CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP054052	Arcobacter lekithochrous strain DSM 100870 chromosome, complete genome	1 crisprs	cas3,cas4,PrimPol,DEDDh,csa3	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054052_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054052_1

1967737-1967945

Orphan

Consensus_repeat	Method
TAAATCATCATCAAAGAAACCAAAAGCATCATTGTCA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP054052_1

>merge|NZ_CP054052|1|1967737-1967945|PILER-CR
CATCATCAAAGAAACCAAAATCCTCTTTGTCATCATCAGTAACAACTAAAGTATCATCAGTATTAAGAGCAATTTCTTCTAATTCATCATCAAAGAAACCATAGTTTTTTTGTGGTTCATCTAACATATCATCAGCAAAAATACCAAATGATCTAGAGTTTTTTTGTTCATTTAAATCATCATCAAAGAAACCAATAGCATCATTGTCA

>NZ_CP054052|1|1|1967737-1967945|PILER-CR
CATCATCAAAGAAACCAAAATCCTCTTTGTCATCATC	AGTAACAACTAAAGTATCATCAGTATTAAGAGCAATTTCTTCTAATT
CATCATCAAAGAAACCATAGTTTTTTTGTGGTTCATC	TAACATATCATCAGCAAAAATACCAAATGATCTAGAGTTTTTTTGTTCATTTAAATCATCATCAAAGAAAC
CAATAGCATCATTGTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054052.1\|WP_071625450.1\|1957162_1957660_-\|RNA-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|234820
NZ_CP054052.1\|WP_071625431.1\|1978138_1979560_-\|ribosome-biogenesis-GTPase-Der	unknown	unknown	gnl\|CDD\|234628
NZ_CP054052.1\|WP_071625444.1\|1962635_1963688_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|376070
NZ_CP054052.1\|WP_071625447.1\|1959695_1961663_+\|M3-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341051
NZ_CP054052.1\|WP_071625433.1\|1975924_1976560_-\|uroporphyrinogen-III-synthase	unknown	unknown	gnl\|CDD\|235647
NZ_CP054052.1\|WP_071625439.1\|1968434_1968803_-\|response-regulator	unknown	unknown	gnl\|CDD\|381110
NZ_CP054052.1\|WP_071625435.1\|1973972_1974410_-\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NZ_CP054052.1\|WP_071625430.1\|1979650_1980193_-\|ribosome-associated-translation-inhibitor-RaiA	unknown	unknown	gnl\|CDD\|238308
NZ_CP054052.1\|WP_071625443.1\|1963704_1964778_-\|chemotaxis-specific-protein-glutamate-methyltransferase-CheB	unknown	unknown	gnl\|CDD\|234828
NZ_CP054052.1\|WP_071625448.1\|1958855_1959683_+\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|236467
NZ_CP054052.1\|WP_071625442.1\|1964802_1965477_-\|chemotaxis-protein-CheD	unknown	unknown	gnl\|CDD\|319352
NZ_CP054052.1\|WP_071625437.1\|1971233_1971887_-\|ABC-transporter	unknown	unknown	gnl\|CDD\|224837
NZ_CP054052.1\|WP_071625449.1\|1957715_1958783_+\|coproporphyrinogen-III-oxidase-family-protein	unknown	unknown	gnl\|CDD\|181428
NZ_CP054052.1\|WP_071625432.1\|1976552_1978124_-\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NZ_CP054052.1\|WP_071625441.1\|1965473_1966319_-\|protein-glutamate-O-methyltransferase-CheR	unknown	unknown	gnl\|CDD\|224271
NZ_CP054052.1\|WP_071625436.1\|1971886_1973980_-\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|224369
NZ_CP054052.1\|WP_071625445.1\|1962255_1962534_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054052.1\|WP_071625438.1\|1969047_1971225_-\|polyribonucleotide-nucleotidyltransferase	unknown	unknown	gnl\|CDD\|236995
NZ_CP054052.1\|WP_071625446.1\|1961713_1962244_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224117
NZ_CP054052.1\|WP_071625434.1\|1974414_1975680_-\|phosphoribosylamine--glycine-ligase	unknown	unknown	gnl\|CDD\|234856

Protein	Function_ID	Function_description	E-value
NZ_CP054052.1\|WP_071625450.1\|1957162_1957660_-\|RNA-pyrophosphohydrolase	gnl\|CDD\|234820	PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed.	1.09788e-73
NZ_CP054052.1\|WP_071625431.1\|1978138_1979560_-\|ribosome-biogenesis-GTPase-Der	gnl\|CDD\|234628	PRK00093, PRK00093, GTP-binding protein Der; Reviewed.	0
NZ_CP054052.1\|WP_071625444.1\|1962635_1963688_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|376070	pfam18644, Phage_int_SAM_6, Phage integrase SAM-like domain. Xer recombinases are members of the tyrosine site-specific recombinase superfamily, a large group of enzymes that catalyze DNA breakage and rejoining using a conserved tyrosine nucleophile. Tyrosine recombinases promote various programmed DNA rearrangements including the monomerization of phage, plasmid and chromosome multimers, resolution of hairpin telomeres, and the movement of virulence and antibiotic resistance carrying integrative mobile genetic elements. Structural analysis of Helicobacter pylori XerH indicates that this N-terminal domain consisting of six alpha-helices contacts the DNA using a four-helix bundle.	6.4374e-59
NZ_CP054052.1\|WP_071625447.1\|1959695_1961663_+\|M3-family-metallopeptidase	gnl\|CDD\|341051	cd06456, M3A_DCP, Peptidase family M3, dipeptidyl carboxypeptidase (DCP). Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70). DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from Escherichia coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called peptidyl dipeptidase A). OpdA may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala. This family also includes Arabidopsis thaliana organellar oligopeptidase OOP (At5g65620), which plays a role in targeting peptide degradation in mitochondria and chloroplasts; it degrades peptide substrates that are between 8 to 23 amino acid residues, and shows a weak preference for hydrophobic residues (F/L) at the P1 position.	0
NZ_CP054052.1\|WP_071625433.1\|1975924_1976560_-\|uroporphyrinogen-III-synthase	gnl\|CDD\|235647	PRK05928, hemD, uroporphyrinogen-III synthase; Reviewed.	4.08366e-42
NZ_CP054052.1\|WP_071625439.1\|1968434_1968803_-\|response-regulator	gnl\|CDD\|381110	cd17562, REC_CheY4-like, phosphoacceptor receiver (REC) domain of chemotaxis response regulator CheY4 and similar CheY family proteins. CheY family chemotaxis response regulators (RRs) comprise about 17% of bacterial RRs and almost half of all RRs in archaea. This subfamily contains Vibrio cholerae CheY4 and similar CheY family RRs. CheY proteins control bacterial motility and participate in signaling phosphorelays and in protein-protein interactions. CheY RRs contain only the REC domain with no output/effector domain. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.28277e-60
NZ_CP054052.1\|WP_071625435.1\|1973972_1974410_-\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	3.70755e-16
NZ_CP054052.1\|WP_071625430.1\|1979650_1980193_-\|ribosome-associated-translation-inhibitor-RaiA	gnl\|CDD\|238308	cd00552, RaiA, RaiA ("ribosome-associated inhibitor A", also known as Protein Y (PY), YfiA, and SpotY, is a stress-response protein that binds the ribosomal subunit interface and arrests translation by interfering with aminoacyl-tRNA binding to the ribosomal A site. RaiA is also thought to counteract miscoding at the A site thus reducing translation errors. The RaiA fold structurally resembles the double-stranded RNA-binding domain (dsRBD).	3.19663e-18
NZ_CP054052.1\|WP_071625443.1\|1963704_1964778_-\|chemotaxis-specific-protein-glutamate-methyltransferase-CheB	gnl\|CDD\|234828	PRK00742, PRK00742, chemotaxis-specific protein-glutamate methyltransferase CheB.	1.6854e-127
NZ_CP054052.1\|WP_071625448.1\|1958855_1959683_+\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	gnl\|CDD\|236467	PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional.	9.09961e-89
NZ_CP054052.1\|WP_071625442.1\|1964802_1965477_-\|chemotaxis-protein-CheD	gnl\|CDD\|319352	cd16352, CheD, chemotaxis protein CheD stimulates methylation of methyl-accepting chemotaxis proteins. This family contains bacterial chemotaxis protein CheD that stimulates methylation of methyl-accepting chemotaxis proteins (MCPs). The CheD chemotaxis gene is not found in the Escherichia coli genome, but is present in many other organisms, including B. subtilis, where CheD appears to have two separate roles; it binds to chemoreceptors to activate them as part of the CheC/CheD/CheYp adaptation system, and it deamidates selected residues to activate chemoreceptors, enabling them to mediate amino acid chemotaxis. CheD has been shown to catalyze amide hydrolysis of specific glutaminyl side chains of the B. subtilis chemoreceptors McpA, McpB and McpC; deamination by CheD is required for the chemoreceptors to effectively transduce signals to the CheA kinase. CheD's ability to bind the receptors is controlled by CheC via a competitive binding mechanism; substituting Gln into the receptor motif of the signal-terminating phosphatase, CheC, turns the inhibitor into a receptor-modifying deamidase CheD substrate. Also, CheYp increases the affinity of CheD for CheC, controlling CheD binding to the receptors through its interactions with CheC. Thus, high levels of CheYp means CheC is a better binding target for CheD than the receptors, resulting in decreased CheA activity. The CheD structure reveals a distant homology with a class of bacterial toxins represented by the cytotoxic necrotizing factor 1 (CNF1) as well as a class of proteins of unknown function represented by B. subtilis YfiH. An invariant Cys-His pair forming a catalytic dyad is observed, and is required by the toxins for deamidation activity.	3.59376e-47
NZ_CP054052.1\|WP_071625437.1\|1971233_1971887_-\|ABC-transporter	gnl\|CDD\|224837	COG1926, COG1926, Predicted phosphoribosyltransferases [General function prediction only].	1.45533e-36
NZ_CP054052.1\|WP_071625449.1\|1957715_1958783_+\|coproporphyrinogen-III-oxidase-family-protein	gnl\|CDD\|181428	PRK08446, PRK08446, coproporphyrinogen III oxidase family protein.	0
NZ_CP054052.1\|WP_071625432.1\|1976552_1978124_-\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	2.19492e-127
NZ_CP054052.1\|WP_071625441.1\|1965473_1966319_-\|protein-glutamate-O-methyltransferase-CheR	gnl\|CDD\|224271	COG1352, CheR, Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms].	3.44939e-65
NZ_CP054052.1\|WP_071625436.1\|1971886_1973980_-\|LPS-assembly-protein-LptD	gnl\|CDD\|224369	COG1452, Imp, Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane].	1.07869e-49
NZ_CP054052.1\|WP_071625446.1\|1961713_1962244_+\|hypothetical-protein	gnl\|CDD\|224117	COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning].	0.00270973
NZ_CP054052.1\|WP_071625438.1\|1969047_1971225_-\|polyribonucleotide-nucleotidyltransferase	gnl\|CDD\|236995	PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional.	0
NZ_CP054052.1\|WP_071625434.1\|1974414_1975680_-\|phosphoribosylamine--glycine-ligase	gnl\|CDD\|234856	PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional.	0

>NZ_CP054052.1|WP_071625441.1|1965473_1966319_-|protein-glutamate-O-methyltransferase-CheR
MSYTTDDVHNRVKKILYSLTGITLAENKDIMISNRIDKLKRDAKYKGDIMDLLDLVESGSKVTEFINSFTTNKTHFFREDFHFLDLKNRVLPALAKEGKKVNMYCSASSTGEEPYSMAMTVLEAKEEIGKFIDSSIIATDIDTNVLQYAANGIYRFSKSSKEFPDWIKPQKYFKRRVQKNLVGEEVLIKVKDELKKPISFQVMNLNDKSYPFSKGQFDVIFCRNVLIYFSAEDQNEILKKLFSHLKMGGTLYLGHSENPHDLINYVNRVGQNIFVKEKEIS
>NZ_CP054052.1|WP_071625442.1|1964802_1965477_-|chemotaxis-protein-CheD
MIVIGHKDGSIERTSSVRFTQKTKGLFTHTVIGGEFAVGSDIEEIAFKTLLGSCVAIMFYDKVKKIKGMNHFLLPKTNNTNDDMKYGLYSVEAMLNEMYKLGCSKNNMIAKISGGADIMQLNVSAQSIGHRNVEFAKDFCQSEGFKLMSEHTRGEHGRLILLANAFETFIKVTQKTETDSKIASEESSLQKEITKAPVIKEYVGGVDLFGVEEKDEPEMEIELF
>NZ_CP054052.1|WP_071625443.1|1963704_1964778_-|chemotaxis-specific-protein-glutamate-methyltransferase-CheB
MYTVLVIDDSPSMRRVIKDMINSIDEFEVIAMAVDAYDAREKIKEYEPDIVTIDINMPKMDGVTFLRNLMRLHPMPAVVISGEGVRGNDIFDDGAVGFIPKPEVGESIASFSERIKDTLLNLTFLLKRYTLKKPKALKKPKNISTQIEYKVHPDEVIPSKPAIMPGSKVIAIGSSTGGVESLLKVFKKLPSGLPPIVITQHIPYGFSNSFAHRLNDNSEVNVHEAKDGEILERGCGYLAPGNMHLTIEKVGNTYKTKLLDTKKVSQHKPSVDVLFRSINNNVGSSAMGIMMTGMGDDGSIAMKEMFDNNAYTVAQNKESCVVFGMPMKAIQAGAIKDTIHLDDIAQYIIDFSKGKRR
>NZ_CP054052.1|WP_071625444.1|1962635_1963688_+|tyrosine-type-recombinase/integrase
MKYSLDCEETFTQTYMFWLSRFIRNKITTLSNRQVKDKDRLTQILHELSIGYKEIEELKSTVKEVRNIGINSIHVYFIPLGKLFKFMSNYGPKSMKEIDEELLSDFLATQTSKLSDATKKNYRIALVTFFNYIDKQNEETNGNTYRFGIELKNWGGLSGKSGQKLPSFMKKDEVQKFIQAIDSYEFSNKIAARNRLILKIILYTGIRVSEAINIHMKDFNKDEDAYIIQVRGKGNKPRVVMIKELIIGKDLNEWNEIKTCQNNLLLCNQKGNELTQAYISSIVEKILLSVGIRKEKNGAHMLRHTFATMLYQKSKDLILVQESLGHADINTSRIYTHFDKDKLKQTTDIF
>NZ_CP054052.1|WP_071625445.1|1962255_1962534_+|hypothetical-protein
MTILLNKNSLYNTFGVENFNSLENAVNGMAPSMVEYYLSDLSQYSEDTYLNKSQIEQSVYIGDYSLYIDYSDNVYLELDSEIVNNNETGSFW
>NZ_CP054052.1|WP_071625446.1|1961713_1962244_+|hypothetical-protein
MTNAETITKLNNALNTLIKAYEELQNDNEGLKARINELEDEVLDLESAKEDLELSKMDLESNLTELNDHTEKDNSNISSMLGKIESLLNTSDSEEKTSNNSSNNNVQNTHNNNHNNHQKKDDKLFEEKKIEKQEEGKEPNSFDNLSVKVEEKKEEDSNSNKIDLNRMASLLNGFNN
>NZ_CP054052.1|WP_071625447.1|1959695_1961663_+|M3-family-metallopeptidase
MFKEFNLENLEDSKNQLEQLLTSSRKETNNLLEIENKTYKNFVTPYQEIGESISDFVTPIFHIDSVKNSETTRKVHEECLPIISKYETEISQNDNIYRALKDIQSKEKSTLTFIQNKVLENEIRDFKLSGSHLDDNKKKRLEELNLTLSELSHKFSQNLLDATNAFEMIIDNEEDVKEIPASDLELAKFEEEGITKYKFSLQIPSYLAYITYGTSREKREELYKAYCTRAPENGKIIEEILTLKNEKVKILGFDSYSQYSIETKMAKTEDEVISFLEELGHKGKDKAKEELEEIKAIAKEDGVNDFRSSDMAYYSEKLKKAKYDLDEEYYRPYFEQESVLNGFFNFLDQIFDVKFTLANTPAWDEKVRVYDLSSKNKTIARIYIDLEARSDKRGGAWMNNWHSHFDKSNGETQLPTAYIVCNFPQSTDTTPSLLRHSDVVTLFHEMGHALHHLLSEVKEPYVSGIAGVAWDTVEFPSQFLEYFSYDKEVLKLFAKHYETGEVLDDAAINRIINAKNFQSSLAMVRQIEFALFDFKLYQKLYKTEDDVQELLDSVRQEFAAMTPPSYNKFQNGFSHIFAGGYSAGYYSYKWAEVLSADAFYMFIDSENIFNKKLALKYKAAVLAQGGSKNMDELFYEFAQREPSVDSLLKIDGIIS
>NZ_CP054052.1|WP_071625448.1|1958855_1959683_+|peptide-chain-release-factor-N(5)-glutamine-methyltransferase
MTIKETIKKYSARLKFVTHIPAKEVEILMLHLLEQNTIWLHLNYNNEFSLEKELEKLVKKRETNYPIEYIINKATFYGENFNVKDGVLIPRPETELLVDNALEIIKDLNKPVKVLEIGTGSGIISVMLALLIKDINIIAVDINEKALELAKSNAIKHNVEHKIDFRLSNLYENVNEEDIDMTISNPPYIADDYKLPDNVKYEPSNALFGGKIGDELLKDIIDQTNERNIEYLLCEMGYDQKKPLEEYFKNFETKDSSFYKDYEKFDRGFTLQLKK
>NZ_CP054052.1|WP_071625449.1|1957715_1958783_+|coproporphyrinogen-III-oxidase-family-protein
MLLYIHIPFCDSKCFYCAFNSYTDRFHLKSEYMKALKLQLKNELNDYVKKHNKKIETVFIGGGTPSTIKHHEYTEVFELIKPYLTHDAEITTEANPNSASFEWQENMNKLGVNRISFGVQSFHTEKLKFLGRSHNSKSAIKAIQNANRIGFNGINCDIIYGVQGDTLESMKEDFDTAFSLPITHLSAYSLTIEEGTKFFDRSSVKIDDEELSYEIFDYIKDAGFKQYEISNFAKNKEYESKHNYGYWQHKEYLGIGAGAVGYYNNQRRYPIKEIEEYIQNPMNIELENISIDDIKAEKILLGFRSSCGVEIELFSKEELEKVNDLIEYKKVYKENNRIFNNNFLLSDELALYILE
>NZ_CP054052.1|WP_071625450.1|1957162_1957660_-|RNA-pyrophosphohydrolase
MTDKNENITSNETKNYRPNVAAIVLSAKYPHTCEIFIASRTDVENAWQFPQGGIDEGESAKEALYRELEEEIGTRDVEIIAEYPKWVSYDFPPAIAKKMHPYDGQRQKYFLVKLKKGAKINIETEIPEFSEYKFVPTKNIYDYITFFKRTVYKQVLKYFRNEGYI
>NZ_CP054052.1|WP_071625439.1|1968434_1968803_-|response-regulator
MAKLLIVDDSTMLRDMLNYALNEGGYNDVTEAVDGVDGLAKAKAADFDLIITDVNMPNMDGLTLIGELRKVPQYSKKPILVLTTERSDEMKAKGKAAGATGWIVKPFVPDQLLKAVNIVLSR
>NZ_CP054052.1|WP_071625438.1|1969047_1971225_-|polyribonucleotide-nucleotidyltransferase
MSTVCEFELNEKQEIFEFGKVAKQANGSVLAKLGKAVVLATVVSEFDNPVSEDFTPLTVQYIEKTYAAAKLPGGFIKREAKPSEFETLTSRVIDRSLRPLFPKGYVYPTTITVLVLSADKDVDLQALALNAASAALYTSNLPIKKSVSGVRVGKINGEYVINPTTTELLDSTLDLYVAGTKDELLMIEMKSISSQELVEVDIEAFTKVHKANEVNESDLVEAIGVAQKALYEANTTYESGFETASVEKKDVELVEFKIEEEVINYVRDNFSADITEAIKKLAKSERATELKDVAKAISANEYCASNEIEFSTIYEAVSIIKRELVRAMIVNDKVRADGRGLRDVRPISIDTNILPSAHSSCLFTRGETQALVVGTIAGSKDGQMFEKLTEKSTSMDNFLLHYNFPGFSVGEAKPMFGVGRRELGHGNLGRKALESTIDNDYTETIRLVSEILESNGSSSMATVCGGSLALKAAGVPISDLVAGVAMGMVVEGDNYSVLTDIMGLEDHDGDMDFKVAGTKDGITALQMDIKLGGIELSVLEEALLQAKEGREHILGLMETAASEIIPSSALPLVEQFAIDPSKVMVVIGKAGSTIKEIIEKFSVAIDLDRNSGNVKVSGECKQSVLDACEHIKSISNNAPARKESRNVNFEDLYKVDEILTGKVERIVDFGAFVSLPKGGEGLLHISKISKQRVKNVSDVLNAGDDVEIKVLKVKRDRIELSSSSI
>NZ_CP054052.1|WP_071625437.1|1971233_1971887_-|ABC-transporter
MNSENNIYFKNREVAGYRLLDILPIDKMKLENWTVISSSYGGYEIAKIIANSLDAKVDIMFSDKIIAPQNDECEIAIVTEHEEVLIHEELVKSFDISLDYIYTKSKQVYEDSILSRVNSFRDGNKISQLEYKNVLIVDEGINTGLTMMACIKTAINLGAKSVSVATPILPSASIQTIESIADDLYYIKKLDHFIAINFYYDSLEDIEFEDIEKIKKG
>NZ_CP054052.1|WP_071625436.1|1971886_1973980_-|LPS-assembly-protein-LptD
MLKHIIAPLIIASSLSFAQEMNTEKFQLLAKSIDTKNDKVIASGDVVIFSNSYYISAKKIIYDKTNETFELFDDVLILKDNSIQTQSDYAFVDMKEDAYKQSPVFLIEKESNLWANSQKSSKEKTEIDLESSIISSCDCIDPAWSIRVSSATYNTENKWIHAYNPRLYIKNVPVFYSPYLGFPTDRRRRSGLLIPTMGYSNNDGFYYSQPIYFAPKANYDFEFIPQFRSKRGYGAFTHFRLADSQYSLLKLKTGFFEEKGEYQREFNLKNRKHYGWSIDYERTKLFSDNNTQDGLYASINWLNDIEYQTIEDKDNRTSSEKNVESKLNYFYNTPEYYGGLYARYYIDTEKDNNDETLQELPQLQFHSYNKEFLLDNLIYSADAKFINYTRSVGLNANIYELSLPISYTKYFADDYLYLNIENKTIVSKYEYTNSSKEFNNATLVQNVSSVSVGTDLIKPYESVLHTVNFNAKYSHPENITSDGDLYNITNNDSDLASFPFVQSKKNILLSFNQSLYNKTDLQQIINHKLSQSILYDENDNPELHDLENYIKYNYEFGSLTNKMIYNVQDKQFIENTSNISYSYKDVTIDLGYYKSKNTPNSNKENLESYRINTTYDISKDYTVGYYENYNLLDNIKNKQGFSFNVNDKCWNLDFKFEKEIIPSTSTNTNSVDQDVIYVNLILKPLGGLKQNYKVKGR
>NZ_CP054052.1|WP_071625435.1|1973972_1974410_-|RDD-family-protein
MQNNNEDLQLASMRSRAFAFVIDDLLVTFIVLVIFWENIVAAQDNIDAMMYLVKVDLVMPLIILKVVYQTFFVWYYGATVGKIITKIRVIDANSWDRVSLFSSFLRSGGRIFSEMFFYVGFLIGFFNDGRKTFHDITGKTLVVNA
>NZ_CP054052.1|WP_071625434.1|1974414_1975680_-|phosphoribosylamine--glycine-ligase
MNILILGSGGREYSIGLAIYKENAHNLFFMPGNGATSELGENININDYNELAQWAKDNSVDLTIVGPEAPLVDGVVDIFKENDLTIFGPSAAAAQLEGSKVYMKNILKKYNIPTAAFIETTNEKEAHDFIDTMNLPIVVKADGLCAGKGVIIAQSKDEAKEAASDMLSGESFGDAGTSIVVEEFLDGYELSIFAICDGENYKVLPAAQDHKRIGDGDTGPNTGGMGAYAPTPLVNDDIYKKVEERVIKPTLEGMKQEGAPFEGVLFIGVMVVNGEPIILEYNVRFGDPECEILMPLLETPVSELFYKGATRQLDKLDIKIKKEFGVGVVIASENYPYSSSKPAEIIVDKIVDEDLAANSHISYAGVASEDGKLMATGGRVLVCVGFGSSIKEARDRAYELCGQVHFAGKKCRSDIAYQALK
>NZ_CP054052.1|WP_071625433.1|1975924_1976560_-|uroporphyrinogen-III-synthase
MAKKIYLLNNLKYDGVENLEVFGIEYISSEIDINKYDALIFTSKNAIYAIDSFNKDWRDIDSYAIAPKTANVIQKYNGNLVFTGVSSHGDSFASELCPLLKDKKVLYVRASKTVSDLTQILKSDNIDIDELIAYKTSCKKVDKKLENNSIFVFTSPSSVQCFLKNYDWNESYLAVCIGETTAKYLPSEINYKISSKTSIEECIKVAQELQI
>NZ_CP054052.1|WP_071625432.1|1976552_1978124_-|SulP-family-inorganic-anion-transporter
MNSIKNNIFSGVTAAVVALPLALAFGVASGAGAIAGLYGAIILGFFASLFGGTHTQISGPTGPMTVITATAVAAFPHDLISVMSIIFLSGLIQISFGIVGIGKWIKYIPYPVISGFMSGVGVIIIILQINPFLGVEAYGSVIYTLSQLLETLKQADDSSLIIAYITLAIMFLTPKFITKIVPSALIALVVVTYFTMYMGYEIDTIGEIPMGLPEIIFPFSFDLLKLDTIITLAITLALLGSIDSLLTSLVADSMTKTKHNPKKELIAQGIGNSLCSFFGAIPGAGATMRTVININSGGTNKLSGIVHSLTLLVIVLFLAPLASKIPLAVLSGILIKVGFDILDYRFLKILKNVTRQDLLIMVTVFLLTIFVDLIMAVGVGITISSILAVYHVSRNTKIKTHRSKTSFDIDIENNHIEVIKIDGSLFFGTASVLDSKLEKVKENKILILDCKLVSFLDLSAIFTIEDLIEKMRSRNIETILVLKHAHKRHILKVDTKKTFKDIKIFHKIDDAINYTQEIELKYG
>NZ_CP054052.1|WP_071625431.1|1978138_1979560_-|ribosome-biogenesis-GTPase-Der
MSKELKKIALIGQPNVGKSSLFNRIAQKRIAIVSEQAGTTRDIRKHEVEVLDRKALMLDTGGIDETDDAIFSNVKRKAIETAKEADIILFMVDGKNIPDDKDKELFYELQALGKELALVVNKIDNDKELERLWEFFEFGISDEDLMGISVSHNRGTKNLFEWIYKHLPEVIEPEIETELADNGTDSLDDLLEDGESEEDNNNEIKVGIIGRVNVGKSSTLNAIIGQERSVVSPIAGTTIDPVDETYEYADKSVTFVDTAGLRRRGRIDGIEKFALMRTKEMLDKANVALVVLDASEPFTDLDEKIAGLVDEYGLGTIIVLNKWDENMDTFKKLEEEVRRRFRFLYYAPIIAISAKTGRSVDRLKEKIIEIHDNYTQRITTSALNKVIEQAVIRHALPSPNGNYLRIYYSTQFSTKPPKIALVMNKPRLLHFSYKRYLINFLRDKFNFEGTPIHLIARGKNDKMGDEEYLDEDN
>NZ_CP054052.1|WP_071625430.1|1979650_1980193_-|ribosome-associated-translation-inhibitor-RaiA
MNTSIVGRHIDLTEPIKDYINSSVEIFKKYNLDIISVNSIISQEEKHGKKAFSFEFTLNVAHLDTIVVKQKDKDLYSAVDIAVDRVSKVLRRHHDKITGHRATKLTEVEANVIEDQIAIELEKFEDEITPVRLNSYKPMDIEEALKELKASDSQFKVFYDKDDNMRVLYKSSDEGNFGLY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

444862 : 451899

Campylobacter_virus(33.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071626445.1\|444862_445861_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	3.6e-32	34.6
WP_071626444.1\|445984_446350_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_071626443.1\|446359_447301_-	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_071626442.1\|447376_448636_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_071626441.1\|448771_449002_-	acyl carrier protein	M4QDG5	Prochlorococcus_phage	1.6e-07	55.2
WP_071626440.1\|449096_449840_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	7.0e-17	32.0
WP_071626439.1\|449926_450691_-	7-carboxy-7-deazaguanine synthase QueE	D5GV09	Campylobacter_virus	2.0e-51	44.0
WP_071626438.1\|450683_451217_-	6-carboxytetrahydropterin synthase	H6SU72	Campylobacter_virus	2.8e-44	47.8
WP_071626437.1\|451218_451899_-	7-cyano-7-deazaguanine synthase QueC	R4TAI3	Halovirus	2.3e-30	33.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage