CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	0 crisprs	csa3	0
NZ_CP054262	Lactobacillus plantarum strain TCI507 plasmid unnamed3	0 crisprs	NA	0
NZ_CP054263	Lactobacillus plantarum strain TCI507 plasmid unnamed4	0 crisprs	NA	0
NZ_CP054259	Lactobacillus plantarum strain TCI507 chromosome, complete genome	2 crisprs	csa3,WYL,cas3,DEDDh,DinG	6
NZ_CP054260	Lactobacillus plantarum strain TCI507 plasmid unnamed1	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054259_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054259_1

1112628-1112743

Orphan

Consensus_repeat	Method
AGTGCAGTTCAACAGCTCTTTGCTGGTTCAAG	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP054259_1

>merge|NZ_CP054259|1|1112628-1112743|CRISPRCasFinder
AGTGCAGTTCAACAGCTCTTTGCTGGTTCAAGCAAAGTTACAAATGGCTTAGTAACATTGAATGGCCAAGTACCAGTTCTGGCAAGTGCAGTTCAACAACTCTTTGCTGGTTCAAG

>NZ_CP054259|1|1|1112628-1112743|CRISPRCasFinder
AGTGCAGTTCAACAGCTCTTTGCTGGTTCAAG	CAAAGTTACAAATGGCTTAGTAACATTGAATGGCCAAGTACCAGTTCTGGCA
AGTGCAGTTCAACAACTCTTTGCTGGTTCAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054259.1\|WP_003642181.1\|1108746_1109076_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP054259.1\|WP_173818884.1\|1100489_1101284_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319820
NZ_CP054259.1\|WP_054395872.1\|1118457_1120245_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP054259.1\|WP_173818891.1\|1115042_1116437_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP054259.1\|WP_011101966.1\|1103312_1104518_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP054259.1\|WP_173818893.1\|1120882_1121911_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_CP054259.1\|WP_033617510.1\|1109174_1109729_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP054259.1\|WP_173818886.1\|1105892_1106420_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP054259.1\|WP_011101955.1\|1122013_1122880_+\|DUF3737-family-protein	unknown	unknown	gnl\|CDD\|378875
NZ_CP054259.1\|WP_097037575.1\|1116706_1118458_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182732
NZ_CP054259.1\|WP_003642189.1\|1098477_1100403_+\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NZ_CP054259.1\|WP_027821793.1\|1124190_1124784_+\|NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224996
NZ_CP054259.1\|WP_003644851.1\|1114070_1114574_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054259.1\|WP_108910054.1\|1125610_1126150_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054259.1\|WP_027821792.1\|1122869_1124042_+\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|224090
NZ_CP054259.1\|WP_011101965.1\|1106682_1107228_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP054259.1\|WP_021356578.1\|1126556_1127240_-\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	unknown	unknown	gnl\|CDD\|162788
NZ_CP054259.1\|WP_015825877.1\|1104985_1105816_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|270702
NZ_CP054259.1\|WP_003644778.1\|1101596_1103219_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP054259.1\|WP_173818887.1\|1107304_1108249_+\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|214889

Protein	Function_ID	Function_description	E-value
NZ_CP054259.1\|WP_003642181.1\|1108746_1109076_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.32613e-13
NZ_CP054259.1\|WP_173818884.1\|1100489_1101284_+\|HAD-family-hydrolase	gnl\|CDD\|319820	cd07518, HAD_YbiV-Like, Escherichia coli YbiV sugar phosphatase/phosphotransferase and related proteins; belongs to the haloacid dehalogenase-like superfamily. Escherichia coli YbiV can act as both a sugar phosphatase and as a phosphotransferase. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.15679e-48
NZ_CP054259.1\|WP_054395872.1\|1118457_1120245_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.37063e-169
NZ_CP054259.1\|WP_173818891.1\|1115042_1116437_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.70127e-56
NZ_CP054259.1\|WP_011101966.1\|1103312_1104518_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.29809e-09
NZ_CP054259.1\|WP_173818893.1\|1120882_1121911_+\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	2.59712e-134
NZ_CP054259.1\|WP_033617510.1\|1109174_1109729_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.68761e-08
NZ_CP054259.1\|WP_173818886.1\|1105892_1106420_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.19972e-29
NZ_CP054259.1\|WP_011101955.1\|1122013_1122880_+\|DUF3737-family-protein	gnl\|CDD\|378875	pfam12541, DUF3737, Protein of unknown function (DUF3737). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 281 and 297 amino acids in length.	4.36824e-180
NZ_CP054259.1\|WP_097037575.1\|1116706_1118458_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182732	PRK10789, PRK10789, SmdA family multidrug ABC transporter permease/ATP-binding protein.	0
NZ_CP054259.1\|WP_003642189.1\|1098477_1100403_+\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	3.33333e-121
NZ_CP054259.1\|WP_027821793.1\|1124190_1124784_+\|NAD(P)-binding-domain-containing-protein	gnl\|CDD\|224996	COG2085, COG2085, Predicted dinucleotide-binding enzymes [General function prediction only].	1.72029e-34
NZ_CP054259.1\|WP_027821792.1\|1122869_1124042_+\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|224090	COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism].	5.00733e-145
NZ_CP054259.1\|WP_011101965.1\|1106682_1107228_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.46296e-18
NZ_CP054259.1\|WP_021356578.1\|1126556_1127240_-\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	gnl\|CDD\|162788	TIGR02254, hydrolase_haloacid_dehalogenase-like_family, noncanonical pyrimidine nucleotidase, YjjG family. This HAD superfamily includes including YjjG from E. coli and YfnB from B. subtilis. YjjG has been shown to act as a house-cleaning enzyme, cleaving nucleotides with non-canonical nucleotide bases. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).	6.30531e-49
NZ_CP054259.1\|WP_015825877.1\|1104985_1105816_+\|phosphotransferase	gnl\|CDD\|270702	cd05153, HomoserineK_II, Type II Homoserine Kinase. This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a Protein Kinase fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine. The Type II homoserine kinase subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	3.51122e-07
NZ_CP054259.1\|WP_003644778.1\|1101596_1103219_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP054259.1\|WP_173818887.1\|1107304_1108249_+\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|214889	smart00892, Endonuclease_NS, DNA/RNA non-specific endonuclease. A family of bacterial and eukaryotic endonucleases share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. An histidine has been shown to be essential for the activity of the Serratia marcescens nuclease. This residue is located in a conserved region which also contains an aspartic acid residue that could be implicated in the binding of the divalent ion.	4.96456e-24

>NZ_CP054259.1|WP_033617510.1|1109174_1109729_+|TetR/AcrR-family-transcriptional-regulator
MVISIRTELDLQRAMYQLLEQRSISQITVEQICKQAFIHRSSFYRYYTDKFDLLRQMVMHTLDELLAAERTNTVGSAIMSTFIGAHTQVLRHLLVTNNEGDNTRSQQVINDCFVTVAETGADDRVFAMIRQSQHPDLTAYLVSGVVTSIVQWLNNGHRDGQAASTQAMIQGTLATVFSLEQHTV
>NZ_CP054259.1|WP_003642181.1|1108746_1109076_+|winged-helix-turn-helix-transcriptional-regulator
MVSSEEALQEFRETIPIFEVLADERRQQIMIELSQHAQGMTVGELTERMHISQPAVSHQLKTLKERHFVAVEHQGTRNYYRVTFDAPLTQVEHLIHTLKADLELKPYLH
>NZ_CP054259.1|WP_173818887.1|1107304_1108249_+|DNA/RNA-non-specific-endonuclease
MVKLMRRVGIAGLLSLSLLLGGCSLLTSGTDTMSSTTSQQSESSRNQTTSATGNTQQTYKQLAKMTYQSGSAAAIKVNSGKSTLAASQWKNSKIDYGNLDSLNRTTTDTAYLSKANLGRSEGRTAQTWSPTGWHNQPITVNGKRVYPQNRGHLIAYTLSFNLTSNGQYRAGEDGSLDNPKNLATQTAYSNQKTMQIYEDQVRTALEQGKKVIYRVTTVFRGNELMPRGYWSQAVSTDGSVNFNVYIWNVEPGVSFDYATGRGKADSTMQVAGADKVSSSQNTSASRSSQSTTTSKQVERELVKYGYKYVKKALN
>NZ_CP054259.1|WP_011101965.1|1106682_1107228_+|GNAT-family-N-acetyltransferase
MTATITIRPLQRAELTMLWQLGFSDPNAEWTRWNGPYFHDQLPTQTDFETIIGPRDWLIRPRNWVITRDGVIVGSVNWHFVDGSLKRWLEVGIIIYNQEHWGEHIGRTALTKWLTHLFQEETTLPHIGLTTWSGNMRMMQLAEAVGLKQEAWIPQVRYWQGQYYDSVKYGILRNDWQVQKD
>NZ_CP054259.1|WP_173818886.1|1105892_1106420_+|GNAT-family-N-acetyltransferase
MTQFETERLILRPMTAADHDALADMIFDPQVVAYLRYRRVQSPAAFEQLFTTHFLADTTTVFGIERRRDHQLIGFYEFHGSGATGELTYALSPAAWGHGYVAEAGNCLMHYGFEMLNYETIEAHYASANPNSGRVMAKMGMQAAGELHTFTSDKGEVIHVMRYLLTKATWRQLSA
>NZ_CP054259.1|WP_015825877.1|1104985_1105816_+|phosphotransferase
MRTLHKTLTRLLQADLIPIAHVSFNEMYTGYSRRYDTVVFVKVFSPNHERKFRTEQQVTAQLTDRVLASFQLASREWVLVLRDWQLTPVPTTLTPALVYQMGQVVSRFHHAIQLPTTADLMPVLDFDGMAARVERLKTSPHYDALVSLLPYFLDHRTMIITALAPQPVMTLHGDMGTRNFRYHHGQLVLIDFERARHGYALEDCLKFFFEDLQQSATLIQAFWAGYGTDLQIPPLVTQWLLLQCSTGIFTYVNQITDPRFEAVGTAMLAQVTLPNH
>NZ_CP054259.1|WP_011101966.1|1103312_1104518_+|CPBP-family-intramembrane-metalloprotease
MTPETEQLLRRWYMGQLIVLFGAAFIQLFTFDGGVFFPVGGMQLLIWGLLAWWPAAEEDQAQWRRLRHVNYYVQTVLQFTLLPILLANLVAWLSQLSWLDEQGLIAVGMAYLMVAFVPVAVVVTKPIESVIGRIAVLITAIFSGVVSAQQTFLILPNLQAPSVFEMVSDTGILGALGFVIAVGVLLRGWGLTGPSWRFNRQAQTSLVVGLIVVGTAFSLWNAFSAGGSWATTFTHWDFQLRSATWKMFLSGLEPGIAEEWLYRFAVLTLLLQAFRHRRHQLDLAVWLSGGLFGMWHITNVFAGQPLSATVEQIIFAATLGWFLASTYLYSGSILLPMVIHAAIDILSMMASGSQTMVKPDAFEWQTIGATVIIFVGITIYFLTGSRRQVIQAHVNQRLSVQ
>NZ_CP054259.1|WP_003644778.1|1101596_1103219_+|ATP-binding-cassette-domain-containing-protein
MLTVNNVSMQFSTRKLYEDVNLKFTPGNCYGVIGANGAGKSTFLKILEGKLQPTTGTVSMGPNERMSSLNQNHFAFEDEEVLATVIRGHEKLYEIMTEKDALYAKPDFSDEDGIRAAELEGEFAEMDGWNAESEADQLLQNLGIDESMQHLKMSELTEPQKVKVLLGQALFGSPDVLLLDEPTNGLDVQSISWLEDFLAGYEKTVIVVSHDRHFLNQVCTHMCDVDFGKITLFVGNYDFWMESSQLAAKLQANANAKKADQIKELQEFVARFSANASKSKQATSRKKQLEKITLDDIKPSSRKYPFIKFTPDREIGNDLVKVENVSKSIEGVKILDNISFTLRPNEKTALISRNDLATTTLMQIIAGSMAPDSGTVTWGQTTSRTYLPKDINEEYAGSELPIIDWLRQFASKEESDNTFLRGFLGKMLFSGSDVERPVNVLSGGEKVRGMLSKMMLSRANVLLLDDPTNHLDLESITALNDSLIDFKGAIVFTSHDHEFIQTIADHIVEVSAKGVVDRGDTTYDEYLAHEATQGRVQDLY
>NZ_CP054259.1|WP_173818884.1|1100489_1101284_+|HAD-family-hydrolase
MTIKLIATDMDGTFLNDHGDYDQERFANDYAALQQRGIQFVIASGHQAAELATTFSAYPEMWLIGGNGAELWQREAGLKAATFSPQATQQVLAALAPYPELQVALCGTQTVHVLAHANPQFVANMRDYYYQLETCADLTTVTDPVVKFDVICPAAMTEQLVYELTPKLAGIAVPASGGQGSIDLIQPGMHKGRALKQLGEQLGILPDEMLVFGDGTNDLEMFHYATHAVAMQNAPENVQANATAVTGTNVDNGVLDYIEQHILS
>NZ_CP054259.1|WP_003642189.1|1098477_1100403_+|DUF2207-domain-containing-protein
MPKKAVAVSRAPRPGEYDKLGLTIIGGGDGEMSKKRRLSWLSVLGLLAGFCWWFSLAMRAAADYDIDQYQVNVAIQRDGSANVTQAMTYQFDDDYHGVFNVQDLKGIQGAQLEGVTTQLNGGTTVTAAPSETGANNTYQLTQNADRMRVKLYRQVQEDDKLRVVYRYRLKGVVTNYADTAELNWKVIGSGWDVPLNNVKIVIQLPAKNVSALQAWTHGPLSGQTKVERAAGRVTMTLGHNPANQFVESHLLFPTTVTATNTRTNTAKRKATVQKQEAKLAQEANEKRRRNQLLRRVIFGAAVAGWLLVMIGYLWWLARHPAKPHQQPIPINHSFDVPPVTPAVAESLWAQRSPNTDALTAEILRAAANQEITIETVAGHRKPDVRLTQLKPVTNSFLAHCFDKIAVDGQFMLTDLKKYGKRDKAGRLGKWFSRWQTEVDQDVAVYQDETNYRLRNQWLMAAVVVSVMGMIATGAGLLVSPKVVTLMVIPAVVAAVAFWIGWIIQRRRIAINTDAGLELRNQINGLRRMLKDIGHFNTAQVGDLILWEQILPYAAAFGLANQVTKQLAIDFGTEALATGMLVYYPLFYANGGLDFDLSGAINDSFSGALDASGSASSASGGSGGFSGGSSGGFGGGSGGGAF
>NZ_CP054259.1|WP_003644851.1|1114070_1114574_+|hypothetical-protein
MLRALSLSAVGLIVSIFFHVVNANSSTFTEQSVTTEQNVIYDKDGNQVPLFDASSQEPVIEDRGPKQPTAVKRLGKGQSCQVNKFSGSRIRYGRYMGGVTGNAKNVSFSEKKGAFTGYITDRPDLSTVAQYFTATPSGGPYHAAFHGLLYFEADNPVPGPNYFMQVH
>NZ_CP054259.1|WP_173818891.1|1115042_1116437_-|MFS-transporter
MSQPSTVTLKTKLAILSVGLLSFVGILVETSMNVTFPTLIKTMRVSLDTVQWLTTGYLLLTTIVMSTTAYVLKRFNPKPLFLFAALVCLLGGLLCWLAPNFPILLTGRLLQAVATGISIPLMFQLIFTYVPRNQLGTYTGLASVIVSLAPALGPTYGGILTSVWSWRAIFVGIVPLLALLAILGAFNISGKALGVGDKKFDYLGAILLAITFTSLLFTFNNAGTHGWLSPNFGLWCLWSIVMIGAMVTYAIKGRRQLIDYSILKLPILRLRLFNYFGLQFINIGLSFVLPLFAQTVLGASAMTAGLMMLPGAIVGAITGPIAGRIYDKQGPTTLLTFSAIMASAALLLFWLTTDYFTVIIMAVIYALLRVGFNTGFGTAISDGSTRVPLPQKSDQNSMFSMMQQYAGSIGTSIMSAVIAGYEIHHPTVTGTIMGSKLDFLLLFVLAIAILISVLHVKRLEIGQN
>NZ_CP054259.1|WP_097037575.1|1116706_1118458_+|ATP-binding-cassette-domain-containing-protein
MSIFLKLGWYFRREWKLYLAGVLGLVLTAIIGIVPPRIIGDVVDGINQHSLTAHTLTVYLVIIGVAAVGQYLARYLWRNAIWGGAAGLERTLRERLFWHFMKMDATFYQQYRTGDLMAHATNDLTAVERVAGGGILQFADSIITGGTTLIAMMTLIDWRLTLIAVVPFPLLAVVSRYLGKKIHVAFRASQAAFSRLNNKAQESISGIKVIKALGQEKADVADFNQQIDQTIKINRHVNVLDSLFDPAITMIIALSYGATIILGGLYVTHGVITIGNLVSFVTYLGMMVWPMFAVGMLFNTMERGNASYDRVMELLNQQSAIIDAKRGIEQRPHGDIQYQIKQFNYPNDAGTSLSNVNFTLKAGQTLGIVGRVGAGKSTIMKLILREFDQYEGHITYGGHDIKQYALDSYLPALGYVPQDSFLFSNTIRENIRFADPTVSQAVVEAVAAKSDLSGQIASMPAGYDTQVGEEGISLSGGQRQRLAIARALLINPELLILDDALSAVDAETEAEILANLKAERADKTTIIAAHRLSSVMNADEIIVLDAGHVVERGTHAQLMTQHGWYQKMFTRQQLETKVEGAVQ
>NZ_CP054259.1|WP_054395872.1|1118457_1120245_+|ABC-transporter-ATP-binding-protein
MAARQSVWARSMPVKEQLTVIRRLLPYAKPFKWFFIAAIVFSGLISVVNIYLPRVLQTFIDHYLKTGHATVPVMWYFAGLYFFGMVVRALMQFVQNFSSTMGAEYMLENVRRQMFAKLHRMGMRYFDQVPGGSILSRLTNDTMSFSNFWALFNTLFTAFFAVISSFVAMYLTDAQIALWLLVFMPFLAVTIWYYQRYSSRVYRRMRERLSELNTKLSEAITGISVIQQFRQEHRINGEFDHTNDAYFKTRQAMIRTNSLLLSPLIDLFYALGTVMVLGIFGVRGLNGYVAAGVVYAFITYLNNFYNPMTSMMDNLSDFQDGVVAGSRVLRVMDDPTIAPTQHADPTAKITRGKIEFRHVTFAYDGQHPVLKDVSFVAEPGQTVALVGQTGSGKTSTINVLMRFYEFQSGEVLIDDRDIREYPAEELRQKMGLVLQEPFMFYGDINSNIRMFNDQISDEQVQAAARFVKADDFINDLPENYQSRVIERGASYSSGQRQLISFARTIVTDPKILILDEATANVDTETEEMIQTGLDRIQENRTTIAIAHRLSTIQNADLILVLNQGQIVERGSNDELLQQHGYYYDMIQLQNSAHVD
>NZ_CP054259.1|WP_173818893.1|1120882_1121911_+|aldo/keto-reductase
MQYRQLGTSDLKVSSIALGCMGFGAGTGTALNQRSWAVGQTQANQVLDRAISLGINFFDTAPVYQAGASERVLGQGLKKFQRDQLVLATKFTNRTTQEIENHVSGREHVLRSLDQSLQNLQTDYVDLYIYHIWDWLTPMAEIMAGLNEAVQAGKVRYIGISNAYSWQIAQINALAVRYGYPQFVSIQSHYNLVYREDERELFSYAHENDFATTPYSPLASGRLAHPFGTQTTRRQQDTFADTKYQATSEMDQPIIDRVEELAHQHHVSMAAINLAWLQQRVTAPIIGATKPHHLDAVAEAAGLALTASEIQYLETPYRPHDLEGVMALNRSRTNNWNQYSGQ
>NZ_CP054259.1|WP_011101955.1|1122013_1122880_+|DUF3737-family-protein
MKTITQQYLTGERALFKAHDLEIDNTTFADGESPLKESRNVTLKQPIFKWKYPLWYSQHVTVDQGLFETMSRSGIWYTKDITITNSTLQAPKLFRRASQVKLAHVHFSDAEETLWNCQDITLNDVQAAGDYFGMNSQNIRIDGFNLVGNYAFDGAKNVEIHHATLMTKDALWNCENVTVYDSQIIGEYLGWNSKNIRFVNCTIESDQGLCYMDNVKLENCTLLNTDLAFEYCRNIDADVVSTIDSVKNPLSGRIHAQAIGEIIMDDPEVDPHQTLISVDHESRAPHAV
>NZ_CP054259.1|WP_027821792.1|1122869_1124042_+|pyridoxal-phosphate-dependent-aminotransferase
MPFDFETVLNRRHTNAVKWDVADNELPMWVADMDFETAPVIKQALIKRAQFGVFGYEEVPTAYYEAVADWWATEHNFRPQIEWLMFCTGVVPAISSIVRKMTATGDNVLVQAPVYNIFYHSIENNGRHTLSSDLVARDASYAIDWDDLTTKLADPLTTMMILCNPQNPIGIVWSRATLQRLGELCLKYHVLVVADEIHCDLTLNGHTYTPFSSLTAPVAHNSISCISPSKTFNVAALHAATLIIPDAHVRALVSRGINNDELAEPNSFAIPASIAAYTEGHDWVAVLRTKLAANQRQVQTYLTAELPQVKLVEAQATYLLWLDVSQVTTDSAALAAFIRQRTGLFLSAGDVYRGDGNRFLRLNVACPTTTLTDGLARLKAGITAYQQVQA
>NZ_CP054259.1|WP_027821793.1|1124190_1124784_+|NAD(P)-binding-domain-containing-protein
MEIGIIGAGTVGTVLAKTFARGDHQIKLSRHSGAASLATRRAEFAANVAFVEVAEALQQPLVILAVPFEQAPAVLAQVADYKQRIVVDVTNQFTADFKKIKTAPLTGSEVIARAANNARVIKAFNTIPPEFMDGHVDGPGKRVLFYAGDDVAAKKEFAALVRPLNFRPVNLGKLRHGGSVMQVGGGLGNTHFVQIEE
>NZ_CP054259.1|WP_108910054.1|1125610_1126150_+|hypothetical-protein
MSSYSNELLMLIFQSTLFKQVIILFAYGCLYYLVTHFIDKKIQHKKNFLLKLGLVKLKKRNKTRWEKIRLIMQLFLLASIPVLVFSELVLNTDYQYMLLVSSIMKCVGFISFVIAFVDSLGPIKEMQQLIAGAQSSDTLDSDKKALAVTSFKKIRWMLILYQVLKVPLLVILLTLSVDY
>NZ_CP054259.1|WP_021356578.1|1126556_1127240_-|noncanonical-pyrimidine-nucleotidase,-YjjG-family
MQYAIFDLDNTILDFDRAEAANLAAVFQHHGVTDIRRAENEYQAYNETVWQQIEQGADRDSLLDQRFQVFLGTLGITVDGPAVQQEYDQLLAHSYQVIPGAHELLRTLTNAGLTLLVGTNGIKHTQLSRLAGAHMTPYFDHIFISESIGYAKPNPHFFNAIHDQYPDMNATNTVMIGDSLRSDIAGAATVQLPSIWYNPQHAHNDTTIAPTYTVDNFKQLQKLLLTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054259_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054259_2

1151044-1151241

Orphan

Consensus_repeat	Method
GGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054259_2

>merge|NZ_CP054259|2|1151044-1151241|CRISPRCasFinder
GGTTACCGTTGTACTTTGACTAGCCGCACTTTTTACTGAACTAGCACTGGCTTGACTAGTACTGCTTTGGCTAGCGGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACTGGCTTGACTAGTACTACTTTGGCTAGTGGCCGACGTTGCACTCTGGCTCGTCGTACTAGTGACTGAACTAGCACT

>NZ_CP054259|2|2|1151044-1151241|CRISPRCasFinder
GGTTACCGTTGTACTTTGACTAGCCGCACTTTTTACTGAACTAGCACT	GGCTTGACTAGTACTGCTTTGGCTAGCGGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACTGGCTTGACTAGTACTACTTTGGCTAGT
GGCCGACGTTGCACTCTGGCTCGTCGTACTAGTGACTGAACTAGCACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054259.1\|WP_173818899.1\|1140487_1143079_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP054259.1\|WP_024002925.1\|1145200_1145599_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380361
NZ_CP054259.1\|WP_024002430.1\|1162195_1163383_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP054259.1\|WP_003642118.1\|1157502_1158513_+\|putative-sulfate-exporter-family-transporter	unknown	unknown	gnl\|CDD\|225411
NZ_CP054259.1\|WP_021355952.1\|1149390_1149564_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054259.1\|WP_003642120.1\|1154965_1156474_+\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP054259.1\|WP_003644753.1\|1161414_1162077_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319787
NZ_CP054259.1\|WP_003644754.1\|1158596_1159160_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP054259.1\|WP_024002927.1\|1148067_1148967_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226631
NZ_CP054259.1\|WP_003642121.1\|1153424_1154969_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP054259.1\|WP_003642119.1\|1156558_1157386_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP054259.1\|WP_003644758.1\|1145966_1146710_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP054259.1\|WP_003642129.1\|1145632_1145953_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|223672
NZ_CP054259.1\|WP_003644761.1\|1144593_1145028_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP054259.1\|WP_003644756.1\|1150007_1150508_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NZ_CP054259.1\|WP_003642127.1\|1146857_1148075_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224582
NZ_CP054259.1\|WP_173818903.1\|1159716_1161201_-\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP054259.1\|WP_024002923.1\|1143159_1144422_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NZ_CP054259.1\|WP_003642116.1\|1159219_1159720_-\|DUF4811-domain-containing-protein	unknown	unknown	gnl\|CDD\|374344
NZ_CP054259.1\|WP_173818901.1\|1152222_1153116_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP054259.1\|WP_173818899.1\|1140487_1143079_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.2848e-14
NZ_CP054259.1\|WP_024002925.1\|1145200_1145599_+\|cupin-domain-containing-protein	gnl\|CDD\|380361	cd02233, cupin_HNL-like, Granulicella tundricola hydroxynitrile lyase (GtHNL) and related proteins, cupin domain. This family includes archaeal, eukaryotic, and bacterial proteins homologous to hydroxynitrile lyase from Granulicella tundricola (GtHNL), a novel class of HNLs that does not show any sequence or structural similarity to any other HNL and does not contain conserved motifs typical of HNLs. HNLs comprise a diverse group of enzymes that vary in terms of their substrate specificity, enantioselectivity and the need for a co-factor. In plants, they catalyze the reversible cleavage of cyanohydrins, yielding HCN and aldehydes or ketones. Also included in this family is TM1010 from Thermotoga maritima, a protein of unknown function. Some but not all members of this family have N- or C-terminal carboxymuconolactone decarboxylase domains in addition to the cupin domain. Members of this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	3.15404e-50
NZ_CP054259.1\|WP_024002430.1\|1162195_1163383_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.87845e-67
NZ_CP054259.1\|WP_003642118.1\|1157502_1158513_+\|putative-sulfate-exporter-family-transporter	gnl\|CDD\|225411	COG2855, COG2855, Predicted membrane protein [Function unknown].	3.10527e-67
NZ_CP054259.1\|WP_003644753.1\|1161414_1162077_+\|HAD-family-hydrolase	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	5.30751e-60
NZ_CP054259.1\|WP_003644754.1\|1158596_1159160_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.10921e-26
NZ_CP054259.1\|WP_024002927.1\|1148067_1148967_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226631	COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only].	6.19952e-136
NZ_CP054259.1\|WP_003642121.1\|1153424_1154969_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.01133e-92
NZ_CP054259.1\|WP_003642119.1\|1156558_1157386_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.66516e-33
NZ_CP054259.1\|WP_003644758.1\|1145966_1146710_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	4.86242e-97
NZ_CP054259.1\|WP_003642129.1\|1145632_1145953_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|223672	COG0599, COG0599, Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown].	7.7214e-25
NZ_CP054259.1\|WP_003644761.1\|1144593_1145028_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.12096e-48
NZ_CP054259.1\|WP_003644756.1\|1150007_1150508_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	1.72955e-47
NZ_CP054259.1\|WP_003642127.1\|1146857_1148075_-\|ABC-transporter-permease	gnl\|CDD\|224582	COG1668, NatB, ABC-type Na+ efflux pump, permease component [Energy production and conversion / Inorganic ion transport and metabolism].	8.34886e-34
NZ_CP054259.1\|WP_173818903.1\|1159716_1161201_-\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.96969e-95
NZ_CP054259.1\|WP_024002923.1\|1143159_1144422_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP054259.1\|WP_003642116.1\|1159219_1159720_-\|DUF4811-domain-containing-protein	gnl\|CDD\|374344	pfam16069, DUF4811, Domain of unknown function (DUF4811). This family of proteins is found in bacteria. Proteins in this family are typically between 188 and 241 amino acids in length. There is a single completely conserved residue Y that may be functionally important.	4.84282e-43
NZ_CP054259.1\|WP_003642120.1\|1154965_1156474_+\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.93235e-80

>NZ_CP054259.1|WP_003644756.1|1150007_1150508_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
MHLTLTQTTINQQTYWLGTTPTGLAFVGRANGPRDEWQAFFKSANIHYDQQANQQACQELHDYLTGQRQHFDIPLDQTTGTPLQHQVWQALTRIPYGQTATYSQLATMINHPTAVRAVASAVGQNPLLIVIPCHRIRRKDGQLGGYRGGLPMKRALLALENARLPK
>NZ_CP054259.1|WP_021355952.1|1149390_1149564_+|hypothetical-protein
MADERPPNLAQSIVGYFDTGTSNKMLGALALCREITSYYTNSGLVSYLNITFSLTVD
>NZ_CP054259.1|WP_024002927.1|1148067_1148967_-|ABC-transporter-ATP-binding-protein
MLSIAHIQKRFGTVQALNDVSFDVHDGEIMGLIGQNGAGKSTTFHSILNFLSFDGQITWNGQPLTADDYDQIGYLPEERSLMSKLTITQQIVYLARLKNQSARVTKGKIAAWMKRFAVKGQPTDKIDKLSKGNQQKVQLICTLIHDPKLIILDEPFSGLDPVNADLLKQAILDAKQRGAAIIFSSHDMSNVEAICDSLVMLRNGEAVLKGTVEDVRAQFGRTRLFLTTDWSQAQLADLPGVTTVTQQGARRFRLELADASVGPAIFDQVTAGHYIEEFSQQPPTLDEIFRTEAGGVNHE
>NZ_CP054259.1|WP_003642127.1|1146857_1148075_-|ABC-transporter-permease
MNKTWIVTFETYLRQIKSWSFLSLVFMPFLFFGFVAAFSYFAAPSASKNDIAVVSTSPQLRTSFIKQSHVATANKYQTLASAKAATKRNDIAGYLVLTTKNQQLQAQFTGPNAVSSGDKAKIQQFLATAQSQRNVQRAQLSAKQTQALAVQPKFTEQLQKHAASDKTAKTVSFYIVVFFVYLILTTYSAITAQEIAADKGTKIMEVIFSSTTPRKYFNGKIYGVLLVIVTQLLVYLVGGFAVMQFVKRSSLTIDFWQQNTDLINQVIHNLVSINLLFALLAVLLYTVASAFCGALVTRVADASKAAQPVIYLSMLAFFMALAFQNTPTNLFVKIFSYIPFFSSYFMPLRLINGMATMPAAIVSLLILIATIIGSMIYIGRIYGGLMLQTDELGFWGNLKRGLRLK
>NZ_CP054259.1|WP_003644758.1|1145966_1146710_+|SDR-family-oxidoreductase
MTVKNKVVVITGASSGIGATTAKQLASNGAKVVLGARREERLAALVDEIKAAGGQAAYQVTDVTKSADVQALVKLAQTQFGGLDVIFNNAGIMPTSPISALHTDEWDQMVDINIKGVLNGVAAVMPIFTAQKSGQIITTSSVAGIKSFAGSGVYGATKFAVRNLMEVIRMESAQEGTNIRTVSLYPAAINTELLHTITDKTAKQNMTDFYQQVGISPAAVANVVNFAIDQPEDVNVNEFTIYPTKQA
>NZ_CP054259.1|WP_003642129.1|1145632_1145953_+|carboxymuconolactone-decarboxylase-family-protein
MTVKQTAGRDNLGKLAPQFAALNDDVLFGEVWARESALSLHDRSMITIACLMTSGDFPQLKAHFKMGKDHGISKDEAVEIVTHLAFYAGWPKAWSAMALIKEVYGE
>NZ_CP054259.1|WP_024002925.1|1145200_1145599_+|cupin-domain-containing-protein
MTTTNNSGLFGLGVKNEAYQQYFIGQSYLNALAGDEQVDVNVSNVTFEPGCRNNWHIHHNGYQILLVTSGEGWYQEAGKPAQLLHPGDVVTIHSGVKHWHGATKDSWFAHIAITKGTSEWLEPVDDEAYAKL
>NZ_CP054259.1|WP_003644761.1|1144593_1145028_-|MerR-family-transcriptional-regulator
MVRTTTERYSIGDFAKAVGLSAPTLRYYEKAGLIEPHRLDNGRRYYETADINWVKFLLHLKGTGMSISELQQYVTWRAAGDDTIPQRLALLKHVKEDFLVQFNEVQHHLQILNDKINWYEEKEAGITQDHEDFSSYLQRFGHHE
>NZ_CP054259.1|WP_024002923.1|1143159_1144422_+|ArgE/DapE-family-deacylase
MNGMAETAQLEAAVQALSDIVKMNTVNNHEQLVADYLVTLLKQHGIEAQSIEYAPGRVNLVAEIGDGHGPVVALDGHEDTVALGDADKWHTDPLAATIKDNRLYGRGVTDMKAGLMAEVFAMIALHDQDVPLHGTVRLLATVGEEVDHLGAEQLTELGYADDIQTLICAEPSGADKQLLLTKSIQAMLGVDDDTAQRMADANPTTEQHFIELAHKGSLTYTIKAQGVAAHSSMPAIGQNAIDMLMTYYQKQTAYFDSFKTIVNPVLGPTVPVVTLISGGEQVNTVPASAEMSVKIRTIPELRNDRLIKDLEAIIAECNADGANLTMDIASSFYPVHTPEDSQLVQLAKKVGEQVLQQRLPYFGAPGGTDASSYIVKSPDMQVIVFGPGNITAHQVNEYVDLDMYGRFIEIYQKMITELLA
>NZ_CP054259.1|WP_173818899.1|1140487_1143079_+|ABC-transporter-permease
MVGAAMTAAYFKTIMREIWSSKARFASILLIIFLGVAFYTGIRATGPDMSQAANDYYAKQKLATNSVQSTMGLTKADTRVLNQHRSQLTYQATRYADVNQLNNSQVVRVMVLPTTQRLNRLRIVKGRLPRHANEIVLDAQAQRLQPKLKVGSTYRISSTAKRNAQFTRRTFKVVGFVNSPTYVENTNRGVTNVGKGTLDYLVYVRPQVIKSSVITRIDVQFKNLRGVTPYTAKYRRLNRENTAQLKRWLKPQARKRQQALQAQAQAKLKPLRQATQQLASQVPAGTAQLVKLQSQLKRAQAQVAAITMPTYLYTDRTDNPGYTEYHENTQRVVALSTVFPLFFIAIAALICLTTMTRMVEELRLQMGTLKALGYTNTAVGSEFMIYGGLAALIGTALGVLFGVNFFPRFIAQAYGSMYNLPAINVQYIWMDIGIALAIALLCTLGTALVVLRVDLNSLPAQLLQPRSPKAGKTLLLERWQWLWHRLSFNHKITLRNLFRYKQRLLMTVLGIAGCMAMMITGFGLKDSIGDISVKQFNELWHYDAVVTRSGNETDQQRQALSRGQLYQASLKLQAKQVTVKQSGVAEQTATLGIPAPHQSLSKFVVLRHRQSHQAIHIGDRGAVIDEKLAKLYGVQAGDDLTIKLAGQTTKRIHISAVAENYVNHFIYMSPTYYRRVFKQAPVYNTNYVRFNQATKKQENAYADRLLKQAGIQNVTLMSTEKATNFKMLDSMNLVVLIFVISAGALALVVLYNLTNINVSERIRELSTIKVLGFYDGEVTMYIFRENLILTVLGIIAGCFLGNWLHAYILQTAETNALMFSPTIHPLSYVYAALLTLAFSLLVMGMMHRKLKRVNMLDALKSVD
>NZ_CP054259.1|WP_173818901.1|1152222_1153116_-|LysM-peptidoglycan-binding-domain-containing-protein
MKIKNALLTSLAATGLLALGTTVANADTVVVKAGDTVSEIALTHKTTIKAIQKANHLKNVNLIYIGDKLEVNGKHHATTVTTQVPTSAASSTASSTSTASSTANSTSTQSASSASVSSSTSTSAASTATSSSTTSVASSSAASSSSTSAASSSVTSTSTASAASSSAASSSTSSATSSSATSQASTASSSTASTSTAASSSATTSSSTTTSTSSSSSTTSTSSSAEAAAKAWIANKESGGSYTASNGNYYGKYQLSKSLLNGDYSASNQETVADEYVASRYGSWVAAKAFWEANGYY
>NZ_CP054259.1|WP_003642121.1|1153424_1154969_+|glycosyltransferase
MYYFVNTSINPKKSGIEHAEMKRLALFNQHHVPAKMVTRFFSLSLHQTLTAAGIAAENQINLFDFIQHSSERPTTKMTIEDLHLAPDLRVQSVGRHYEVYQNDQLLMKVNTFLNTQKQLNNVQYYDQNGKLVKTDWYDTRGFKGLEQFYAADGQVASEQVFNPDGEVVYQTFHMADRQNQVQNSLYRFINYEGQDWSFAGETAMTTFFLDELNRRTPHAVFVIDRTYELAYAALHMRTKAFKVMHLHSNHVNDPAHPKTASLNFNYAYALNNLDQWNGVIASTKQQTADFQARFGNQPAVYTIPVGIVDDATLNAPKPSFDQRTAGKIIFVARLAEEKQQDQVIRAFKKVLAQVPNATLDFWGYANGDTGKQLHQLVEQLGLKAAVTFNDYTTDLTAVYNDAQLAMLTSRAEGFALALLEGQAHGVPQIAYDVKYGPRDIIRDGHDGQLVPVNDENALATAMIDLLTQPKKLAMYSQQAYQDAQRFSTTAVWQQWQPLMKAAADFYQVEGATQR
>NZ_CP054259.1|WP_003642120.1|1154965_1156474_+|accessory-Sec-system-glycosyltransferase-Asp1
MNFFVNQYLMALNSGVEHAEFKRLQLFKDHQAPAKLVTRQFDGLLHQNMRRFNIADDQMANLFDFFRETTSFSSRVIKMADLNWPTAYDIKPDPNVSEVRAGDRLVAKVHFVPSTVGHVYFIEIFDHFNNLVQRTDYDERGFKARDEFFSSAGEPITDIFYRPDGSRMAEQYYTHDNNGTNYVSLCHLINYHGRDYYFNGEQEWYRFFLDELNKQYDENNVFIADRPLAAQWPVVNMQTAAKKYLWLPTPHAVDPRDQVYSNLNNAYVYGLHEFLSAWDGVITSTEQQKQDLTQWLGGQPSVPILTISAAIVSKQQAQHAPISISERHAHEIIYTGRLDAERRVDQLVTAFDQVHHKITDATLVIYGYGGELDRLKQQVSQLHLETAVTFAGYQPNLTMAYDQAGAYVYTGESDAQPLSLIEALSHGVPAIAYDINYGPKDVLKDGKNGYLVTDGAVNQLVRALTRTLESPQRQQRLSKGAYRSSEQYSDEQVWQQWQPVVQ
>NZ_CP054259.1|WP_003642119.1|1156558_1157386_-|LysR-family-transcriptional-regulator
MFKQLETFCAVYETRNFSHAAEQLFISQPTVSTQIKQLEADLQTTLLTRNGRQEIVPTASGQLLYQQAQKLLTTWAATKTAVQSPRHLVKVPCRIGASHTTGRLILPTLLANLSAVSDRFDFQVTLANSAEILTAMSQHKLDFGLVEKPLVTDQLNRLPFGHDELVHAGDFASPLWLLREPNSGVRHYTNAFLKARNIQPAQVMVIHSNQIIADLLAHGIGQTIISRHVLSNEIPIEQLSAHYQRQFFLLTNTQPAAALRPVQTAITQYLTTWSD
>NZ_CP054259.1|WP_003642118.1|1157502_1158513_+|putative-sulfate-exporter-family-transporter
MKVKGILPGLVTSLVIAIISQGLAQFVPALGAATIAILLGIIGGNTFLKQPQLGRGTKFAESKLLEYSVMLLGATMTVQTIGKIGGFGVLFILCQMTITIVGALWLGRKLGFSQSVRMLMAGGNAVCGSSAIASIAPVIDADEDDKGTVITLVNLMGTVLMLTLPVLGMAVFGGSVILKGALIGGTLQSVGQVVAAASMINQTTVQFATIFKIMRIMMLVVVVLIFGRLHQRTIENELAEDAVVSGNGNGHWLPWYVAGFLILCALNSLISLPAIIGATAHTISSWFEIIALAAIGLRLNLVNFMKAGKRLALYGLGVGTIQVVSALILITLLLQH
>NZ_CP054259.1|WP_003644754.1|1158596_1159160_+|GNAT-family-N-acetyltransferase
MFMLTYRVTPAIELREPLPQSDAPALLALLTADRAQYQYYLPWVAKIQTVADEQRFLTFAQAQLQQAQALNLVIVVEQRVAGMVSCDHFDDNDHSANIGYWLGRPFQGRGVMTAAVRGVCDLGFNQYHRQCLRIRAAVDNQASNAVAQRAGFDFLIQHPGGQHLLDGDHDENVYQVSAVDWLAKRHK
>NZ_CP054259.1|WP_003642116.1|1159219_1159720_-|DUF4811-domain-containing-protein
MIIVLLILATLVFAGTMIFSPAGRNRLIAIIISGLIIAASLIALVLNDNYHWGMHEVTRTQIQDLAPLKSKQAALRVQQLGTGSERVISYRVAAATKVSHTVTATTTTTKLTSGSPAQVQLKTTTWQFKNHLTHVLFSLGNTKTKIVQRQYLFTIPKTWQVVTVKN
>NZ_CP054259.1|WP_173818903.1|1159716_1161201_-|multidrug-efflux-MFS-transporter
MPTQNSTLPLDANGQPYHRTWLVLTLLVGTFTTFITQTLLTTAFPTLMADFHISATAVQWLTTGFMLIMGIMIPVSAWLLTRINSKYLYLTAMLIFGLGTTLAYFAVNFQMLLIARMIQAMGVGISAPVFQTIMSSVYPPEKRGSAMGTAGIVIGLAPAIGPTLSGWIIDNYSWRALFLFILPINILVIIVSFFTLRKVLPTSKQPIDWWSVLISTIGFGSMLYGFSSVGNAGWGDPVVLTTLVIGLIFIGLFVWRQLHMDQPLLELRVFKIPAFTLSAILTALAYMAMMGVEMILPMYIQTVLGRSAMDSGLILLPGAIMMGIMSPITGRIFDHIGARRLAMTGMLLLTLGTAFFLSISATTPILWIIVVYAIRMFGLTMVTMPVTTTGINALPFRLISHGTAANNTLRQVAASMGTAILISVYSSVAKWQMPGHQLLTQAPLKYRQDGITATLTGYHMAFVVSLIFCAIGFGITFFLKANHSKTISQEDDAA
>NZ_CP054259.1|WP_003644753.1|1161414_1162077_+|HAD-family-hydrolase
MTKKYLTFDCYGTLINTEPLYQWVANLGLAVGLDPLTVRKAYATYEDDPASVNPYLDYSTLVRADLKHLDRLFEQRHFFESHYVECLEVQRHLLPYADVIPTLTAWQQLGYQLIIMSNSSWDIMPANIAALKVSFTAVVTAEDIQAYKPALAFFETVQERFKLTADNHWHIARGYESDVVPASAMQWPMIWINRDQRQPTSSERPTHMVTDLAAVKQWVN
>NZ_CP054259.1|WP_024002430.1|1162195_1163383_+|MFS-transporter
MNSKSLNKSTVLLMAISAAIVVANINYIQPIEADIAQQFNLPNAVIGAVAMLTQLGYAFGLLLIVPMGDIMNRRMLIMRLLVLAIISALLAFVAPNIWVYALASLLIGITSVAPQVIIPYAGFLAPRNQRGQVLGNVLSGLLVGVLLSRTVSGVLASYLSWQMVYLIAAILIAGLWLVLWRKLPHDPVTTHTTNYKAMIQTVPQLVKRYPVLRASAVNGFVLFGVSNIFWATLVFYLQHQYGWGSREAGLLALLGVTGVLAAPLIGRLADRFRPRTIIGLGLVLSTLAYVVFWLSGTHLVGLIIGIVILDLGTQFGQVANQTRIQSIDVHASSRFNSVFMFGYFMGGALGSFCGNVLWDLAGWNGVCGLAVVVLMIGFYAHFVHYPRVVTRQAQH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

740944 : 795176

Lactobacillus_phage(81.4%)

integrase,tail,portal,bacteriocin,capsid,head,protease,terminase

attL 745218:745240|attR 787990:788012

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642489.1\|740944_741274_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_021356330.1\|741468_742803_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-26	26.4
WP_173818796.1\|742938_744051_+	glycerate kinase	W6LM47	Streptococcus_phage	1.5e-34	35.0
WP_173818798.1\|744116_745058_-	alpha/beta hydrolase	NA	NA	NA	NA
745218:745240	attL	NA	NA	NA	NA
WP_003642485.1\|745419_746301_-	phytoene/squalene synthase family protein	NA	NA	NA	NA
WP_011102097.1\|746281_747778_-	phytoene desaturase	NA	NA	NA	NA
WP_063486111.1\|748057_749197_-\|integrase	site-specific integrase	A0A2H4JCB7	uncultured_Caudovirales_phage	4.0e-35	29.0
WP_003644558.1\|749372_749687_-	hypothetical protein	NA	NA	NA	NA
WP_057137256.1\|749869_750127_-	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	5.0e-31	75.0
WP_003644556.1\|750252_750429_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	7.2e-21	86.2
WP_154812813.1\|751443_752358_-	hypothetical protein	E9LUS7	Lactobacillus_phage	2.1e-07	30.4
WP_063486113.1\|752438_752693_-	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	1.1e-06	36.7
WP_080469392.1\|752807_753479_-	helix-turn-helix domain-containing protein	D7RWL5	Brochothrix_phage	2.5e-66	58.1
WP_024624159.1\|753641_753872_+	hypothetical protein	A0A0N7IRA0	Lactobacillus_phage	1.0e-14	57.7
WP_063486125.1\|753903_754638_+	ORF6C domain-containing protein	A0A1P8BM06	Lactococcus_phage	9.6e-51	45.3
WP_003641364.1\|754649_754859_+	hypothetical protein	NA	NA	NA	NA
WP_063486114.1\|754871_755120_+	hypothetical protein	NA	NA	NA	NA
WP_025015699.1\|755114_755336_-	hypothetical protein	NA	NA	NA	NA
WP_057137267.1\|755961_756234_+	hypothetical protein	NA	NA	NA	NA
WP_063486115.1\|756399_756648_+	hypothetical protein	E9LUT6	Lactobacillus_phage	8.6e-28	73.9
WP_003641371.1\|756650_756851_+	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
WP_173818800.1\|757134_757305_+	hypothetical protein	NA	NA	NA	NA
WP_033098960.1\|757304_757562_+	hypothetical protein	NA	NA	NA	NA
WP_063486116.1\|757665_758460_+	hypothetical protein	Q9AZA0	Lactobacillus_prophage	1.9e-52	69.7
WP_063486117.1\|758453_759320_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	1.4e-48	40.9
WP_173818802.1\|759485_759794_+	hypothetical protein	E9LUN7	Lactobacillus_phage	7.1e-48	93.1
WP_173818804.1\|759786_759945_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	1.9e-17	90.4
WP_173818806.1\|760154_760502_+	hypothetical protein	A0A142F1A4	Bacillus_phage	2.4e-15	50.7
WP_173818808.1\|760498_760669_+	hypothetical protein	E9LUP4	Lactobacillus_phage	5.0e-19	89.3
WP_022638818.1\|760649_761075_+	phage transcriptional activator RinA	E9LUP5	Lactobacillus_phage	3.1e-62	81.6
WP_024624388.1\|762168_762969_+	hypothetical protein	NA	NA	NA	NA
WP_173818810.1\|763022_763193_+	hypothetical protein	E9LUP6	Lactobacillus_phage	2.2e-22	92.9
WP_173819229.1\|763203_763671_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.2e-80	92.9
WP_033608389.1\|763869_764331_+\|terminase	phage terminase small subunit P27 family	A0A286QRF4	Streptococcus_phage	6.5e-45	58.2
WP_072539996.1\|764317_766225_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	2.2e-179	49.7
WP_033608390.1\|766214_766409_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	2.0e-24	92.2
WP_072539990.1\|766411_767608_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.5e-205	89.7
WP_173818812.1\|767585_768320_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	8.8e-121	92.2
WP_063489696.1\|768319_769552_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	2.5e-205	90.9
WP_076669798.1\|769624_769963_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	4.0e-52	92.9
WP_033608492.1\|769946_770309_+\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	5.8e-65	98.3
WP_173818814.1\|770298_770739_+\|tail	phage tail protein	E9LUQ6	Lactobacillus_phage	2.7e-77	96.6
WP_072539986.1\|770735_771119_+	DUF806 family protein	E9LUQ7	Lactobacillus_phage	8.8e-64	94.5
WP_173818816.1\|771119_771758_+\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	1.0e-109	94.3
WP_173818818.1\|771959_772343_+	hypothetical protein	E9LUQ9	Lactobacillus_phage	5.7e-63	97.6
WP_016058335.1\|772339_772531_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_173818820.1\|772543_777451_+	tape measure protein	E9LUR1	Lactobacillus_phage	0.0e+00	63.0
WP_173818822.1\|777522_779298_+\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	4.2e-302	90.8
WP_053566541.1\|779362_781777_+	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	90.0
WP_173818824.1\|781793_784367_+\|tail	phage tail protein	A0A2K9VCB6	Lactobacillus_phage	1.4e-274	50.5
WP_053566543.1\|784359_784611_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	6.6e-28	97.1
WP_003644513.1\|784614_784776_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	9.5e-20	100.0
WP_053566544.1\|784759_785119_+	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	8.6e-45	78.2
WP_173818826.1\|786149_786413_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	5.7e-38	98.9
WP_063489763.1\|786424_786955_+	hypothetical protein	E9LUS0	Lactobacillus_phage	8.0e-39	95.7
WP_003642482.1\|788357_789056_-	zinc metallopeptidase	NA	NA	NA	NA
787990:788012	attR	NA	NA	NA	NA
WP_003642481.1\|789223_789391_+	hypothetical protein	NA	NA	NA	NA
WP_011102096.1\|789915_790755_+	DegV family protein	NA	NA	NA	NA
WP_003642478.1\|790929_791658_+	LrgB family protein	NA	NA	NA	NA
WP_003642477.1\|791677_792097_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_003642476.1\|792508_793051_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003642475.1\|793483_794356_+	metallophosphoesterase	NA	NA	NA	NA
WP_003643468.1\|794410_794638_+	PLDc N-terminal domain-containing protein	NA	NA	NA	NA
WP_003642473.1\|794819_795176_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA

DBSCAN-SWA_2

1259900 : 1268411

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645861.1\|1259900_1260383_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_011101896.1\|1260366_1261497_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|1261499_1262231_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|1262232_1262487_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011101895.1\|1262486_1263167_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_173818912.1\|1263159_1265379_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.3
WP_003642591.1\|1265363_1266818_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_013355836.1\|1266814_1267840_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	5.4e-60	40.7
WP_003645867.1\|1267832_1268411_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_3

2288266 : 2302718

Lactobacillus_phage(90.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173819100.1\|2288266_2290540_+	HAD-IC family P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	1.0e-37	23.5
WP_047673279.1\|2292652_2292862_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_173819102.1\|2292965_2293931_-	hypothetical protein	A0A2P0ZL95	Lactobacillus_phage	4.7e-29	88.9
WP_052098033.1\|2293914_2294382_-	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	6.1e-83	99.4
WP_011101401.1\|2294726_2295167_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_011101400.1\|2295237_2295798_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	3.8e-100	99.5
WP_173819104.1\|2295885_2298324_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_173819106.1\|2298326_2298941_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.8e-111	99.5
WP_003643099.1\|2299284_2300232_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_011101398.1\|2300417_2301389_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_173819108.1\|2301479_2302718_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	8.5e-217	97.4

DBSCAN-SWA_4

2500724 : 2508331

Escherichia_phage(66.67%)

integrase

attL 2494825:2494841|attR 2516865:2516881

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2494825:2494841	attL	NA	NA	NA	NA
WP_024002485.1\|2500724_2501672_-	GDP-mannose 4,6-dehydratase	A0A1V0SAI6	Catovirus	1.4e-41	34.9
WP_060417606.1\|2501689_2502463_-	tyrosine protein phosphatase	NA	NA	NA	NA
WP_063721029.1\|2502449_2503178_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_024002886.1\|2503189_2503960_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_080440298.1\|2504316_2504895_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	9.3e-33	42.5
WP_024002617.1\|2504926_2505769_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.5e-34	37.2
WP_003643249.1\|2505838_2506867_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	4.9e-69	42.1
WP_024002618.1\|2506876_2507458_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A1D8EQH2	Escherichia_phage	1.6e-32	41.0
WP_024002619.1\|2507461_2508331_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	9.2e-101	61.2
2516865:2516881	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2962394 : 2971018

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355240.1\|2962394_2963390_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
WP_003640969.1\|2963528_2964314_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355239.1\|2964317_2965214_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640967.1\|2965312_2965660_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|2965684_2966704_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|2966720_2967050_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_173819189.1\|2967046_2967712_-	dTMP kinase	M1PSC7	Streptococcus_phage	3.2e-53	53.0
WP_003640957.1\|2968109_2968361_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|2968375_2968975_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|2968990_2969299_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003644909.1\|2969320_2971018_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_6

3104249 : 3160436

uncultured_Mediterranean_phage(22.22%)

tRNA,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060684287.1\|3104249_3105521_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.6e-96	43.9
WP_003642042.1\|3105987_3107601_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|3107773_3108382_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|3108426_3108867_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003643833.1\|3109229_3110162_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_169484456.1\|3110170_3111529_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_015379810.1\|3111548_3112358_+	sugar-phosphatase	NA	NA	NA	NA
WP_003643831.1\|3112527_3113514_-	lipoprotein	NA	NA	NA	NA
WP_173819211.1\|3113596_3114619_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|3114907_3115888_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_173819214.1\|3116253_3117078_-	serine hydrolase	NA	NA	NA	NA
WP_003642031.1\|3117313_3118696_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|3118764_3119601_-	pur operon repressor	NA	NA	NA	NA
WP_173819261.1\|3119956_3120754_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|3120746_3121445_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_047672693.1\|3121712_3122657_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|3122966_3123833_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|3123965_3124217_-	Veg family protein	NA	NA	NA	NA
WP_003642019.1\|3124321_3125212_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_011101014.1\|3125208_3125772_-	ribonuclease M5	NA	NA	NA	NA
WP_003642017.1\|3125758_3126535_-	TatD family hydrolase	NA	NA	NA	NA
WP_016511603.1\|3126657_3127842_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003643823.1\|3128074_3130126_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_021356646.1\|3130447_3130837_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|3131433_3132276_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646490.1\|3132275_3132980_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642010.1\|3133001_3133961_-	hypothetical protein	NA	NA	NA	NA
WP_033608308.1\|3133953_3135228_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|3135273_3136191_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003643820.1\|3136359_3137154_-	hypothetical protein	NA	NA	NA	NA
WP_003642006.1\|3137158_3138292_-	hypothetical protein	NA	NA	NA	NA
WP_011101007.1\|3138746_3139760_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642004.1\|3139872_3140619_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_173819216.1\|3140768_3141665_-	ROK family protein	NA	NA	NA	NA
WP_003642002.1\|3141785_3143222_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_053567057.1\|3143239_3144595_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|3144817_3145240_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|3145229_3145418_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|3145424_3146786_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|3146858_3147569_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003643815.1\|3147976_3148993_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_021356643.1\|3149432_3150209_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_060684282.1\|3150467_3152777_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_060684281.1\|3152871_3153075_-	hypothetical protein	NA	NA	NA	NA
WP_053566441.1\|3153212_3153899_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_173819218.1\|3153992_3154673_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721086.1\|3154759_3155428_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_062688864.1\|3155494_3156184_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721087.1\|3157665_3159816_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641985.1\|3160082_3160253_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003643811.1\|3160277_3160436_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054259

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection