CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP053856	Rhizobium pusense strain 76 chromosome R76C1, complete sequence	0 crisprs	WYL,csa3,cas3,DEDDh	6
NZ_CP053857	Rhizobium pusense strain 76 chromosome R76C2, complete sequence	1 crisprs	csa3,DEDDh	0
NZ_CP053858	Rhizobium pusense strain 76 plasmid pR76, complete sequence	0 crisprs	csa3	45

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

596852 : 604227

Geobacillus_phage(33.33%)

capsid,portal,head,protease,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173614535.1\|596852_598019_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	6.0e-63	38.7
WP_003509186.1\|598207_598528_+	hypothetical protein	NA	NA	NA	NA
WP_045532421.1\|598556_599147_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	5.4e-28	43.4
WP_173614536.1\|599178_600447_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	2.5e-75	42.1
WP_035210200.1\|600617_601187_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_112766952.1\|601190_601532_+\|head	phage head closure protein	NA	NA	NA	NA
WP_004440751.1\|601528_601924_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_173614993.1\|601930_603130_-	MFS transporter	NA	NA	NA	NA
WP_006700098.1\|603625_603985_+	gene transfer agent family protein	NA	NA	NA	NA
WP_112766954.1\|603981_604227_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA

DBSCAN-SWA_2

982012 : 1032997

Pandoravirus(11.11%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004441483.1\|982012_982639_-\|protease	DUF922 domain-containing Zn-dependent protease	NA	NA	NA	NA
WP_173614596.1\|982817_983603_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	4.2e-20	33.3
WP_003502532.1\|983681_984047_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_173614597.1\|984051_984567_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_004441493.1\|984580_985141_-	hypothetical protein	NA	NA	NA	NA
WP_022556073.1\|985270_986350_-	TIGR01620 family protein	NA	NA	NA	NA
WP_022556074.1\|986346_987825_-	YcjX family protein	NA	NA	NA	NA
WP_022556075.1\|987952_988462_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_004441503.1\|988731_989151_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_173614598.1\|989255_990503_-	flagellar biosynthetic protein FliO	NA	NA	NA	NA
WP_006697576.1\|991162_993751_+	PAS domain-containing hybrid sensor histidine kinase/response regulator	W8CYM9	Bacillus_phage	2.3e-06	31.9
WP_003502541.1\|994035_994392_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	5.0e-13	41.0
WP_004441518.1\|994402_996910_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.2e-171	42.0
WP_112765767.1\|997075_997834_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_162719197.1\|997830_998175_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_173614599.1\|998230_999181_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_173614600.1\|999164_1000040_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_112765769.1\|1000149_1001001_+	urea carboxylase-associated family protein	NA	NA	NA	NA
WP_006697570.1\|1001185_1001617_-	HIT family protein	NA	NA	NA	NA
WP_113381077.1\|1001654_1002833_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_045534114.1\|1002829_1003570_-	glycerophosphodiester phosphodiesterase	M1HTS7	Paramecium_bursaria_Chlorella_virus	8.0e-13	26.6
WP_004441543.1\|1003566_1004037_-	RidA family protein	NA	NA	NA	NA
WP_004441545.1\|1004153_1004996_+	cell envelope integrity EipB family protein	NA	NA	NA	NA
WP_003502558.1\|1005188_1005956_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_004441554.1\|1006313_1007240_+	elongation factor Ts	NA	NA	NA	NA
WP_003502561.1\|1007337_1008060_+	UMP kinase	NA	NA	NA	NA
WP_004441558.1\|1008121_1008679_+	ribosome recycling factor	NA	NA	NA	NA
WP_004441561.1\|1008741_1009485_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	5.8e-19	40.5
WP_112765771.1\|1009484_1010318_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_162699329.1\|1010367_1011489_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_004441565.1\|1011688_1014013_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_173614601.1\|1014062_1015130_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_004441570.1\|1015122_1015590_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_006697564.1\|1015586_1016402_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_162699314.1\|1016405_1017272_+	UDP-2,3-diacylglucosamine diphosphatase LpxI	NA	NA	NA	NA
WP_045534118.1\|1017268_1018444_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_006697561.1\|1018573_1019863_-	citrate (Si)-synthase	NA	NA	NA	NA
WP_173614998.1\|1020170_1022600_+	ComEC/Rec2 family competence protein	NA	NA	NA	NA
WP_004441586.1\|1022619_1023297_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_045534120.1\|1023547_1024270_-	transcriptional repressor LexA	A0A1B2APZ3	Phage_Wrath	6.9e-09	35.5
WP_045534121.1\|1024586_1025060_+	RHS repeat-associated core domain-containing protein	NA	NA	NA	NA
WP_146175666.1\|1025150_1025729_+	hypothetical protein	NA	NA	NA	NA
WP_112765909.1\|1025886_1026630_+	hypothetical protein	NA	NA	NA	NA
WP_112765775.1\|1026601_1027036_+	HNH endonuclease	NA	NA	NA	NA
WP_173614602.1\|1027627_1028840_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.0e-65	48.8
WP_045535667.1\|1029461_1029908_+	hypothetical protein	NA	NA	NA	NA
WP_162699316.1\|1029913_1030165_+	hypothetical protein	NA	NA	NA	NA
WP_162750672.1\|1030148_1030286_-	hypothetical protein	NA	NA	NA	NA
WP_139786353.1\|1030564_1030774_-	hypothetical protein	NA	NA	NA	NA
WP_173614603.1\|1030862_1031144_-	RHS repeat-associated core domain-containing protein	NA	NA	NA	NA
WP_080823057.1\|1031196_1031538_-	hypothetical protein	NA	NA	NA	NA
WP_144115371.1\|1031897_1032997_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	8.8e-48	39.8

DBSCAN-SWA_3

1278064 : 1286321

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112765855.1\|1278064_1279597_+	AMP-binding protein	A0A2K9L3I8	Tupanvirus	8.2e-20	24.2
WP_162699325.1\|1279580_1280858_+	type III PLP-dependent enzyme	NA	NA	NA	NA
WP_048902825.1\|1280858_1282016_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.2e-42	43.1
WP_004442089.1\|1282207_1283338_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.1e-105	53.0
WP_022556255.1\|1283337_1284420_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_004442093.1\|1284682_1285192_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	6.5e-46	58.8
WP_004442095.1\|1285228_1285798_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.5e-47	53.8
WP_006698870.1\|1285826_1286321_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.5e-26	37.7

DBSCAN-SWA_4

1302697 : 1311096

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_037093448.1\|1302697_1304263_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	1.1e-11	30.4
WP_022556269.1\|1304608_1305262_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC37	Streptomyces_phage	1.0e-11	35.1
WP_004442133.1\|1305258_1306029_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.8e-23	29.8
WP_112765867.1\|1306202_1307486_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-97	45.8
WP_022556270.1\|1307587_1308391_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.4e-42	40.7
WP_173614678.1\|1308387_1309134_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003509722.1\|1309189_1309396_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	2.1e-08	69.8
WP_112765869.1\|1309526_1310261_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.4e-40	47.1
WP_173614679.1\|1310253_1311096_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.5e-34	36.1

DBSCAN-SWA_5

1399454 : 1423457

Morganella_phage(16.67%)

capsid,head,terminase,holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112766383.1\|1399454_1400180_-\|holin	phosphatidylcholine/phosphatidylserine synthase	NA	NA	NA	NA
WP_112766364.1\|1400389_1401598_+	UbiH/UbiF family hydroxylase	NA	NA	NA	NA
WP_035210762.1\|1401581_1402520_-	AEC family transporter	NA	NA	NA	NA
WP_173614696.1\|1402554_1403301_-	cytochrome c biogenesis protein CcdA	NA	NA	NA	NA
WP_173614697.1\|1404003_1405266_-	DUF882 domain-containing protein	NA	NA	NA	NA
WP_112766362.1\|1405424_1405865_-	VOC family protein	NA	NA	NA	NA
WP_004442353.1\|1406057_1406636_+	CspA family cold shock protein	A0A1W6JNX5	Morganella_phage	5.1e-07	42.4
WP_162699377.1\|1406635_1407118_+	DUF192 domain-containing protein	NA	NA	NA	NA
WP_003522642.1\|1407178_1407427_-	BON domain-containing protein	NA	NA	NA	NA
WP_004442357.1\|1407651_1407921_+	DUF982 domain-containing protein	NA	NA	NA	NA
WP_004442359.1\|1408132_1409275_+	glycosyltransferase	NA	NA	NA	NA
WP_112391641.1\|1409542_1409992_-	hypothetical protein	NA	NA	NA	NA
WP_173614698.1\|1409995_1411138_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_173614699.1\|1411170_1411632_+	hypothetical protein	NA	NA	NA	NA
WP_173614700.1\|1412347_1413100_-	hypothetical protein	NA	NA	NA	NA
WP_173614701.1\|1413144_1413576_-	hypothetical protein	NA	NA	NA	NA
WP_173614702.1\|1413800_1416506_-	D-alanyl-D-alanine carboxypeptidase family protein	A0A291AUM6	Sinorhizobium_phage	2.5e-59	47.3
WP_173614703.1\|1416516_1418136_-\|terminase	terminase large subunit	A0A023J2V1	Lactococcus_phage	4.0e-17	22.5
WP_173614704.1\|1418135_1418537_-\|terminase	phage terminase small subunit P27 family	A0A1B3B1V2	Gordonia_phage	2.9e-09	40.0
WP_173614705.1\|1418706_1419024_-\|head	phage head closure protein	NA	NA	NA	NA
WP_173614706.1\|1419020_1419452_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_173614707.1\|1419451_1419874_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_013636361.1\|1419863_1420166_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_173614708.1\|1420162_1420933_-	hypothetical protein	NA	NA	NA	NA
WP_173614709.1\|1420929_1421271_-	HNH endonuclease	Q38456	Bacillus_phage	3.2e-17	46.1
WP_173614710.1\|1421267_1421882_-	hypothetical protein	NA	NA	NA	NA
WP_173614711.1\|1421885_1423457_-\|capsid	phage major capsid protein	Q6DMU0	Streptococcus_phage	2.4e-35	31.7

DBSCAN-SWA_6

1905675 : 1975323

Aurantimonas_phage(19.35%)

tRNA,portal,terminase,holin,plate,integrase,tail

attL 1930181:1930226|attR 1975495:1975540

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112766639.1\|1905675_1906431_+\|tRNA	tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD	NA	NA	NA	NA
WP_162699408.1\|1906442_1910117_-	response regulator	A0A1V0SGX0	Hokovirus	2.5e-67	32.9
WP_004443127.1\|1910618_1912091_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.4e-54	33.6
WP_112556943.1\|1912325_1913234_-	EamA family transporter	NA	NA	NA	NA
WP_173614795.1\|1913398_1913788_-	DoxX family protein	NA	NA	NA	NA
WP_004443131.1\|1914027_1914645_-	L,D-transpeptidase	NA	NA	NA	NA
WP_006699592.1\|1914723_1915620_-	DMT family transporter	NA	NA	NA	NA
WP_022556767.1\|1916057_1917467_+	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_004443135.1\|1917470_1918412_+	alpha-E domain-containing protein	NA	NA	NA	NA
WP_112766642.1\|1918433_1919255_+	transglutaminase family protein	NA	NA	NA	NA
WP_112766643.1\|1919259_1919856_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_112766644.1\|1919972_1920431_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004443141.1\|1920486_1920903_+	VOC family protein	NA	NA	NA	NA
WP_112766645.1\|1920926_1921559_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_112766646.1\|1921759_1922755_-	GguC protein	NA	NA	NA	NA
WP_004443145.1\|1922874_1924071_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_022556773.1\|1924067_1925606_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.9e-18	28.0
WP_004443148.1\|1925696_1926761_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004443150.1\|1927015_1928020_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_112766648.1\|1928091_1928574_+	hypothetical protein	NA	NA	NA	NA
WP_006699583.1\|1928620_1928884_-	hypothetical protein	NA	NA	NA	NA
WP_112766649.1\|1929121_1929628_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
1930181:1930226	attL	NA	NA	NA	NA
WP_173614796.1\|1930317_1930800_+	hypothetical protein	NA	NA	NA	NA
WP_173614797.1\|1930879_1931629_-	DUF4145 domain-containing protein	Q7Y4L7	Streptococcus_phage	3.0e-23	40.5
WP_173614798.1\|1932147_1932867_-	hypothetical protein	NA	NA	NA	NA
WP_173614799.1\|1933052_1933313_+	hypothetical protein	NA	NA	NA	NA
WP_173614800.1\|1933299_1933932_+	hypothetical protein	NA	NA	NA	NA
WP_173614801.1\|1933931_1934408_+	hypothetical protein	NA	NA	NA	NA
WP_173614802.1\|1934549_1936013_-	hypothetical protein	NA	NA	NA	NA
WP_112951022.1\|1936072_1936339_-	DUF982 domain-containing protein	NA	NA	NA	NA
WP_003513730.1\|1936756_1937080_-\|holin	phage holin family protein	A0A291AUN9	Sinorhizobium_phage	2.3e-33	62.9
WP_173614803.1\|1937096_1937342_+	hypothetical protein	NA	NA	NA	NA
WP_173614804.1\|1937444_1938374_-	peptidoglycan-binding protein	A0A0M5M782	Salmonella_phage	1.2e-05	30.4
WP_173614805.1\|1938417_1939578_-	phage late control D family protein	A0A1X9SGQ9	Bradyrhizobium_phage	6.5e-09	24.9
WP_080841915.1\|1939580_1939793_-\|tail	tail protein X	A0A077K8R0	Ralstonia_phage	2.1e-11	53.2
WP_080810740.1\|1939797_1940262_-\|tail	phage tail protein	NA	NA	NA	NA
WP_173614806.1\|1940338_1940680_+	hypothetical protein	NA	NA	NA	NA
WP_173615011.1\|1940676_1942824_-\|tail	phage tail tape measure protein	A0A088FV68	Escherichia_phage	6.5e-55	36.0
WP_173614807.1\|1942948_1943218_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_080816010.1\|1943293_1943806_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	2.7e-15	31.6
WP_173614808.1\|1943818_1945282_-\|tail	phage tail sheath subtilisin-like domain-containing protein	Q9ZXK4	Pseudomonas_virus	1.8e-19	29.1
WP_173614809.1\|1945403_1945973_-	hypothetical protein	NA	NA	NA	NA
WP_173614810.1\|1945982_1947038_-	hypothetical protein	A0A0A8IK81	Aurantimonas_phage	5.3e-18	35.8
WP_173614811.1\|1947099_1947273_-	hypothetical protein	NA	NA	NA	NA
WP_173614812.1\|1947282_1949547_-	hypothetical protein	A0A0A8ILB4	Aurantimonas_phage	6.4e-303	69.4
WP_173614813.1\|1949559_1950225_-\|tail	phage tail protein I	A0A0A8IL57	Aurantimonas_phage	1.4e-77	64.1
WP_173615012.1\|1950221_1951163_-\|plate	baseplate J/gp47 family protein	A0A0A8IKZ9	Aurantimonas_phage	4.8e-87	55.4
WP_173614814.1\|1951171_1951549_-	GPW/gp25 family protein	K4I3Z7	Acidithiobacillus_phage	3.2e-18	49.0
WP_173614815.1\|1951499_1951697_-	hypothetical protein	NA	NA	NA	NA
WP_173614816.1\|1951706_1952258_-\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_173614817.1\|1952257_1953004_-	hypothetical protein	A0A0A8IKZ7	Aurantimonas_phage	1.3e-42	43.4
WP_173614818.1\|1953012_1953390_-	hypothetical protein	NA	NA	NA	NA
WP_112495633.1\|1953391_1953715_-	DUF2190 family protein	NA	NA	NA	NA
WP_173614819.1\|1953790_1955446_-	hypothetical protein	A0A2I7QSM3	Vibrio_phage	5.9e-32	31.2
WP_112154917.1\|1955544_1956195_-	hypothetical protein	B7SYD7	Stenotrophomonas_phage	4.9e-30	40.8
WP_173614820.1\|1956181_1957723_-\|portal	phage portal protein	B7SYD6	Stenotrophomonas_phage	2.3e-78	38.4
WP_112200667.1\|1957722_1957917_-	hypothetical protein	NA	NA	NA	NA
WP_173614821.1\|1957916_1959698_-\|terminase	phage terminase large subunit family protein	Q9JMP6	Wolbachia_phage	1.1e-71	29.5
WP_173614822.1\|1959612_1960425_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_173614823.1\|1960507_1961077_-	hypothetical protein	A0A0A8IL87	Aurantimonas_phage	7.3e-22	39.0
WP_173614824.1\|1961319_1962006_-	antitermination protein	NA	NA	NA	NA
WP_173615013.1\|1961995_1963264_-	helix-turn-helix domain-containing protein	A0A291AUK7	Sinorhizobium_phage	5.2e-20	29.1
WP_173614825.1\|1963263_1963557_-	hypothetical protein	A0A068C9G0	Rhizobium_phage	1.0e-19	50.0
WP_173615014.1\|1963553_1964135_-	hypothetical protein	A0A291AUS8	Sinorhizobium_phage	2.8e-29	38.1
WP_173614826.1\|1964823_1966206_-	SAM-dependent methyltransferase	A0A068C9F4	Rhizobium_phage	6.1e-123	62.9
WP_142841007.1\|1966205_1966457_-	hypothetical protein	NA	NA	NA	NA
WP_112967340.1\|1966453_1966951_-	hypothetical protein	R9TQJ7	Rhizobium_phage	3.6e-49	63.6
WP_173614827.1\|1967160_1967469_-	helix-turn-helix domain-containing protein	W6MWX8	Pseudomonas_phage	8.8e-06	55.4
WP_173614828.1\|1967467_1968163_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_173614829.1\|1969035_1969266_+	hypothetical protein	A0A2R3ZZ87	Microbacterium_phage	1.5e-05	46.7
WP_173614830.1\|1969326_1969509_+	hypothetical protein	NA	NA	NA	NA
WP_112200745.1\|1969539_1969872_+	hypothetical protein	A0A291AUR5	Sinorhizobium_phage	3.6e-37	74.3
WP_173614831.1\|1969931_1970837_+	DUF2303 family protein	A0A291AUR3	Sinorhizobium_phage	2.1e-108	62.9
WP_173614832.1\|1971166_1971904_-	DUF2290 domain-containing protein	NA	NA	NA	NA
WP_173614833.1\|1971900_1973997_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_173614834.1\|1974090_1975323_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1975495:1975540	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP053857

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053857_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053857_1

1664756-1664877

Orphan

Consensus_repeat	Method
TCGCTGTACGACTTGCTTTCATAGCTCCAGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053857_1

>merge|NZ_CP053857|1|1664756-1664877|CRISPRCasFinder
TCGCTGTACGACTTGCTTTCATAGCTCCAGTCGTAATCGGTCTTGATTTCGGTGCTGGTTTCGGTGCTCGTCTTGGTCGTCGTGTCGTTATCGCTGTACGACTTGCTGTCATAGCTCCAGTC

>NZ_CP053857|1|1|1664756-1664877|CRISPRCasFinder
TCGCTGTACGACTTGCTTTCATAGCTCCAGTC	GTAATCGGTCTTGATTTCGGTGCTGGTTTCGGTGCTCGTCTTGGTCGTCGTGTCGTTA
TCGCTGTACGACTTGCTGTCATAGCTCCAGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053857.1\|WP_173616036.1\|1667576_1668599_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187541
NZ_CP053857.1\|WP_173615845.1\|1654357_1655038_+\|sugar-transferase	unknown	unknown	gnl\|CDD\|274395
NZ_CP053857.1\|WP_006698570.1\|1671526_1672030_+\|DUF995-domain-containing-protein	unknown	unknown	gnl\|CDD\|336337
NZ_CP053857.1\|WP_173616038.1\|1674507_1675569_+\|cellulose-biosynthesis-protein-BcsN	unknown	unknown	gnl\|CDD\|374958
NZ_CP053857.1\|WP_173615850.1\|1661974_1663996_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053857.1\|WP_004438580.1\|1653191_1653740_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|182158
NZ_CP053857.1\|WP_004438642.1\|1675636_1677826_+\|UDP-forming-cellulose-synthase-catalytic-subunit	unknown	unknown	gnl\|CDD\|274400
NZ_CP053857.1\|WP_173615844.1\|1651710_1653045_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|181707
NZ_CP053857.1\|WP_173616037.1\|1673060_1674236_-\|AGE-family-epimerase/isomerase	unknown	unknown	gnl\|CDD\|225493
NZ_CP053857.1\|WP_107340100.1\|1650572_1651499_+\|homocysteine-S-methyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224951
NZ_CP053857.1\|WP_006698574.1\|1666836_1667184_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053857.1\|WP_022563661.1\|1672043_1673006_+\|protein-involved-in-cellulose-synthesis	unknown	unknown	gnl\|CDD\|226609
NZ_CP053857.1\|WP_173616035.1\|1666023_1666794_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP053857.1\|WP_173615849.1\|1659698_1661906_-\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|226969
NZ_CP053857.1\|WP_173615847.1\|1656486_1657755_+\|O-antigen-ligase-family-protein	unknown	unknown	gnl\|CDD\|225844
NZ_CP053857.1\|WP_173615848.1\|1658331_1659690_-\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP053857.1\|WP_004438593.1\|1657751_1658246_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053857.1\|WP_173615846.1\|1655222_1656479_+\|polysaccharide-biosynthesis/export-family-protein	unknown	unknown	gnl\|CDD\|224512
NZ_CP053857.1\|WP_173615851.1\|1669580_1671512_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133043
NZ_CP053857.1\|WP_006698572.1\|1668600_1669584_+\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|224012

Protein	Function_ID	Function_description	E-value
NZ_CP053857.1\|WP_173616036.1\|1667576_1668599_+\|SDR-family-oxidoreductase	gnl\|CDD\|187541	cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs. UGD catalyzes the formation of UDP-xylose from UDP-glucuronate; it is an extended-SDR, and has the characteristic glycine-rich NAD-binding pattern, TGXXGXXG, and active site tetrad. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP053857.1\|WP_173615845.1\|1654357_1655038_+\|sugar-transferase	gnl\|CDD\|274395	TIGR03022, WbaP_sugtrans, Undecaprenyl-phosphate galactose phosphotransferase, WbaP. The WbaP (formerly RfbP) protein has been characterized as the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. This model includes the enterobacterial enzymes, where the function is presumed to be identical to the S. typhimurium enzyme as well as a somewhat broader group which are likely to catalyze the same or highly similar reactions based on a phylogenetic tree-building analysis of the broader sugar transferase family. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. The most likely heterogeneity would be in the precise nature of the sugar molecule transferred.	1.70803e-97
NZ_CP053857.1\|WP_173616037.1\|1673060_1674236_-\|AGE-family-epimerase/isomerase	gnl\|CDD\|225493	COG2942, COG2942, N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism].	3.3016e-159
NZ_CP053857.1\|WP_173616038.1\|1674507_1675569_+\|cellulose-biosynthesis-protein-BcsN	gnl\|CDD\|374958	pfam17038, CBP_BcsN, Cellulose biosynthesis protein BcsN. This is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).	9.86732e-88
NZ_CP053857.1\|WP_006698570.1\|1671526_1672030_+\|DUF995-domain-containing-protein	gnl\|CDD\|336337	pfam06191, DUF995, Protein of unknown function (DUF995). Family of uncharacterized Proteobacteria proteins.	1.26399e-66
NZ_CP053857.1\|WP_004438580.1\|1653191_1653740_+\|cupin-domain-containing-protein	gnl\|CDD\|182158	PRK09943, PRK09943, HTH-type transcriptional regulator PuuR.	2.14578e-37
NZ_CP053857.1\|WP_004438642.1\|1675636_1677826_+\|UDP-forming-cellulose-synthase-catalytic-subunit	gnl\|CDD\|274400	TIGR03030, Cellulose_synthase_UDP-forming, cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.	0
NZ_CP053857.1\|WP_173615844.1\|1651710_1653045_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|181707	PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional.	0
NZ_CP053857.1\|WP_107340100.1\|1650572_1651499_+\|homocysteine-S-methyltransferase-family-protein	gnl\|CDD\|224951	COG2040, MHT1, Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) [Amino acid transport and metabolism].	6.83173e-100
NZ_CP053857.1\|WP_022563661.1\|1672043_1673006_+\|protein-involved-in-cellulose-synthesis	gnl\|CDD\|226609	COG4124, ManB, Beta-mannanase [Carbohydrate transport and metabolism].	2.43609e-133
NZ_CP053857.1\|WP_173616035.1\|1666023_1666794_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	5.03094e-39
NZ_CP053857.1\|WP_173615849.1\|1659698_1661906_-\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|226969	COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only].	0
NZ_CP053857.1\|WP_173615847.1\|1656486_1657755_+\|O-antigen-ligase-family-protein	gnl\|CDD\|225844	COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane].	2.02909e-44
NZ_CP053857.1\|WP_173615848.1\|1658331_1659690_-\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	1.95159e-133
NZ_CP053857.1\|WP_173615846.1\|1655222_1656479_+\|polysaccharide-biosynthesis/export-family-protein	gnl\|CDD\|224512	COG1596, Wza, Periplasmic protein involved in polysaccharide export, contains SLBB domain of b-grasp fold [Cell wall/membrane/envelope biogenesis].	1.05897e-34
NZ_CP053857.1\|WP_173615851.1\|1669580_1671512_+\|glycosyltransferase	gnl\|CDD\|133043	cd06421, CESA_CelA_like, CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.	7.37191e-69
NZ_CP053857.1\|WP_006698572.1\|1668600_1669584_+\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|224012	COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane].	0

>NZ_CP053857.1|WP_173615850.1|1661974_1663996_-|hypothetical-protein
MHIDKISDMIAHFIGLFDTMAEEARLRNNYSEGPARSGPEQLPEEEAARLLDKNYDVALQDYDPGVKYHAGYYDFDYLPPHFARTVEHDMQQFANSIPVDISAANFRFPGRLSFEDERELVIHTGPGSVVAHVAQVNILQDDDYLNMTDGPNVARDTSFVTERTVEFYNEASVFTPFSGFQRTDSYDALQALAKTAHDYIEHARDNDVTSLGTGADQDFVLAGNDINGLYINGVAAAEKPALDDYMPDRGIAKPPEEPERSDVALHEESPAGNSLDVAAGANVVANVATLVNTAVMTSVTAVMGDYHQIDAITQAYVYSDRDEIASVFTRSEDQVDTAAYNIANFERSVFPGAENTATESPETGEMPIFPTAWRVSVLEGDVSFVHWIEQYQFVSDNDTMMITTSGASVSLLTGGNAALNIANFLGIGMQYDLIIVGGNVLDMNLISQIAVLYDNDWARANPDAPGGATIQSGNNLLWNDASIYNVGSNDRFETMPDYMAQTVSAINERDPNMPDALAHDSNFAGYQGLNVLYITGNLYDVSIIKQVSVLGDSDDVTQAAAKVLENNENTDVHIDTGSNAVINLAQIIDYDSFGSTTYVAGGVYSDAILIQGGIIENDTSQPAQPGQLANEVIAFLHDDPATIENESDGVINAGHDLSWSNAHSSDVMQAVTA
>NZ_CP053857.1|WP_173615849.1|1659698_1661906_-|type-I-secretion-system-permease/ATPase
MDHISRRTIADGRSLDLPLDQDAEDSKLTDACISAINEAVENLRQLSGAEQIARATPPSPEVAPQPSPTTPQSGTLRDMPAGNPAPQQEPHPASRPAPKAKIDNAELKSAPDLPFVKTIDNNDGPIRENERRPATGGGGDGKEPTGNGGGGGGGGSSQSGFHKRSEPINFAASLAKGIAAVRRNMIVVMLFTVAINVLLLAIPLYLFQISDRVLTSRSMDTLVMLTVAVLGAVLLQAFMDAIRRFILMRTAVELEVQLGAPILSAAARASLHGSGKDYQILQDLQQLRSFLTSGTLIAFLDAPLMPLFIVVVYLVHPHLGIIIMVCCAVLFTIAWLNQRFTARQFSEASGYLSRANFHLDSMSRNSQIINALAMIPEAVKMWGRETAGSLKSHVAAQDRNIMFSGVSKAARMITQVALLGWGAHLSLSGELTGGMVIAASIVSGRALAPIEGAIEGWHQFNKSAASYGRIKQLLISSPLNFPRLRLPNPEGRLDVERILFVPPPQKKVILNGISFSLKKGESLAIIGNSGSGKTTLGKMLVGSILPTSGNVRLDLMDLRNWDQRQFGESIGYLPQDVQLFPGTIKANICRMRDDIEDRQIYEAAVLADVHELIAGFPQGYETVVAADGAPLSGGQKQRIALARAFFGDPKFVVLDEPNSNLDTQGEQALAKALLHAKRQGITTVTITQRPALLQCVDKIMVLKDGSVAMFGERMDVLKALSGNGRQASQSPQIEG
>NZ_CP053857.1|WP_173615848.1|1658331_1659690_-|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit
MFRKKNAIAEVKPQGQLEWYSEVPRSIRLHSSIGLAVLLASFGGFGYWAGTAPLSSAIIAQGSFVATGNNKVVQHLEGGIIKEMMVSEGDTVKAGDVLLTLDKTTALANERMLQLRRLRLETIVTRLRAEAQGAKSFKVPDIVMKEAGDPDINAIIQSQNIVFHSKLIKLEEQLNLIEKNIRSLEFRYAGYDGQKQSFDRQLALLTQERDSKERLAKDGVIRKTDMLALERAIADAMGDIARLSGEMNQSEAEIAKFKQEAIIAVNANKQAALDALETAESDLDSVREQVRGAAEVLERTVIRSPVNGTVVRAYYHTPGGVITTGKPIMEILPAHVPLILEAQVLRTSIDQLHEGQTAAIRLSALDRRTTPVLNGKVFYVSADSIEENAGLQVKDVYIVRVQVPDEEIAKVHNFHPVPGMPADVLIQTSERTFFEYLTKPIADSMSRAFKER
>NZ_CP053857.1|WP_004438593.1|1657751_1658246_-|hypothetical-protein
MAAMSDVLLLVGRLNYVWTNTESLMIYLIVHLLKVDKEAAIVVFLTLNTTRARMDLIERLAKLPSTDAKDRKTVLSIMARLKREAKTRNKYNHCIYSFDEKGDIASTQLMRLVEDDSQVRYGKVERMDEKEIGQLEKSIADIVEVSKDMWSFIHASPHVSADYL
>NZ_CP053857.1|WP_173615847.1|1656486_1657755_+|O-antigen-ligase-family-protein
MRIAKSALIDPERNEIYGMTAVALSFFVFAYSSRFGQVSVLAYYGMWLPLVAVDYRRVLGNYPRYLWIFAFGILTVLSSFWSEAVSVTMRASIQYLTHIVCALVAMRVISIRTLTRGALIGIGVVLLYSLLFGIYLFDALDGTYSFVGAFSSKNQLGFYASLGVIFAASSVLVLKQRGIWLPIAGVTGLLSAYSLIASQSATSAITTAAVVALIIGFIPIGMLSPANRKMMFFALGGLGALLAVASLQFGLLDAILGIFGKDSTLTGRTYLWQQGIEAAKQAPILGVGYQGFWVAGFADAERLWNDFFITGRSGFHFHNTYIETVVENGFVGMILLGMVLYGTLLGHLRSVLMRRSDPQGVILFAICALFVVRSFVEIDIIFPYQIGSFLLYFAAGKLCLPVKAARNGETHPAIGMRLQTRP
>NZ_CP053857.1|WP_173615846.1|1655222_1656479_+|polysaccharide-biosynthesis/export-family-protein
MNGFSAAHRPFVALVLAATVAFSAPLSTMAADGAQYKLGTADKLRIRVAEWQPADGSIRNWDVINGDYSVGPAGTLSLPFIGQLDVAGKTPSEVSDQIGAQLQSKFALRNLPSASVEIAQFRPIFLSGDVQTPGEYPYAPNITVLKAVSLAGGLRRSDAGQRFARDFINARGDAAVYDNQRARLLARQARLIAEVKGDQTITKTPEMEKIAEIDTLLASESALMKSRTERYTLQLKALTDLHALLQSEVESLKKKSETQNRQLQLANEDRDRVNRLNQQGLALSQRRISAEERAAEVESTLLDIDTQSLRAKQDINKATQDEINLRNDWVAQRSKELQDTEAELDKLNLQLTTSRELMSEALAQSAEAIRFDPSGKSATISYVVVREENGKPKELKVDENALLQPGDVIKVSSEILMQ
>NZ_CP053857.1|WP_173615845.1|1654357_1655038_+|sugar-transferase
MKSATQSAEQTLSSSEDFDVSFPIGGIAKRSFDMTSAALALLIFSPIFLLIAVLVKLSDPGPIFYGHRRVGHNGRYFHCLKFRTMAMNGDEILRQYLAANPEAAEEWRATRKLKNDPRVTAVGAVLRKLSLDELPQLINILRGEMSVVGPRPVVDEELSYYESAAAYYLSTRPGLTGLWQISGRNDVSYKARVAFDTQYVQNWSMRQDVFIIVKTIPAVCLSRGSY
>NZ_CP053857.1|WP_004438580.1|1653191_1653740_+|cupin-domain-containing-protein
MSVDIGGRLRHLRLRHNISQRELARRAGVTNSTISLIESNTSNPSVGALKRILDGIPIGLAEFFAFEPETSRKAFYRADELVEIGKGPISFRQVGENVFGRSLQILKECYQPGADTGKVPLVHDGEEGGIILSGRLEVTVDEERRVLGPGDAYYFESRRPHRFRCVGPVACEVISACTPPTF
>NZ_CP053857.1|WP_173615844.1|1651710_1653045_-|aspartate-aminotransferase-family-protein
MDNPSRSNSISLDSYWMPFTANRQFKANPRLLASAEGMYYTSNDGRQVLDGTAGLWCVNAGHGRQQIASAVKHQLSTMDYAPSFQMGHPVAFEFAERLAEIAPGPEGGKLDRVFYTGSGSESVDTALKIAIAYQRAIGQGTRSRLIGRERGYHGVGFGGISVGGLVNNRRVFPQIPADHLRHTHDLTKNSFVKGQPEHGAELADDLERLVALHGAETIAACIVEPVAGSTGVLVPPKGYLERLRAICDKHGILLIFDEVITGFGRMGSSFASNYFGVTPDIVTTAKGLTNGAIPMGAVFTTRKVHDALMHGPESQIELFHGYTYSGHPVACAAGIATLDIYRDEGLFTRASELQDAWHDAIHSLKGSPNVIDIRTIGFIAGIELQPRDGAIGARAYDVFVDCFERGLLIRVTGDIIALSPPLIAEKSHFDDIVSILGDALKRAE
>NZ_CP053857.1|WP_107340100.1|1650572_1651499_+|homocysteine-S-methyltransferase-family-protein
MSDIRILDGGMSRELQRLGAELKQPEWSALALINAPDIVRQVHAEFIEAGADVVTTNSYALVPFHIGEDRFNKEGASLIALSGRLAREAAEASKRNVTVAGSLPPIFGSYEPENFDPSRVQDYLKVLVENLQPHVDVWLGETLSLVAEGEAVRQAVAETGKPFWISFTLNDEPAQVNGAEPKLRSGETVRSAAEWAAGSGAAALLFNCSKPEVMRAAVETASAVFKEKGVALDIGVYANAFEGEQGDSAANEGLHGTRADLTDDVYSRFACSWADAGATLIGGCCGIGAAHIHTVADTLRRRGAGRTI
>NZ_CP053857.1|WP_173616035.1|1666023_1666794_+|response-regulator-transcription-factor
MFMGTSDYAAKQKNAVTHINGTLLIVADPDLFSECLMEALGKKFPTFSVVSVTSSATIDDDYGADVRLVLPYRLAGERLNSVLSAIREKHPEAPIALVVETIDKIEEPLKRLVGMRIIDGVLPLNLRLDVFMAAVDLLMKGGEHFPAALLSKLTPYSTAAGGKSVQNSAVIANRADALAESRSDMATLTTREVQILDLLCKGTQNKIIADRLHLSENTVKVHVRNIYKKMNVRNRTEAASRFFSKDEGATFSGWKN
>NZ_CP053857.1|WP_006698574.1|1666836_1667184_-|hypothetical-protein
MMNEMPYFRGGKTVRQCRLALVAGALLTFTFATASCSVVEDAVLTTASASPTTIKSRVTPAKAAYGYQKTGNAAVTLVADASDTPAVSRPSYSGSSPYICSPSGFGQKSRCFLRP
>NZ_CP053857.1|WP_173616036.1|1667576_1668599_+|SDR-family-oxidoreductase
MRNFVPNEHDNGVTIYSDWKPGQRVLVNGGAGFLGSHLCERLLSSGHEVICLDDLSTGRTANVEHLRNNKRFLMVEHDVRKPYDIDVSLIFNFASPASPPDYQRDPVGTLLTNVLGAVNVLEVARRCAATVVQSSTSEVYGDPHVNPQPETYFGNVNTIGPRACYDEGKRSAETLFFDYHRTFGVDIKVGRIFNTYGPRMRPDDGRVVSNFIVQALKGDDITIYGDGSQTRSFCYVDDLIDGFLRFSAKPKDCIGPINLGNPAEIPVRQLADIVIRMTGSRSRIVHLPAAIDDPQQRRPDISRANELLKWQPRVPLEIGLERTIVYFDALLTGRKVAEAV
>NZ_CP053857.1|WP_006698572.1|1668600_1669584_+|UDP-glucose-4-epimerase-GalE
MPRTILVTGGAGFIGSHICKALAQSGFKPIAYDNLSTGHADSVRWGPFIEGDILDRGLLKATLQEFSPAFVIHCAANAYVGESVEDPRKYYRNNVGGSLSLLDACLDQNIGGLVFSSSCATYGVPPQLPIREETAQTPVNPYGRTKLIFEMALDDYAAAYGLRFVALRYFNAAGADPDGELCERHEPETHLIPRALMAAAARLPQLDVFGADYDTSDGTCIRDYIHVSDLADAHVAAVNYLADGGETLRVNLGSGHGTSVGDIIRAIHRVTGQEVPVHFGARRAGDPPALFADIERARQTLGFAPRRSDIDTIIRTAGPGFGLEVLS
>NZ_CP053857.1|WP_173615851.1|1669580_1671512_+|glycosyltransferase
MTMRSTPSVASPRAAAGVLRMLPVFTGWNRLAYLLGIGGWLVTLAYFWIWWLDRDRVIDWPYYFVVTLTLAWITLLPSYFIFIFLNARVVDRRSPLPRGRVAMVVTKAPSEPFAVVEKTLLAMLEQKGLEFDVWLADEAPDAETLRWCGAHGVFVSTRQGIAEYHRKTWPRRTRCKEGNLAYFYDRFGYERYDFVAQFDADHVPEPDYLSEVIRPFADPRIGYVSAPSICDANANESWAARGRLYAEASLHGALQLGYNNGWAPLCIGSHYAVRTKALREVGGLGPELAEDHSTTLLMNAGGWRGVHAVNAIAHGDGPVTFADLIVQEFQWSRSLMTILLQYSRHYVPKLPARLKFQFLFSQLWYLLFSGFMALMFVLPAVALVRGHVLVNASYPAFLAHFLPVSLIMIVFAFFWRATGAFRPHDAKLFSWEAMVFLFLRWPWSLMGVLAAIRDTIRGDFVDFRITPKGTQAKPPLPLRVVAPYMVLAALSLLAMVFAPRQNGAEGFFIFAAINVAIYAGLSVFLLIRHAVENGLPKLPALRGGASAAACSLLLVAGSAAELSSHAIGGLEALSHGQPYISFTETRFTVAGAGAEGARSVRLKLRIALPGLRGPQEMQAEPIVAPPPAVATGEIMLADNRVGQ
>NZ_CP053857.1|WP_006698570.1|1671526_1672030_+|DUF995-domain-containing-protein
MKTTISTCGFSAFVLCLAVVAPSVVHAAGGTKTPKPLRTSEVVEMYFDKTWKWDTGGGRFIADGRKFIAATEEKGKKSIGEGRWTVDANGTLCMRATWKAEAGSGKANTCFDHGRIGNVLYQRKQGGQWYVFRHNPPRPGDEFLKLVRKDDVTPQIAAYDKAMTATR
>NZ_CP053857.1|WP_022563661.1|1672043_1673006_+|protein-involved-in-cellulose-synthesis
MQITRRTLLFASGAAAAFTAGMYPVLKLDAQGVAPMTSTGMKTLADKRPTLHADGIRFGAYDPHGDFTGQSGVATEHLFLPWEDVDLDSLALADAYALERKRNVMITVEPWSWDVNWRLSSDELRRKVLSGDYDKNMQAIAARMSAMKSPLILRWGQEMEDTTGRFSWSGWNPRDYITAYKRVVDMTRKAVPGVKVMWSPKGLDGLRAYYPGDNYADLVGLSVFGLEDYDKIEYGAPKTFTDLLRKGYGLVETFDKPVWVAELGYEGSDSYVRPWMNDVTLKQADFPKLEEVVYFNDKDVHPWPHNLGRPDWRVVRPAKV
>NZ_CP053857.1|WP_173616037.1|1673060_1674236_-|AGE-family-epimerase/isomerase
MQFPSIAQTLAEEIGTLRKWLDEDALPLWWEAGSARPDGGFYERLGQDAKPVFSDDRRARVQPRQAYCYAAAGQHGWHGPWKDAVLRGLSWFEKVYRLENGLYGNLADQTGRLIDPSFDLYNQAFALFAAAQTAAVLPDRKDEMRSRALEILAILERDYRHSIAGFEEANPPRTPLCSNPHMHLFEAMLAWEEQDRDGPWSALADEIAGLALSRFIDGGNGGLREFFDHDWTPYKGEKGRIMEPGHQFEWAWLLVRWGSLRGNDEAIRKAKRLFEIGEDHGICPRRKVAVMSLYDDFSVRDGLARLWPQTEWLKAAVRLASVTDGEERQRYLASGLSAIGALQPFLDTPVKGLWFDKWPADRPMLDEPAPASTFYHIVCAIYEAEAVLAAG
>NZ_CP053857.1|WP_173616038.1|1674507_1675569_+|cellulose-biosynthesis-protein-BcsN
MVWSLVIRFPFNLGGVGEKKGRRAVKFSAYTSLLFSIAVLSGCNTPAGVRSFGGTQLLSPSEALIFPPPGGPEIVTVVSRTYSNAVAQQVILRSEAATPGQNYLKAEFFGPQQAGDTDFDSLAFTGFRASSLAREIRAEFPGETIAMSANYLQNSYGAFSYAAGKGRGEDTCLYGWQDIRSPESMRQDFRNLGRIKVRLRLCQSGASVERLLAVMYNYTITGTYASPSWNPYGTPQAVDKNLGRPGNPVYPIKSEEVPMRPGGEVTASVPVRPVRRAAATAPVQPEQQPLPPVAAVNIPSPVSAGASGQPAVTAPRAAGGGAVTGQQQSSRVPQVSIPSPSCLSGSGAGQGCR
>NZ_CP053857.1|WP_004438642.1|1675636_1677826_+|UDP-forming-cellulose-synthase-catalytic-subunit
MNKAITIIVWLLVSLCVLAIITMPVSLQTHLVATAISLILLATIKGFNGQGVWRLVALGFGTAIVLRYVYWRTTSTLPPVNQLENFIPGFLLYLAEMYSVVMLALSLVIVSMPLPSRKTRPGSPTYRPTVDVFVPSYNEDAELLANTLAAAKNMDYPADRFTVWLLDDGGSVQKRNAANIVEAQAAQRRHEELKKLCEDLDVRYLTRERNVHAKAGNLNNGLAHSTGELVTVFDADHAPARDFLLETVGYFEEDPRLFLVQTPHFFVNPDPIERNLRTFETMPSENEMFYGIIQRGLDKWNGAFFCGSAAVLRREALQDTEGFSGVSITEDCETALALHSRGWNSIYVDKPLIAGLQPATFASFIGQRSRWAQGMMQILIFRQPLFKRGLTFTQRLCYMSSTLFWLFPFPRTIFLFAPLFYLFFDLQIFVASGGEFLAYTAAYMLVNLMMQNYLYGSFRWPWISELYEYVQTVHLLPAVVSVIFNPGKPTFKVTAKDESIAEARLSEISRPFFVIFGLLVVAMIFAVWRIYSEPYKADVTLVVGGWNLLNLIFAGCALGVVSERGDKSASRRITVKRRCEVKLEGSDTWVPASIDNVSVHGLLINLFDNATTVEKGETAIVRVKPHSEGVPETMPLNIVRTVRGEGFISIGCTFSPQRAVDHRLIADLIFANSEQWSEFQRVRRRNPGLIRGTATFLAISLFQTQRGLFYLARALRPGSKAVKPAGAVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP053858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2246

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616055.1\|1220_2246_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	9.7e-33	33.9

DBSCAN-SWA_2

12207 : 15352

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022557053.1\|12207_12933_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.1e-86	72.5
WP_173616062.1\|12907_13330_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	6.3e-47	65.0
WP_173616063.1\|13335_14376_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_173616064.1\|14821_15352_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	6.3e-28	43.3

DBSCAN-SWA_3

20328 : 20622

Moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173402666.1\|20328_20622_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PC92	Moumouvirus	5.6e-10	54.5

DBSCAN-SWA_4

25711 : 26902

Burkholderia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616069.1\|25711_26902_+	DNA cytosine methyltransferase	I6NLI4	Burkholderia_phage	2.3e-94	46.9

DBSCAN-SWA_5

31577 : 37855

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616072.1\|31577_37385_+	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	1.3e-09	42.5
WP_173616073.1\|37435_37855_+	DNA mismatch endonuclease Vsr	I6NSG0	Burkholderia_phage	2.8e-39	59.5

DBSCAN-SWA_6

48796 : 49549

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616082.1\|48796_49549_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	6.0e-16	33.2

DBSCAN-SWA_7

54699 : 58833

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616087.1\|54699_55509_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-16	30.7
WP_173616088.1\|55567_56128_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_173616089.1\|56172_56589_+	hypothetical protein	NA	NA	NA	NA
WP_173616090.1\|56691_57588_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_173616091.1\|57626_58040_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_173616092.1\|58083_58833_-	glucose 1-dehydrogenase	F2NZ40	Diadromus_pulchellus_ascovirus	4.6e-16	31.7

DBSCAN-SWA_8

68322 : 74859

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616096.1\|68322_71508_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.6e-65	22.1
WP_173616383.1\|71504_72641_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_111791589.1\|72883_73069_+	hypothetical protein	NA	NA	NA	NA
WP_045534727.1\|73173_74859_+	FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	6.5e-26	28.8

DBSCAN-SWA_9

82809 : 87827

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045534743.1\|82809_83259_+	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	4.3e-09	33.1
WP_111791593.1\|83300_83609_+	XdhC family protein	NA	NA	NA	NA
WP_045534795.1\|83608_84331_+	XdhC family protein	NA	NA	NA	NA
WP_082074493.1\|84339_85365_+	molybdopterin-binding protein	NA	NA	NA	NA
WP_173616098.1\|85420_86257_-	alpha/beta hydrolase	A0A1L7N183	Ralstonia_phage	9.1e-05	43.8
WP_045534749.1\|86435_87827_+	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-66	33.8

DBSCAN-SWA_10

102001 : 102991

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113207740.1\|102001_102991_-	alpha/beta hydrolase	A0A249XU20	Mycobacterium_phage	5.9e-11	26.5

DBSCAN-SWA_11

117811 : 120787

Salmonella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616106.1\|117811_120787_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	3.6e-189	37.6

DBSCAN-SWA_12

124044 : 124893

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616109.1\|124044_124893_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	7.4e-55	40.7

DBSCAN-SWA_13

136512 : 141864

Planktothrix_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616119.1\|136512_137256_+	urea ABC transporter ATP-binding protein UrtD	G9BWD6	Planktothrix_phage	1.5e-14	28.1
WP_173616386.1\|137258_137954_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	1.5e-13	25.2
WP_173616387.1\|137972_138953_+	acetamidase/formamidase family protein	NA	NA	NA	NA
WP_173616120.1\|139535_140348_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	8.2e-35	35.1
WP_173616388.1\|140337_141864_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.2e-18	25.3

DBSCAN-SWA_14

148184 : 151374

Pithovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616125.1\|148184_148940_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	6.7e-07	29.7
WP_173616126.1\|148933_149635_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.9e-14	26.6
WP_173616127.1\|149621_150428_+	aspartate dehydrogenase	NA	NA	NA	NA
WP_173616391.1\|150489_151374_+	alpha/beta hydrolase	A0A088FQA2	Mycobacterium_phage	4.6e-07	35.5

DBSCAN-SWA_15

155912 : 169128

Stx2-converting_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010009780.1\|155912_156263_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	3.5e-27	53.3
WP_173616131.1\|156322_157960_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.2e-103	44.3
WP_173616051.1\|157991_158129_-	hypothetical protein	NA	NA	NA	NA
WP_173616132.1\|159184_160792_-	ATP-dependent acyl-CoA ligase	A0A2K9KZV5	Tupanvirus	3.8e-07	24.3
WP_173616133.1\|160978_161455_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_173616393.1\|161568_162360_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.6e-51	44.5
WP_173616134.1\|162552_163377_-	ABC transporter permease	NA	NA	NA	NA
WP_173616394.1\|163373_164171_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-27	36.6
WP_173616135.1\|164716_165664_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_173616136.1\|165740_166652_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	7.3e-08	30.9
WP_173616137.1\|166846_167581_+	hypothetical protein	NA	NA	NA	NA
WP_173616138.1\|168025_169128_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.9e-10	29.5

DBSCAN-SWA_16

175295 : 176942

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616145.1\|175295_176942_+	thiamine pyrophosphate-binding protein	E5EQ70	Micromonas_sp._RCC1109_virus	1.2e-21	22.9

DBSCAN-SWA_17

192556 : 200687

Trichoplusia_ni_ascovirus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616161.1\|192556_193543_+	alpha/beta hydrolase	M1PGN2	Moumouvirus	8.5e-10	22.9
WP_173616162.1\|193587_194397_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.1e-13	29.2
WP_173616163.1\|194443_194830_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_173616396.1\|194980_195514_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_173616164.1\|195592_197011_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	1.9e-42	33.2
WP_173616165.1\|197099_197855_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-17	36.7
WP_173616166.1\|198114_198804_+	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_173616167.1\|198854_199781_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_173616168.1\|199859_200687_+	oxidoreductase	I7B2R4	Escherichia_phage	8.7e-08	27.2

DBSCAN-SWA_18

207006 : 207855

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616175.1\|207006_207855_+	alpha/beta hydrolase	A0A2K9KZN8	Tupanvirus	2.9e-06	35.4

DBSCAN-SWA_19

211221 : 213134

Pandoravirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616400.1\|211221_211605_+	RidA family protein	S4W0G3	Pandoravirus	3.4e-07	32.7
WP_113344534.1\|211921_213134_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	6.0e-66	48.8

DBSCAN-SWA_20

216300 : 219266

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616180.1\|216300_217335_-	hydroxyacid dehydrogenase	M1H214	Paramecium_bursaria_Chlorella_virus	1.0e-13	30.7
WP_173616181.1\|217331_218501_-	SGNH/GDSL hydrolase family protein	A0A2H4P717	Pseudomonas_phage	3.5e-47	30.9
WP_173616182.1\|218516_219266_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.1e-15	31.0

DBSCAN-SWA_21

225091 : 228903

Bacillus_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616185.1\|225091_226207_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	1.8e-24	30.9
WP_173616186.1\|226241_226952_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_173616187.1\|227691_227817_-\|transposase	transposase	NA	NA	NA	NA
WP_173616188.1\|227889_228903_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.7e-16	27.8

DBSCAN-SWA_22

235458 : 238823

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616192.1\|235458_237171_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-16	30.3
WP_173616193.1\|237182_237968_+	hydroxypyruvate isomerase	NA	NA	NA	NA
WP_173616194.1\|237971_238823_+	2-hydroxy-3-oxopropionate reductase	A0A077SLF7	Escherichia_phage	4.7e-25	28.7

DBSCAN-SWA_23

242874 : 248172

Brochothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616196.1\|242874_243981_+	Fic family protein	D7RWK9	Brochothrix_phage	3.2e-05	28.0
WP_111818031.1\|244389_245602_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	7.9e-66	48.8
WP_173616197.1\|246546_248172_-	chaperonin GroEL	A0A219YK78	uncultured_virus	1.1e-174	61.2

DBSCAN-SWA_24

251600 : 253914

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616201.1\|251600_251810_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	4.7e-11	51.6
WP_173616404.1\|252852_253914_-	fatty acid desaturase	A0A1V0SAL5	Catovirus	7.2e-23	26.0

DBSCAN-SWA_25

268665 : 269079

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616215.1\|268665_269079_-	DUF1810 domain-containing protein	A0A2H4UVK5	Bodo_saltans_virus	1.3e-12	40.9

DBSCAN-SWA_26

273364 : 276513

Orpheovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616222.1\|273364_275032_+	FAD-dependent oxidoreductase	A0A2I2L5E1	Orpheovirus	1.2e-19	27.6
WP_173616223.1\|275532_276513_+	alpha/beta hydrolase	A0A286MQ79	Mycobacterium_phage	8.7e-15	30.0

DBSCAN-SWA_27

285818 : 286918

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144115371.1\|285818_286918_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	8.8e-48	39.8

DBSCAN-SWA_28

295834 : 296647

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616239.1\|295834_296647_-	MoxR family ATPase	R4TG24	Halovirus	1.3e-11	28.1

DBSCAN-SWA_29

303693 : 304671

Phage_TP(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616248.1\|303693_304671_+	U32 family peptidase	Q6DW11	Phage_TP	1.7e-18	34.7

DBSCAN-SWA_30

307937 : 308690

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616253.1\|307937_308690_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.1e-25	31.9

DBSCAN-SWA_31

317396 : 318173

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616261.1\|317396_318173_-	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	7.3e-41	39.3

DBSCAN-SWA_32

323327 : 332486

Streptomyces_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616266.1\|323327_326585_+	error-prone DNA polymerase	A0A0K1Y8T6	Streptomyces_phage	1.0e-88	26.4
WP_173616267.1\|326957_327368_-	hypothetical protein	NA	NA	NA	NA
WP_173616411.1\|327621_329748_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-14	34.0
WP_173616268.1\|330543_331326_-	MFS transporter	NA	NA	NA	NA
WP_173616269.1\|331430_331754_+	DUF736 family protein	NA	NA	NA	NA
WP_173616270.1\|331810_332143_+	hypothetical protein	NA	NA	NA	NA
WP_006699033.1\|332207_332486_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	2.6e-09	42.5

DBSCAN-SWA_33

336249 : 337407

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616412.1\|336249_337407_+	transglycosylase SLT domain-containing protein	I6ZXX9	Escherichia_phage	3.0e-06	34.6

DBSCAN-SWA_34

340586 : 341759

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616276.1\|340586_341759_+	transglycosylase SLT domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	5.7e-21	39.5

DBSCAN-SWA_35

356685 : 357432

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616290.1\|356685_357432_+	ParA family protein	Q8H9K9	Vibrio_phage	4.3e-06	26.4

DBSCAN-SWA_36

365782 : 367567

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616299.1\|365782_366667_+	helix-turn-helix transcriptional regulator	A0A291LAM3	Bordetella_phage	4.3e-13	29.8
WP_173616414.1\|366805_367567_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.5e-26	37.3

DBSCAN-SWA_37

375679 : 377167

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616309.1\|375679_377167_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	7.4e-167	64.9

DBSCAN-SWA_38

381578 : 390791

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006699024.1\|381578_381893_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	1.8e-22	56.4
WP_173616313.1\|381947_383573_+	chaperonin GroEL	A0A240F779	uncultured_virus	5.4e-179	61.1
WP_173616314.1\|385117_387334_+	bifunctional diguanylate cyclase/phosphodiesterase	A0A127AWB9	Bacillus_phage	2.8e-13	35.9
WP_173616315.1\|387696_388803_+	cache domain-containing protein	NA	NA	NA	NA
WP_173616316.1\|388817_390791_-	glycosyltransferase	M1I277	Paramecium_bursaria_Chlorella_virus	2.6e-26	29.5

DBSCAN-SWA_39

401282 : 402809

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616328.1\|401282_402809_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.0e-15	28.9

DBSCAN-SWA_40

410025 : 411087

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616334.1\|410025_411087_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	6.3e-27	31.9

DBSCAN-SWA_41

420761 : 421802

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616418.1\|420761_421802_+	alpha/beta hydrolase	A0A068F2G2	Mycobacterium_phage	1.9e-15	27.9

DBSCAN-SWA_42

427313 : 428063

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616346.1\|427313_428063_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.6e-23	34.0

DBSCAN-SWA_43

438262 : 438892

Bartonella_henselae_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616350.1\|438262_438892_-	porin family protein	O11861	Bartonella_henselae_phage	4.0e-05	34.8

DBSCAN-SWA_44

453875 : 456128

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173616361.1\|453875_456128_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.4e-22	23.2

DBSCAN-SWA_45

473682 : 473892

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034806062.1\|473682_473892_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.5e-09	50.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP053856

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP053857

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP053858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection