130316
NZ_CP054048.1\|WP_088130070.1\|4150866_4150998_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054048.1\|WP_108087676.1\|4147751_4148381_+\|CatB-related-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100040

Protein	Function_ID	Function_description	E-value
NZ_CP054048.1\|WP_108087673.1\|4139385_4140270_+\|copper-homeostasis-membrane-protein-CopD	gnl\|CDD\|224195	COG1276, PcoD, Putative copper export protein [Inorganic ion transport and metabolism].	7.02248e-70
NZ_CP054048.1\|WP_108087671.1\|4135287_4135947_-\|exodeoxyribonuclease-X	gnl\|CDD\|181186	PRK07983, PRK07983, exodeoxyribonuclease X; Provisional.	9.19178e-153
NZ_CP054048.1\|WP_019210237.1\|4138094_4138604_+\|non-heme-ferritin	gnl\|CDD\|224445	COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism].	3.02014e-85
NZ_CP054048.1\|WP_050080599.1\|4149261_4149897_+\|glutathione-transferase	gnl\|CDD\|185068	PRK15113, PRK15113, glutathione transferase.	2.22533e-127
NZ_CP054048.1\|WP_108087674.1\|4140367_4140709_+\|YebY-family-protein	gnl\|CDD\|371203	pfam10709, DUF2511, Protein of unknown function (DUF2511). This family is conserved in bacteria. The function is not known.	7.52324e-52
NZ_CP054048.1\|WP_050080589.1\|4138997_4139384_+\|CopC-domain-containing-protein-YobA	gnl\|CDD\|225247	COG2372, CopC, Uncharacterized protein, homolog of Cu resistance protein CopC [General function prediction only].	1.05652e-47
NZ_CP054048.1\|WP_108088266.1\|4141323_4141725_-\|VOC-family-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	2.66345e-39
NZ_CP054048.1\|WP_108087672.1\|4137467_4137701_-\|DNA-polymerase-III-subunit-theta	gnl\|CDD\|182872	PRK10969, PRK10969, DNA polymerase III subunit theta; Reviewed.	5.73977e-41
NZ_CP054048.1\|WP_050080601.1\|4151150_4151540_+\|ASCH-domain-containing-protein	gnl\|CDD\|226838	COG4405, COG4405, Uncharacterized protein conserved in bacteria [Function unknown].	3.66024e-52
NZ_CP054048.1\|WP_049607063.1\|4151653_4151896_-\|DUF1480-family-protein	gnl\|CDD\|369328	pfam07351, DUF1480, Protein of unknown function (DUF1480). This family consists of several hypothetical Enterobacterial proteins of around 80 residues in length. The function of this family is unknown.	2.78948e-42
NZ_CP054048.1\|WP_050285736.1\|4136465_4137422_+\|prolyl-aminopeptidase	gnl\|CDD\|130316	TIGR01249, Putative_proline_iminopeptidase, proline iminopeptidase, Neisseria-type subfamily. This model represents one of two related families of proline iminopeptidase in the alpha/beta fold hydrolase family. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.	5.83378e-144
NZ_CP054048.1\|WP_108087676.1\|4147751_4148381_+\|CatB-related-O-acetyltransferase	gnl\|CDD\|100040	cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.	3.95315e-55

>NZ_CP054048.1|WP_050080592.1|4142552_4142873_-|hypothetical-protein
MKISIIAATVIFSVTLSGCAVKNDKTQFQGLGLTYQSDIKKLDNGNYFTEVEAAPAAGRIHGATGTASKKASDFCRVQNKTMKEVKTDIDTHLLVNGVARLTFQCV
>NZ_CP054048.1|WP_108088266.1|4141323_4141725_-|VOC-family-protein
MRTQKRCLGYVAVVVDDYDCAIEYYTDKLGFTLVEDTPQPEKRWVVVTPNPESDCNILLARASNERQENFIGNQCGGRVFLFLQTDDFWRDYNSMKTKGVNFCEEPREEDYGTVVVFEDLYGNRWDLYQNMQN
>NZ_CP054048.1|WP_108087674.1|4140367_4140709_+|YebY-family-protein
MKGSVLALTLLMLSVNAFAAGKIITVSKFEFGKQWAFTREEVMLECRAGDALFVINPSTLTQYPLNDIATEQMKAGHVLAKPLDVLLLDDSANPSQKMSLEPFVQRAMTLCQK
>NZ_CP054048.1|WP_108087673.1|4139385_4140270_+|copper-homeostasis-membrane-protein-CopD
MSLAALFILCRFLHFMAVMLMFGISLFTAVLASGSFSSILTKRLSPLLIISTTLAFISAVGLLAIQAGMMGDGWADTYRLSVWWSVLGTRFGQVWQWHLALSVLSMGIIFLGPTRTAFRMMAGCSALLLASLAFTGHAAMHDGLLGWIHQTNQVIHLISAGYWVGCLPPLLICLAYTRNQMVKREATSVLIRFSSWGHLSVALVLATGVINSLIMLRDTQLELTSSYQILLFSKVVLVMLMIFIALINRYRIVPMLRKLPAKAHYWLVINSCTEILLGAAVLLLVSLFATMAPV
>NZ_CP054048.1|WP_050080589.1|4138997_4139384_+|CopC-domain-containing-protein-YobA
MFIRKVRSSCRMLSALIVLFVGLSSQQALAHAHLKIESPAADTTIGSAPEALTLGFSEGIELNFSGVKVTGPDNSVVKTGALKLDPANNTQLILPIDHALTAGKYNVSWHVVSVDGHKTKGTYSFTVK
>NZ_CP054048.1|WP_019210237.1|4138094_4138604_+|non-heme-ferritin
MLKTEMAQKLNEQLNLEFYSANLYLQMSAWCSDKGFEGAAAFLKEHSQEEMQHMQRLFEYLSGTGSMPVLGTISAPPIDFASLADVFKLTYEHEQLITTQINELAHVAMTTHDYSTFNFLQWYVAEQHEEEKLFKSILDKLALVGNSGNSLFFVDKDLKTMAAQSHPQA
>NZ_CP054048.1|WP_108087672.1|4137467_4137701_-|DNA-polymerase-III-subunit-theta
MGYNLAELSREEMAKMNVDLAASGVAFKERYNMPVIPEMVAREQPEELCEYFSQRLAHYRIESNKFSRLPYEPKMKS
>NZ_CP054048.1|WP_050285736.1|4136465_4137422_+|prolyl-aminopeptidase
MEQLRGLYPAYEPYDSGLLDTGDGHQIYWELCGNPEGKPAVFIHGGPGGGIAPYHRQLFNPTKYKVLLFDQRGCGRSKPHASLENNTTWHLVEDIERLRKMAGVDKWLLFGGSWGSTLALAYGETHPERVSEMVLRGIFTLRKKELHWYYQEGASRFFPDKWQRILSILSPEEQGDVIAAYRKRLTSPDKAVQLEAAKIWSLWEGETVTLLPTKSSASFGEDDFALAFARIENHYFTHLGFLDDDNQLLDNVTRIRHIPAVIIHGRYDMACQPQNAWDLAQAWPEAELHLVEGAGHSFDEPGILHQLILATDKFARKS
>NZ_CP054048.1|WP_155410999.1|4136030_4136183_-|hypothetical-protein
MRTNLTEGKERQAMSKGMDSKKNAKKKPLKTPAEKKAEKRAKKSSTSSAE
>NZ_CP054048.1|WP_108087671.1|4135287_4135947_-|exodeoxyribonuclease-X
MYFRVIDTETCGLDGGIVEVASIDIVDGQLSNPMSDLVSPDRPISIDAMVIHHITEEMVEGKPRIAVAIQKYQGSPYYVAHNAPFDRGVLPEMGGQWICTFKLARMLYPDIKYSNQYLRYALRLNVSPPDGLYPHRALYDCYVTAALLQRIMKDSGWNAEQMVEITQQPLLLQTFKFGKYRGKSIEQIARQDPDYLRWMLASITDLTPDMRHTLNHYLS
>NZ_CP054048.1|WP_050080596.1|4146616_4146883_-|hypothetical-protein
MNILTVIRKIIVPAICFLSVFAALPSHAAPLESQKFICSGAYGDATDSGLWDWTFTANSEADAANQAKAKYMLTTPGAWVNVFFCRPQ
>NZ_CP054048.1|WP_155489872.1|4147310_4147448_+|hypothetical-protein
MSEENRKTNSDPSSKTGEKPFPNKIGYVIGIVILLLAVGYMFMYW
>NZ_CP054048.1|WP_108087676.1|4147751_4148381_+|CatB-related-O-acetyltransferase
MNNKHWSKVEYLHASVKNPNILIKGQHSYYSDCWDDGFESSVVRYLHGDSVSQQWEPLGHIDQLIIGDYVCIAAEAVILMGGNHNHRIDFISLYPFMSMIRDSYQPRGDTVLSDGCWLGMRCMILPGVTVGEGAVIAAGSIVTKDIPPYAIVGGNPAQLLKYRFSEETISKILSLQIYNRSDDEIERLIPLLSSEDIPALELALTELDA
>NZ_CP054048.1|WP_049607057.1|4148534_4148729_-|hypothetical-protein
MLIGFVLLVSTCGMDACEALPVTDDIYATRHECMAVALRLHERRPDVVLICGEVYRNAGSDEAN
>NZ_CP054048.1|WP_019210224.1|4148928_4149177_+|hypothetical-protein
MKQFPFDKRYEIEDASGVIGYYIDGDEYIRTQDGIPGYRIDGYEVYEHDAPTKLAGFLEGKHITTPDADILLTILDDQQPTE
>NZ_CP054048.1|WP_050080599.1|4149261_4149897_+|glutathione-transferase
MNQQTITLYSDADFFSPYVMSAFVALTEKALPFTLSTINLSKGEHMQPAYALLSTTRRVPTLVIDDFQLSESSAIAEYLEERFPSPDYARVYPQDRQERARAREIQAWLRSDFMPIRAERPTEVVFAGLKLPPLSENGLQAASKLISGLEPLLSDGRKYLFNEWCIADTDLALMLNRLALSGDPLPDYLQQYASYQWRRPSVQQWRALSQK
>NZ_CP054048.1|WP_005272441.1|4150165_4150399_+|hypothetical-protein
MKKVSIIAQCLINAKSFSEMSEAESSIKKVFNDSYADHSFDEWNTDVSTLSANRIISLVAGASKVRVRGLIQELWNH
>NZ_CP054048.1|WP_088130070.1|4150866_4150998_-|hypothetical-protein
MLRSSKDPRVTKRFHAKHWKMFVVLLCICGALMLLRWASMIFG
>NZ_CP054048.1|WP_050080601.1|4151150_4151540_+|ASCH-domain-containing-protein
MATIPQKYQDAERWAFGDTEQVADDVLALVLDGTKTATCASLDDEGVPQAGDVFVVVNGRNEPVCAVELTDVELKTFDQVDEAHALAEGEGDRTLTYWRKTQQRFFEEYDMFSPDMMLICMRFKLLEKF
>NZ_CP054048.1|WP_049607063.1|4151653_4151896_-|DUF1480-family-protein
MVKTVVKIRSFEVDDAVLAAPLEKSENTLSIPCKSDPDLCMQLDGWDEHTSIPATLDGNDRLLYKQHYDQNQDAWIMKVT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27 : 34556

Salmonella_phage(17.39%)

capsid,portal,head,integrase,tail,plate,terminase,holin

attL 22393:22406|attR 39703:39716

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_108087865.1\|27_624_-	YmfQ family protein	A0A2P9JZK7	Alteromonadaceae_phage	2.8e-32	37.2
WP_108087866.1\|620_1757_-\|plate	baseplate J/gp47 family protein	B6SBU6	Clostridium_virus	9.8e-10	25.7
WP_108087867.1\|1760_2198_-	phage GP46 family protein	A0A0C4UR04	Shigella_phage	2.6e-19	48.2
WP_108087868.1\|2194_2788_-\|plate	phage baseplate assembly protein	NA	NA	NA	NA
WP_108087869.1\|2784_3858_-\|tail	phage tail protein	M1PVV2	Vibrio_phage	1.6e-41	30.9
WP_172986824.1\|3854_5261_-	DNA circularization protein	A0A192Y5U9	Salmonella_phage	3.0e-24	27.8
WP_108087871.1\|5318_7121_-	transglycosylase SLT domain-containing protein	A0A2H4J9N7	uncultured_Caudovirales_phage	4.5e-25	51.7
WP_083159844.1\|7238_7541_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_049615551.1\|7542_7917_-\|tail	phage tail tube protein	NA	NA	NA	NA
WP_172986825.1\|7929_9420_-\|tail	phage tail sheath subtilisin-like domain-containing protein	B5TK67	Pseudomonas_phage	3.1e-104	44.6
WP_108087873.1\|9419_9611_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_108087874.1\|9616_10162_-	ATP-binding protein	NA	NA	NA	NA
WP_108087875.1\|10158_10503_-	hypothetical protein	NA	NA	NA	NA
WP_108087876.1\|10502_10997_-	hypothetical protein	NA	NA	NA	NA
WP_108087806.1\|10998_12045_-\|capsid	major capsid protein	Q6UYI3	Burkholderia_phage	2.4e-39	31.3
WP_108087807.1\|12153_12555_-\|head	head decoration protein	A0A067ZIL6	Vibrio_phage	9.0e-11	37.5
WP_108087877.1\|12554_13139_-	DNA primase	NA	NA	NA	NA
WP_108087878.1\|13138_13996_-	S49 family peptidase	A0A2I6TC87	Escherichia_phage	1.3e-51	39.1
WP_108088282.1\|13992_15561_-\|portal	phage portal protein	A0A291AUL8	Sinorhizobium_phage	2.2e-97	38.3
WP_108087879.1\|15629_15893_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_108088283.1\|15901_17878_-\|terminase	phage terminase large subunit family protein	G8EXZ6	Synechococcus_phage	1.7e-134	45.3
WP_108087880.1\|17849_18449_-	RNA polymerase subunit sigma-70	NA	NA	NA	NA
WP_108087881.1\|18559_19084_-	HNH endonuclease	A0A1W6DY33	Salmonella_phage	9.0e-35	50.6
WP_108087882.1\|19160_19805_-	hypothetical protein	NA	NA	NA	NA
WP_145566229.1\|20037_20316_-	hypothetical protein	NA	NA	NA	NA
WP_145566227.1\|20334_20745_-	hypothetical protein	NA	NA	NA	NA
WP_172986939.1\|20755_21256_-	DUF2514 family protein	Q7Y3V2	Yersinia_phage	1.3e-70	83.7
WP_049525582.1\|21273_21672_-	M15 family metallopeptidase	E7C9S9	Salmonella_phage	1.0e-38	61.7
WP_049525581.1\|21658_21976_-\|holin	phage holin family protein	E7C9S8	Salmonella_phage	8.4e-28	57.6
22393:22406	attL	NA	NA	NA	NA
WP_049606725.1\|22765_22966_-	hypothetical protein	NA	NA	NA	NA
WP_108087887.1\|23298_23700_-	antitermination protein	S5M7R9	Escherichia_phage	2.6e-34	56.3
WP_172986826.1\|23887_24904_-	hypothetical protein	A0A1B5FPA6	Escherichia_phage	9.2e-68	50.5
WP_050535715.1\|25003_27673_-	DUF927 domain-containing protein	A0A1W6JPG0	Morganella_phage	4.1e-232	48.7
WP_032898470.1\|27669_28065_-	hypothetical protein	NA	NA	NA	NA
WP_172986827.1\|28178_28382_-	hypothetical protein	NA	NA	NA	NA
WP_099460543.1\|28384_28555_-	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_172986822.1\|28532_28730_-	hypothetical protein	NA	NA	NA	NA
WP_172986828.1\|28722_29517_-	ORF6N domain-containing protein	F1C5A3	Cronobacter_phage	7.2e-44	45.1
WP_145519121.1\|29509_29806_-	transcriptional regulator	NA	NA	NA	NA
WP_172986829.1\|29960_30161_-	host cell division inhibitor Icd-like protein	NA	NA	NA	NA
WP_050880143.1\|30354_30540_+	hypothetical protein	NA	NA	NA	NA
WP_172986830.1\|30811_31432_-	hypothetical protein	A0A0P0J0J7	Acinetobacter_phage	8.5e-24	39.7
WP_172986831.1\|31540_31747_-	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	4.1e-07	45.3
WP_172986832.1\|31891_32950_-	hypothetical protein	NA	NA	NA	NA
WP_108087895.1\|33365_34556_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	3.2e-136	59.0
39703:39716	attR	NA	NA	NA	NA

DBSCAN-SWA_2

359231 : 399778

Shigella_phage(34.29%)

terminase,capsid,portal,head,integrase,tail,plate,protease,holin

attL 378970:378985|attR 400834:400849

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098904284.1\|359231_360224_-	hypothetical protein	U5P0I1	Shigella_phage	1.5e-22	47.6
WP_050874971.1\|360230_360812_-	YmfQ family protein	O22003	Shigella_phage	3.9e-71	64.6
WP_172986837.1\|360802_361861_-\|plate	baseplate J/gp47 family protein	U5P424	Shigella_phage	3.2e-132	63.1
WP_050874976.1\|361853_362267_-	phage GP46 family protein	A0A192Y6D0	Salmonella_phage	2.7e-42	59.9
WP_172986838.1\|362270_362837_-\|plate	phage baseplate assembly protein	Q8HAB9	Salmonella_phage	1.8e-33	48.3
WP_172986839.1\|362836_363907_-\|plate	baseplate protein	U5P0H6	Shigella_phage	1.9e-132	65.2
WP_172986840.1\|363903_365208_-	DNA circularization N-terminal domain-containing protein	S5FUX4	Shigella_phage	5.0e-135	55.8
WP_172986841.1\|365273_365828_-	hypothetical protein	NA	NA	NA	NA
WP_050090279.1\|365790_367620_-\|tail	phage tail tape measure protein	M1FQW0	Enterobacteria_phage	2.0e-174	61.0
WP_050090283.1\|367761_368028_-\|tail	phage tail assembly protein	M1FPE4	Enterobacteria_phage	9.5e-25	63.5
WP_038277325.1\|368024_368381_-\|tail	phage tail tube protein	U5P076	Shigella_phage	9.1e-55	85.6
WP_172986842.1\|368381_369875_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A192Y7L1	Salmonella_phage	4.6e-185	68.5
WP_049603053.1\|369871_370078_-	DUF2635 domain-containing protein	Q8SBH3	Shigella_phage	4.3e-09	66.7
WP_057645666.1\|370084_370636_-	hypothetical protein	S5FM61	Shigella_phage	1.8e-57	58.2
WP_057645669.1\|370632_371151_-	hypothetical protein	M1FPE2	Enterobacteria_phage	5.7e-50	58.6
WP_057645672.1\|371150_371543_-\|head	phage head closure protein	NA	NA	NA	NA
WP_057645676.1\|371539_371857_-\|head,tail	phage gp6-like head-tail connector protein	S5FKK6	Shigella_phage	8.1e-31	62.3
WP_057645732.1\|371940_373167_-\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	8.0e-159	68.5
WP_057645679.1\|373185_373785_-\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	1.0e-82	76.0
WP_172986843.1\|373777_375010_-\|portal	phage portal protein	A0A1W6JP33	Morganella_phage	1.4e-195	82.2
WP_019081897.1\|374999_375161_-	hypothetical protein	NA	NA	NA	NA
WP_057645684.1\|375157_376888_-\|terminase	terminase large subunit	Q8HAD6	Salmonella_phage	1.3e-287	81.8
WP_050535723.1\|376884_377379_-\|terminase	phage terminase small subunit P27 family	U5P067	Shigella_phage	9.9e-76	84.1
WP_138774975.1\|377555_377906_-	HNH endonuclease	A0A1W6JP27	Morganella_phage	1.2e-43	67.2
WP_138775215.1\|378001_378583_+	hypothetical protein	NA	NA	NA	NA
WP_172986943.1\|378656_379157_-	DUF2514 family protein	Q7Y3V2	Yersinia_phage	2.0e-71	84.3
378970:378985	attL	NA	NA	NA	NA
WP_049525582.1\|379174_379573_-	M15 family metallopeptidase	E7C9S9	Salmonella_phage	1.0e-38	61.7
WP_049525581.1\|379559_379877_-\|holin	phage holin family protein	E7C9S8	Salmonella_phage	8.4e-28	57.6
WP_049606725.1\|380666_380867_-	hypothetical protein	NA	NA	NA	NA
WP_172986844.1\|381248_382013_-	antitermination protein	A0A286N2Q2	Klebsiella_phage	3.1e-60	47.3
WP_050875033.1\|382028_383390_-	helicase	Q8W640	Enterobacteria_phage	8.4e-117	50.0
WP_172986845.1\|383386_384226_-	ATP-binding protein	K7PLU3	Enterobacteria_phage	9.6e-63	44.8
WP_172986846.1\|384258_385140_-	hypothetical protein	A0A067ZIA1	Vibrio_phage	6.6e-30	43.9
WP_172986847.1\|385136_385961_-	transporter	Q8W644	Enterobacteria_phage	2.4e-114	70.8
WP_050151988.1\|385980_386190_-	helix-turn-helix transcriptional regulator	A0A1C9IHV8	Salmonella_phage	8.6e-13	52.9
WP_050874302.1\|386307_386997_+	helix-turn-helix transcriptional regulator	F1C5C2	Cronobacter_phage	1.4e-80	62.4
WP_050874299.1\|387186_387396_+	hypothetical protein	NA	NA	NA	NA
WP_050874297.1\|387409_387628_+	hypothetical protein	NA	NA	NA	NA
WP_050874294.1\|387624_387816_+	hypothetical protein	NA	NA	NA	NA
WP_172986848.1\|387812_388178_+	hypothetical protein	NA	NA	NA	NA
WP_172986849.1\|388167_388368_+	hypothetical protein	NA	NA	NA	NA
WP_172986850.1\|388360_388567_+	hypothetical protein	NA	NA	NA	NA
WP_172986851.1\|388556_388778_+	hypothetical protein	NA	NA	NA	NA
WP_172986852.1\|388770_389154_+	S24 family peptidase	NA	NA	NA	NA
WP_172986853.1\|389157_389592_+	hypothetical protein	A0A286S1S2	Klebsiella_phage	2.3e-15	41.0
WP_172986854.1\|389680_390040_+	hypothetical protein	NA	NA	NA	NA
WP_050079869.1\|390036_390225_+	hypothetical protein	NA	NA	NA	NA
WP_050075091.1\|390221_390752_+	hypothetical protein	NA	NA	NA	NA
WP_050079870.1\|390765_391362_+	hypothetical protein	NA	NA	NA	NA
WP_050874145.1\|391345_391471_+	hypothetical protein	NA	NA	NA	NA
WP_050874148.1\|391467_391689_+	hypothetical protein	A0A1B5FPG2	Escherichia_phage	6.9e-13	55.6
WP_050874150.1\|391685_392060_+	hypothetical protein	NA	NA	NA	NA
WP_050874152.1\|392049_392511_+	hypothetical protein	NA	NA	NA	NA
WP_019210765.1\|392503_392740_+	hypothetical protein	NA	NA	NA	NA
WP_050079875.1\|392739_393006_+	hypothetical protein	NA	NA	NA	NA
WP_172665462.1\|393002_393161_+	hypothetical protein	NA	NA	NA	NA
WP_172986855.1\|393153_393447_+	hypothetical protein	NA	NA	NA	NA
WP_025377636.1\|393449_393650_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_172986856.1\|393615_394809_-\|integrase	integrase arm-type DNA-binding domain-containing protein	Q8W6M6	Sinorhizobium_phage	4.9e-60	37.9
WP_050286551.1\|394984_395764_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004877266.1\|395957_396098_-	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
WP_108087933.1\|396301_397093_+	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
WP_050082513.1\|397202_398714_+	molybdate ABC transporter ATP-binding protein ModF	A0A1M7XV31	Cedratvirus	6.2e-12	29.5
WP_050082512.1\|398959_399778_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
400834:400849	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2495224 : 2566006

Erwinia_phage(48.65%)

capsid,portal,head,plate,integrase,tail,tRNA,lysis,terminase,holin

attL 2508226:2508241|attR 2531487:2531502

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050083160.1\|2495224_2495620_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_019212474.1\|2495622_2495928_-	DUF883 domain-containing protein	NA	NA	NA	NA
WP_108087304.1\|2496053_2496446_-	DUF1090 domain-containing protein	NA	NA	NA	NA
WP_050286895.1\|2496632_2497022_-	EnvZ/OmpR regulon moderator MzrA	NA	NA	NA	NA
WP_050083155.1\|2497018_2497723_-	DedA family protein	NA	NA	NA	NA
WP_050083153.1\|2497961_2498495_-	hypothetical protein	NA	NA	NA	NA
WP_050083152.1\|2498747_2499557_-	transcriptional regulator ExuR	NA	NA	NA	NA
WP_050083218.1\|2499800_2501102_-	MFS transporter	NA	NA	NA	NA
WP_019212482.1\|2501702_2503112_+	glucuronate isomerase	NA	NA	NA	NA
WP_050083148.1\|2503306_2504758_+	tagaturonate reductase	NA	NA	NA	NA
WP_050286898.1\|2504768_2506259_+	altronate dehydratase	NA	NA	NA	NA
WP_019212485.1\|2506432_2506984_+	YgjV family protein	NA	NA	NA	NA
WP_050083145.1\|2507050_2508307_-	serine/threonine transporter SstT	NA	NA	NA	NA
2508226:2508241	attL	NA	NA	NA	NA
WP_167311508.1\|2508639_2509623_-	TerC family protein	A0A291LBC5	Escherichia_phage	1.8e-36	35.6
WP_099462050.1\|2509678_2509873_+	hypothetical protein	NA	NA	NA	NA
WP_050874444.1\|2509978_2510980_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_050286901.1\|2511077_2511581_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_050083136.1\|2511869_2513057_+	23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG	NA	NA	NA	NA
WP_159074550.1\|2513131_2516008_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_108087306.1\|2516374_2518396_-	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_050083133.1\|2518634_2519207_-	HdeD family acid-resistance protein	NA	NA	NA	NA
WP_072084818.1\|2519376_2520171_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_019212496.1\|2520332_2520980_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_019212497.1\|2521070_2522387_-	MFS transporter	NA	NA	NA	NA
WP_050083127.1\|2522428_2523421_-	2-dehydro-3-deoxygalactonokinase	NA	NA	NA	NA
WP_050083125.1\|2523578_2524598_-	2-dehydro-3-deoxygalactonokinase	NA	NA	NA	NA
WP_057650849.1\|2524677_2525829_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_057650847.1\|2526127_2527303_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_098904993.1\|2527413_2527863_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_159074551.1\|2528218_2529154_-	hypothetical protein	NA	NA	NA	NA
WP_108087307.1\|2529166_2530177_-\|integrase	tyrosine-type recombinase/integrase	A0A218M4I3	Erwinia_phage	6.1e-181	91.5
WP_108087308.1\|2530176_2530755_-	phage repressor protein CI	A0A218M4J1	Erwinia_phage	5.6e-62	63.0
WP_064515257.1\|2530884_2531160_+	hypothetical protein	A0A218M4I5	Erwinia_phage	2.8e-35	82.4
WP_108087309.1\|2531180_2531690_+	phage regulatory CII family protein	A0A1S6L008	Salmonella_phage	2.1e-44	51.2
2531487:2531502	attR	NA	NA	NA	NA
WP_012303669.1\|2531699_2531885_+	DUF2724 domain-containing protein	NA	NA	NA	NA
WP_108087310.1\|2531896_2532208_+	hypothetical protein	NA	NA	NA	NA
WP_108087311.1\|2532273_2532522_+	DUF2732 family protein	NA	NA	NA	NA
WP_108087312.1\|2532508_2534791_+	replication endonuclease	Q858T4	Yersinia_virus	1.7e-242	57.2
WP_050535850.1\|2534810_2535170_+	hypothetical protein	H9C172	Pectobacterium_phage	3.1e-18	43.4
WP_050535841.1\|2535370_2535589_+	hypothetical protein	NA	NA	NA	NA
WP_050535840.1\|2535879_2536086_+	hypothetical protein	NA	NA	NA	NA
WP_050535839.1\|2536102_2536954_+	hypothetical protein	I6PD67	Cronobacter_phage	5.9e-76	54.2
WP_108087314.1\|2537339_2538377_-\|portal	phage portal protein	F1BUR7	Erwinia_phage	4.5e-163	79.1
WP_108087315.1\|2538373_2540146_-\|terminase	terminase ATPase subunit family protein	F1BUR2	Erwinia_phage	2.0e-288	81.3
WP_108087316.1\|2540291_2541146_+\|capsid	GPO family capsid scaffolding protein	Q01088	Escherichia_phage	6.9e-93	62.5
WP_108087317.1\|2541222_2542458_+\|capsid	phage major capsid protein, P2 family	F1BUQ8	Erwinia_phage	1.9e-152	74.4
WP_108087318.1\|2542461_2543121_+\|terminase	terminase endonuclease subunit	F1BUQ7	Erwinia_phage	8.6e-83	71.7
WP_108087319.1\|2543220_2543694_+\|head	head completion/stabilization protein	M1SNN6	Escherichia_phage	4.9e-40	56.1
WP_020282765.1\|2543693_2543897_+\|tail	tail protein X	A0A218M4L8	Erwinia_phage	5.4e-20	65.7
WP_019079970.1\|2543899_2544109_+	hypothetical protein	NA	NA	NA	NA
WP_108087320.1\|2544092_2544599_+	lysozyme	A0A218M4K3	Erwinia_phage	8.9e-56	63.1
WP_108087321.1\|2544600_2545005_+\|lysis	LysB family phage lysis regulatory protein	F1BUQ1	Erwinia_phage	1.5e-26	50.4
WP_071827698.1\|2544976_2545174_+\|holin	holin	F1BUQ0	Erwinia_phage	5.2e-12	54.8
WP_108087322.1\|2545112_2545568_+\|tail	phage tail protein	F1BUP9	Erwinia_phage	1.8e-47	62.7
WP_108087323.1\|2545564_2546029_+	phage virion morphogenesis protein	O80313	Escherichia_phage	4.5e-46	66.0
WP_108087324.1\|2546115_2546739_+	sce7726 family protein	NA	NA	NA	NA
WP_108088232.1\|2546724_2547756_-	beta family protein	NA	NA	NA	NA
WP_108087325.1\|2547761_2548304_-	ImmA/IrrE family metallo-endopeptidase	Q854W5	Mycobacterium_virus	6.1e-10	34.2
WP_108087326.1\|2548304_2549048_-	hydrolase	NA	NA	NA	NA
WP_108087327.1\|2549202_2549844_+\|plate	phage baseplate assembly protein V	A0A0M4S6F6	Salmonella_phage	2.5e-71	64.5
WP_108087328.1\|2549840_2550191_+	GPW/gp25 family protein	F1BUP4	Erwinia_phage	2.0e-38	66.4
WP_108087329.1\|2550195_2551104_+\|plate	baseplate assembly protein	F1BUP3	Erwinia_phage	1.9e-125	79.8
WP_108087330.1\|2551096_2551705_+\|tail	phage tail protein I	F1BUP2	Erwinia_phage	6.7e-90	79.1
WP_108087332.1\|2552873_2553353_+\|tail	phage tail protein	F1BUP0	Erwinia_phage	1.8e-37	46.2
WP_145566058.1\|2553479_2554649_+\|tail	phage tail sheath subtilisin-like domain-containing protein	F1BUU3	Erwinia_phage	3.1e-184	80.5
WP_108087336.1\|2554662_2555178_+\|tail	phage major tail tube protein	S4TNZ0	Salmonella_phage	1.0e-67	73.7
WP_108087337.1\|2555231_2555543_+\|tail	phage tail assembly protein	F1BUU0	Erwinia_phage	1.6e-23	62.5
WP_004875948.1\|2555575_2555698_+\|tail	GpE family phage tail protein	Q858U8	Yersinia_virus	2.0e-09	71.1
WP_108087338.1\|2555690_2558123_+\|tail	phage tail tape measure protein	Q7Y4C8	Escherichia_virus	2.8e-147	45.2
WP_108087339.1\|2558125_2558611_+\|tail	phage tail protein	A0A0F7LDE8	Escherichia_phage	6.3e-51	59.9
WP_108087340.1\|2558607_2559771_+	phage late control D family protein	A0A0M5M5V5	Salmonella_phage	7.9e-148	67.2
WP_072076720.1\|2559877_2560096_+	DNA-binding transcriptional regulator	Q37973	Salmonella_virus	1.6e-25	70.8
WP_019212504.1\|2560524_2562363_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.9e-34	33.3
WP_050083118.1\|2562520_2564269_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.0e-74	38.4
WP_001144069.1\|2564404_2564620_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_019212506.1\|2564992_2566006_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.1e-105	57.7

DBSCAN-SWA_4

3488812 : 3533599

Salmonella_phage(23.91%)

head,protease,integrase,tail

attL 3532387:3532400|attR 3535596:3535609

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_108087564.1\|3488812_3489274_-	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	3.8e-53	84.0
WP_108087565.1\|3489270_3490134_-	ATP-binding protein	Q94MN8	Myxococcus_phage	2.4e-48	44.9
WP_172986898.1\|3490144_3490321_-	hypothetical protein	NA	NA	NA	NA
WP_172986899.1\|3490317_3490497_-	DUF5444 family protein	NA	NA	NA	NA
WP_099466446.1\|3490493_3490625_-\|protease	protease FtsH-inhibitory lysogeny factor CIII	NA	NA	NA	NA
WP_128823345.1\|3490719_3490926_-	hypothetical protein	NA	NA	NA	NA
WP_050311062.1\|3491319_3491577_-	hypothetical protein	U5PUY0	Salmonella_phage	1.4e-17	53.8
WP_072083845.1\|3491738_3491918_+	hypothetical protein	NA	NA	NA	NA
WP_172986900.1\|3492061_3492292_-	hypothetical protein	NA	NA	NA	NA
WP_172986901.1\|3492352_3492700_-	hypothetical protein	A0A0K2FII1	Escherichia_phage	8.4e-05	34.9
WP_050144656.1\|3493342_3493549_+	hypothetical protein	A0A2H5BFH9	Salmonella_phage	4.9e-13	58.2
WP_050945902.1\|3493873_3494227_-	hypothetical protein	NA	NA	NA	NA
WP_057532843.1\|3494528_3495254_-	LexA family transcriptional regulator	K7PK07	Enterobacteria_phage	3.6e-74	61.2
WP_172986902.1\|3495700_3495991_+	hypothetical protein	I6RSP4	Salmonella_phage	3.1e-21	57.3
WP_172986903.1\|3496003_3496165_+	hypothetical protein	NA	NA	NA	NA
WP_172986904.1\|3496157_3497363_+	hypothetical protein	Q7Y5W1	Haemophilus_phage	1.1e-06	33.7
WP_172986952.1\|3497362_3498748_+	AAA family ATPase	A0A0P0ZC27	Stx2-converting_phage	4.5e-158	62.7
WP_172986905.1\|3498747_3499050_+	hypothetical protein	NA	NA	NA	NA
WP_172986906.1\|3499046_3499340_+	hypothetical protein	NA	NA	NA	NA
WP_172986907.1\|3499336_3499894_+	hypothetical protein	NA	NA	NA	NA
WP_172986908.1\|3499890_3500130_+	DUF4752 family protein	T1S9K2	Salmonella_phage	5.4e-19	60.0
WP_057649643.1\|3500132_3500570_+	recombination protein NinB	E5AGF7	Erwinia_phage	3.9e-68	84.1
WP_108087580.1\|3500566_3500773_+	hypothetical protein	A0A2H4P784	Pseudomonas_phage	8.2e-08	47.6
WP_077174391.1\|3500896_3501412_+	hypothetical protein	A0A0H4IQ56	Shigella_phage	7.9e-68	72.8
WP_172986909.1\|3501404_3501551_+	hypothetical protein	NA	NA	NA	NA
WP_050879018.1\|3501525_3502119_+	recombination protein NinG	A0A2R2Z332	Escherichia_phage	1.2e-38	43.5
WP_172986910.1\|3502115_3502733_+	hypothetical protein	A0A1V0E5R2	Salmonella_phage	7.5e-57	56.3
WP_172986911.1\|3503128_3503452_+	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	1.1e-27	61.2
WP_050535746.1\|3503654_3504167_+	HNH endonuclease	G0XNS0	Escherichia_phage	6.3e-41	54.1
WP_172986912.1\|3504341_3504557_+	peptidoglycan-binding protein LysM	H9C183	Pectobacterium_phage	1.1e-12	54.3
WP_172986913.1\|3504556_3505087_+	lysozyme	H9C184	Pectobacterium_phage	5.3e-75	74.3
WP_172986914.1\|3505079_3505469_+	exotoxin	U5P0U9	Shigella_phage	1.4e-08	30.8
WP_108087586.1\|3505883_3506570_+	Rha family transcriptional regulator	A0A192Y918	Salmonella_phage	3.2e-109	85.1
WP_172986953.1\|3507232_3507847_+	hypothetical protein	H9C189	Pectobacterium_phage	2.2e-85	72.7
WP_057649664.1\|3507880_3508360_+	DUF2280 domain-containing protein	F1C5D6	Cronobacter_phage	6.7e-61	74.2
WP_108087589.1\|3508346_3509825_+	DNA-packaging protein	G0ZND4	Cronobacter_phage	1.1e-260	88.2
WP_172986915.1\|3510088_3511465_+	DUF1073 domain-containing protein	H6WRT0	Salmonella_phage	2.1e-179	72.0
WP_172986954.1\|3511499_3512342_+\|head	phage head morphogenesis protein	Q5G8Y3	Enterobacteria_phage	3.6e-94	64.1
WP_172986916.1\|3512345_3513623_+	hypothetical protein	G0ZND7	Cronobacter_phage	7.0e-190	78.8
WP_172986917.1\|3513622_3514063_+	hypothetical protein	A0A125RNM2	Pseudomonas_phage	5.4e-41	64.1
WP_057649678.1\|3514073_3515171_+	hypothetical protein	A0A125RNM3	Pseudomonas_phage	7.7e-137	65.8
WP_145585524.1\|3515180_3515375_+	glycoprotein	Q5G8X9	Enterobacteria_phage	9.1e-17	70.3
WP_172986918.1\|3515438_3515837_+	hypothetical protein	G0ZNE1	Cronobacter_phage	8.9e-59	81.1
WP_155483172.1\|3516003_3516234_+	hypothetical protein	NA	NA	NA	NA
WP_172986919.1\|3516234_3516585_+	hypothetical protein	G0ZNE2	Cronobacter_phage	1.3e-29	56.9
WP_050879000.1\|3516586_3516955_+	hypothetical protein	F1C5E3	Cronobacter_phage	3.7e-43	69.7
WP_108087597.1\|3516951_3517335_+	hypothetical protein	G0ZNE4	Cronobacter_phage	2.4e-45	66.9
WP_172986920.1\|3517359_3518109_+	Ig domain-containing protein	G0ZNE6	Cronobacter_phage	9.5e-46	51.2
WP_108087599.1\|3518183_3518789_-	hypothetical protein	M9NZJ1	Enterobacteria_phage	4.8e-48	47.2
WP_108088261.1\|3519122_3519461_+	hypothetical protein	A0A222YZ97	Escherichia_phage	2.6e-27	59.6
WP_172986921.1\|3519542_3520235_+	hypothetical protein	A0A1W6JNX2	Morganella_phage	1.8e-51	49.1
WP_172986922.1\|3520224_3522828_+	tape measure protein	A0A1W6JNU2	Morganella_phage	2.1e-84	31.4
WP_172986923.1\|3522877_3523099_+	hypothetical protein	NA	NA	NA	NA
WP_172986924.1\|3523160_3523511_+\|tail	phage tail protein	A0A1V0E5N3	Salmonella_phage	3.6e-48	75.0
WP_172986925.1\|3523537_3523810_+	hypothetical protein	NA	NA	NA	NA
WP_172986926.1\|3523790_3524021_-	hypothetical protein	NA	NA	NA	NA
WP_050287234.1\|3524195_3524900_+\|tail	phage minor tail protein L	A0A1V0E5N2	Salmonella_phage	2.0e-109	79.9
WP_108087607.1\|3524899_3525625_+	C40 family peptidase	Q5G8W2	Enterobacteria_phage	1.6e-98	67.9
WP_050287232.1\|3525567_3526095_+\|tail	tail assembly protein	H6WRW3	Salmonella_phage	9.7e-45	58.0
WP_172986927.1\|3526104_3529272_+	host specificity protein J	I6R9B3	Salmonella_phage	0.0e+00	66.4
WP_108087609.1\|3529271_3530270_+	hypothetical protein	I6PBN9	Cronobacter_phage	5.4e-20	29.8
WP_172986928.1\|3531966_3532176_-	hypothetical protein	NA	NA	NA	NA
3532387:3532400	attL	NA	NA	NA	NA
WP_172986929.1\|3532420_3533599_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	9.2e-128	54.1
WP_172986929.1\|3532420_3533599_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	9.2e-128	54.1
3535596:3535609	attR	NA	NA	NA	NA

DBSCAN-SWA_5

3919831 : 3931600

Herpes_simplex_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_108087544.1\|3919831_3922978_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	63.2
WP_108087545.1\|3923126_3924152_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	7.5e-86	52.1
WP_002210893.1\|3924643_3924856_+	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	2.0e-25	80.0
WP_004701013.1\|3925189_3925381_+	protein DsrB	NA	NA	NA	NA
WP_108087546.1\|3925529_3927269_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.7e-11	51.2
WP_050083779.1\|3928025_3928724_+	MgtC family protein	G3MA03	Bacillus_virus	3.6e-15	42.5
WP_050083778.1\|3928903_3931600_+	magnesium-translocating P-type ATPase	M1HM40	Paramecium_bursaria_Chlorella_virus	1.2e-42	25.6

DBSCAN-SWA_6

4024680 : 4057406

Enterobacteria_phage(25.81%)

capsid,portal,protease,head,integrase,tail,terminase,holin

attL 4024524:4024583|attR 4064124:4064244

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4024524:4024583	attL	NA	NA	NA	NA
WP_108087620.1\|4024680_4025703_-\|integrase	tyrosine-type recombinase/integrase	K7PLZ2	Enterobacterial_phage	5.0e-138	69.9
WP_050134996.1\|4025702_4025930_-	DUF4224 domain-containing protein	K7PHA0	Enterobacterial_phage	3.8e-14	44.4
WP_108087621.1\|4026207_4026738_-	hypothetical protein	A0A1W6JP41	Morganella_phage	5.5e-48	57.2
WP_108087622.1\|4027195_4027663_+	hypothetical protein	NA	NA	NA	NA
WP_108087623.1\|4028018_4028651_-	LexA family transcriptional regulator	K7PM82	Enterobacteria_phage	2.2e-43	47.8
WP_057645851.1\|4028750_4028951_+	cell division protein	NA	NA	NA	NA
WP_057650005.1\|4028988_4029516_+	hypothetical protein	Q8SBF4	Shigella_phage	1.6e-10	27.7
WP_108087624.1\|4029681_4029879_+	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_108087625.1\|4029875_4030889_+	helix-turn-helix domain-containing protein	U5P0A0	Shigella_phage	7.3e-33	77.2
WP_108087626.1\|4030885_4032448_+	phage N-6-adenine-methyltransferase	A0A2H4J5Y9	uncultured_Caudovirales_phage	8.2e-100	54.9
WP_108088263.1\|4032471_4033116_+	phage antirepressor KilAC domain-containing protein	G0ZND1	Cronobacter_phage	1.4e-53	52.0
WP_108087627.1\|4033112_4034114_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	4.8e-93	50.3
WP_159074567.1\|4034139_4034802_+	antitermination protein	I6PDF8	Cronobacter_phage	1.1e-32	37.1
WP_023160403.1\|4035758_4036085_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_108087629.1\|4036088_4036715_+	glycoside hydrolase family 19 protein	K7PJS7	Enterobacterial_phage	5.3e-66	63.7
WP_108087630.1\|4036711_4037044_+	DUF2570 domain-containing protein	NA	NA	NA	NA
WP_108087632.1\|4037329_4037554_+	hypothetical protein	NA	NA	NA	NA
WP_108087633.1\|4037647_4037878_+	hypothetical protein	NA	NA	NA	NA
WP_108087634.1\|4037880_4038231_+	HNH endonuclease	A0A1B5FP94	Escherichia_phage	7.6e-46	71.3
WP_108087635.1\|4038380_4038878_+\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	2.2e-70	81.2
WP_108087636.1\|4038877_4040626_+\|terminase	terminase large subunit	K7PKT2	Enterobacteria_phage	1.3e-298	86.3
WP_172986959.1\|4040648_4040828_+	hypothetical protein	A0A1B5FP99	Escherichia_phage	2.0e-10	55.2
WP_108087638.1\|4040827_4042051_+\|portal	phage portal protein	Q8W629	Enterobacteria_phage	2.2e-180	77.1
WP_108087639.1\|4042040_4042691_+\|head,protease	HK97 family phage prohead protease	Q8HAD3	Salmonella_phage	2.0e-100	80.6
WP_108087640.1\|4042706_4043915_+\|capsid	phage major capsid protein	A0A192Y5T6	Salmonella_phage	6.4e-185	81.3
WP_172986930.1\|4043955_4044315_+	hypothetical protein	NA	NA	NA	NA
WP_108087641.1\|4044350_4044677_+\|head,tail	phage gp6-like head-tail connector protein	Q8SBH7	Shigella_phage	3.4e-08	32.4
WP_108087642.1\|4044673_4045012_+\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	2.3e-31	61.3
WP_108087643.1\|4045008_4045425_+	HK97 gp10 family phage protein	A0A1P8DTH7	Proteus_phage	5.3e-30	52.8
WP_108087644.1\|4045421_4045769_+	DUF3168 domain-containing protein	K7P7Q9	Enterobacteria_phage	2.5e-25	51.3
WP_108087645.1\|4045825_4046536_+	Ig-like domain-containing protein	A0A1W6JP06	Morganella_phage	7.6e-45	67.8
WP_108087646.1\|4046538_4046928_+\|tail	phage tail protein	Q9MCS5	Enterobacteria_phage	2.5e-26	52.8
WP_051144542.1\|4046951_4047224_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	4.7e-19	62.7
WP_108087647.1\|4047256_4050652_+\|tail	phage tail tape measure protein	A0A1P8DTH2	Proteus_phage	1.4e-99	30.0
WP_108087648.1\|4050648_4051002_+\|tail	phage tail protein	K7PKL8	Enterobacterial_phage	3.6e-27	51.3
WP_108087649.1\|4051010_4051763_+\|tail	phage minor tail protein L	K7PGX3	Enterobacteria_phage	4.2e-78	54.6
WP_108087650.1\|4051765_4052479_+	C40 family peptidase	A0A1W6JP31	Morganella_phage	1.4e-78	58.2
WP_108087651.1\|4052534_4053077_+	hypothetical protein	NA	NA	NA	NA
WP_108087652.1\|4053131_4053722_+\|tail	tail assembly protein	A0A1W6JNY8	Morganella_phage	1.6e-51	57.3
WP_108087653.1\|4053779_4057406_+	DUF1983 domain-containing protein	F1C571	Cronobacter_phage	0.0e+00	54.5
4064124:4064244	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054046

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP054047

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP054048

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection