CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP054304	Klebsiella pneumoniae strain MS14393 plasmid pMS14393A, complete sequence	0 crisprs	cas3,csa3,RT	0	0	2
NZ_CP054303	Klebsiella pneumoniae strain MS14393 chromosome, complete genome	3 crisprs	WYL,DinG,cas3,csa3,DEDDh	24	39	10
NZ_CP054305	Klebsiella pneumoniae strain MS14393 plasmid pMS14393B, complete sequence	0 crisprs	DEDDh	0	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14907 : 62475

uncultured_Caudovirales_phage(27.27%)

transposase,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000427623.1\|14907_15912_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001114073.1\|17111_17465_+	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-23	50.0
WP_000783215.1\|17512_17875_+	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_001556710.1\|17892_19644_+	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_003026002.1\|19692_20982_+	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	3.3e-171	73.3
WP_000065759.1\|20994_21420_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.8e-50	70.0
WP_004118313.1\|21450_21855_-	arsenic transporter ATPase	NA	NA	NA	NA
WP_001556711.1\|21863_22436_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.0e-83	89.0
WP_012291341.1\|22599_25608_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	64.5
WP_047063025.1\|25624_26692_+	type IV secretion system protein VirB10	NA	NA	NA	NA
WP_012561144.1\|26733_27729_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_000792636.1\|27728_28262_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	5.8e-21	33.9
WP_000091613.1\|28434_28749_-	hypothetical protein	NA	NA	NA	NA
WP_000215515.1\|29003_29360_-	cupin domain-containing protein	NA	NA	NA	NA
WP_001293886.1\|29349_29751_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_001247892.1\|29747_30038_-	nucleotidyltransferase	NA	NA	NA	NA
WP_000427623.1\|30529_31534_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001138073.1\|31612_34585_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.1
WP_001162012.1\|34587_35145_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
WP_000993245.1\|35274_35487_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_001087807.1\|35552_35789_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_001277466.1\|35785_36151_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_000209296.1\|36168_37854_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
WP_000522996.1\|37892_38318_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_000732275.1\|38345_38621_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_004200999.1\|38636_39002_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_001166628.1\|39073_39529_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_004152292.1\|39803_40661_-	incFII family plasmid replication initiator RepA	NA	NA	NA	NA
WP_004171457.1\|40653_40731_-	RepA leader peptide Tap	NA	NA	NA	NA
WP_004199332.1\|40947_41226_-	replication regulatory protein RepA	NA	NA	NA	NA
WP_009485932.1\|41546_42026_-	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	9.8e-20	35.2
WP_004152296.1\|42366_42645_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_004178051.1\|42646_44968_-\|bacteriocin	klebicin B-related nuclease bacteriocin	NA	NA	NA	NA
WP_004178052.1\|45323_45869_+	hypothetical protein	NA	NA	NA	NA
WP_004152301.1\|46083_46431_-	hypothetical protein	NA	NA	NA	NA
WP_004178053.1\|46450_47047_-	fertility inhibition protein FinO	NA	NA	NA	NA
WP_004152303.1\|47204_47930_-	type-F conjugative transfer system pilin acetylase TraX	A0A1D6ZIU7	Xanthomonas_phage	5.5e-06	29.4
WP_004153029.1\|48009_53271_-	conjugative transfer relaxase/helicase TraI	NA	NA	NA	NA
WP_004152629.1\|55939_56671_-	complement resistance protein TraT	NA	NA	NA	NA
WP_004153030.1\|56860_57388_-	hypothetical protein	NA	NA	NA	NA
WP_004178054.1\|57393_60243_-	conjugal transfer mating pair stabilization protein TraG	NA	NA	NA	NA
WP_004176137.1\|61443_62475_+\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

117112 : 173406

uncultured_Caudovirales_phage(31.25%)

transposase,holin,integrase,protease

attL 106005:106020|attR 152432:152447

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
106005:106020	attL	NA	NA	NA	NA
WP_001515717.1\|117112_117853_-\|integrase	site-specific integrase	I3WFA4	Macacine_betaherpesvirus	5.4e-25	58.6
WP_004182028.1\|118996_119944_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.3e-12	30.6
WP_071527918.1\|119970_120282_-	EAL domain-containing protein	NA	NA	NA	NA
WP_068814619.1\|120301_121270_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	8.7e-185	98.4
WP_004197688.1\|121942_122200_-	hypothetical protein	NA	NA	NA	NA
WP_004176137.1\|124136_125168_+\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA
WP_004152070.1\|126393_127671_-	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_004178088.1\|127733_129731_-\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	9.7e-21	25.9
WP_085955172.1\|130770_131978_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	1.7e-100	63.2
WP_004178091.1\|133406_133838_-	silver-binding protein SilE	NA	NA	NA	NA
WP_003032875.1\|134088_135564_-	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.0e-27	30.1
WP_001572351.1\|135556_136237_-	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	2.1e-31	35.6
WP_000475512.1\|136426_137812_+	Cu(+)/Ag(+) efflux RND transporter outer membrane channel SilC	NA	NA	NA	NA
WP_001246153.1\|137840_138194_+	cation efflux system protein CusF	NA	NA	NA	NA
WP_004098959.1\|138307_139600_+	Cu(+)/Ag(+) efflux RND transporter periplasmic adaptor subunit SilB	NA	NA	NA	NA
WP_004098958.1\|139610_142757_+	Cu(+)/Ag(+) efflux RND transporter permease subunit SilA	S5VTK5	Leptospira_phage	4.0e-61	22.5
WP_000758228.1\|142843_143284_+	hypothetical protein	NA	NA	NA	NA
WP_004098955.1\|143410_145858_+	Ag(+)-translocating P-type ATPase SilP	A0A218MNH6	uncultured_virus	7.6e-84	35.8
WP_000843497.1\|145898_146096_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_004182013.1\|146129_146867_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
WP_001023257.1\|147155_147605_-	copper resistance protein	NA	NA	NA	NA
WP_000925242.1\|147838_149656_+	multicopper oxidase PcoA	NA	NA	NA	NA
WP_001378118.1\|149661_150552_+	copper resistance outer membrane transporter PcoB	NA	NA	NA	NA
WP_000025662.1\|150591_150972_+	copper resistance system metallochaperone PcoC	NA	NA	NA	NA
WP_004118344.1\|150976_151906_+	copper resistance inner membrane protein PcoD	NA	NA	NA	NA
WP_001188930.1\|151960_152641_+	copper response regulator transcription factor PcoR	W8CYM9	Bacillus_phage	8.7e-30	34.4
152432:152447	attR	NA	NA	NA	NA
WP_004152084.1\|152637_154038_+	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	4.1e-18	26.3
WP_004152085.1\|154254_154689_+	copper resistance system metallochaperone PcoE	NA	NA	NA	NA
WP_024623170.1\|154920_155100_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_004196769.1\|156842_157352_+	aquaporin	NA	NA	NA	NA
WP_004196778.1\|157401_157899_-	N-acetyltransferase	NA	NA	NA	NA
WP_004152092.1\|158230_158557_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004182006.1\|158553_159267_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	2.9e-92	77.0
WP_004182005.1\|159275_159821_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_004152095.1\|159896_160259_+	arsenic metallochaperone ArsD family protein	NA	NA	NA	NA
WP_004152096.1\|162155_162692_+	N-acetyltransferase	NA	NA	NA	NA
WP_004152097.1\|162724_163150_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-52	72.9
WP_004152098.1\|163162_164452_-	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.9e-171	74.0
WP_004152099.1\|164499_166251_-	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_004152100.1\|166268_166631_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_004152101.1\|166680_167031_-	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	1.4e-23	50.9
WP_004152102.1\|167388_167658_+	hypothetical protein	NA	NA	NA	NA
WP_004152103.1\|167645_168221_+	hypothetical protein	NA	NA	NA	NA
WP_004152104.1\|168251_168746_+	DNA-binding protein	NA	NA	NA	NA
WP_004152105.1\|168789_169158_+	hypothetical protein	NA	NA	NA	NA
WP_004152106.1\|169191_169395_+	hemolysin expression modulator Hha	NA	NA	NA	NA
WP_004152107.1\|169443_169701_+	hypothetical protein	NA	NA	NA	NA
WP_004152108.1\|169776_170031_+	hypothetical protein	NA	NA	NA	NA
WP_003026799.1\|170206_170473_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_003026803.1\|170460_170943_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004152113.1\|172443_173406_-\|protease	M48 family metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP054303

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054303_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054303_1

714944-715021

Orphan

Consensus_repeat	Method
AAGGCGTCAGCCGCCACCCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054303_1

>merge|NZ_CP054303|1|714944-715021|CRISPRCasFinder
AAGGCGTCAGCCGCCACCCGGCAAAATAATCGCGCAATAGCACCGTAGGCCGGGCAAGGCGTCAGCCGCCGCCCGGCA

>NZ_CP054303|1|1|714944-715021|CRISPRCasFinder
AAGGCGTCAGCCGCCACCCGGCA	AAATAATCGCGCAATAGCACCGTAGGCCGGGC
AAGGCGTCAGCCGCCGCCCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054303.1\|WP_040211196.1\|722248_724270_+\|excinuclease-ABC-subunit-B	unknown	unknown	gnl\|CDD\|235395
NZ_CP054303.1\|WP_002895648.1\|720151_720874_+\|ATP-dependent-dethiobiotin-synthetase-BioD	unknown	unknown	gnl\|CDD\|234625
NZ_CP054303.1\|WP_002895575.1\|715175_715652_-\|kinase-inhibitor	unknown	unknown	gnl\|CDD\|182339
NZ_CP054303.1\|WP_002895652.1\|721624_721837_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054303.1\|WP_004142100.1\|719403_720159_+\|malonyl-ACP-O-methyltransferase-BioC	unknown	unknown	gnl\|CDD\|182340
NZ_CP054303.1\|WP_004183463.1\|700000_701086_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP054303.1\|WP_004147680.1\|724518_725616_-\|two-component-system-sensor-histidine-kinase-PmrB	unknown	unknown	gnl\|CDD\|236751
NZ_CP054303.1\|WP_002895580.1\|717225_718266_+\|biotin-synthase-BioB	unknown	unknown	gnl\|CDD\|185063
NZ_CP054303.1\|WP_004152853.1\|720815_721538_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP054303.1\|WP_004183475.1\|718262_719420_+\|8-amino-7-oxononanoate-synthase	unknown	unknown	gnl\|CDD\|235655
NZ_CP054303.1\|WP_004142109.1\|713013_714396_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182566
NZ_CP054303.1\|WP_074398601.1\|706501_707821_+\|imidazolonepropionase	unknown	unknown	gnl\|CDD\|236478
NZ_CP054303.1\|WP_004179084.1\|702102_704790_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP054303.1\|WP_002895358.1\|708835_709561_+\|histidine-utilization-repressor	unknown	unknown	gnl\|CDD\|184961
NZ_CP054303.1\|WP_012737677.1\|711388_712915_+\|histidine-ammonia-lyase	unknown	unknown	gnl\|CDD\|236484
NZ_CP054303.1\|WP_004142122.1\|705063_706347_-\|putative-acyl-CoA-thioester-hydrolase	unknown	unknown	gnl\|CDD\|236709
NZ_CP054303.1\|WP_160333877.1\|710453_711392_+\|urocanate-hydratase	unknown	unknown	gnl\|CDD\|235448
NZ_CP054303.1\|WP_004176805.1\|715722_717012_-\|adenosylmethionine--8-amino-7-oxononanoate-transaminase	unknown	unknown	gnl\|CDD\|181189
NZ_CP054303.1\|WP_038431914.1\|707817_708774_+\|formimidoylglutamase	unknown	unknown	gnl\|CDD\|234974
NZ_CP054303.1\|WP_004183465.1\|701619_702051_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|185353

Protein	Function_ID	Function_description	E-value
NZ_CP054303.1\|WP_040211196.1\|722248_724270_+\|excinuclease-ABC-subunit-B	gnl\|CDD\|235395	PRK05298, PRK05298, excinuclease ABC subunit UvrB.	0
NZ_CP054303.1\|WP_002895648.1\|720151_720874_+\|ATP-dependent-dethiobiotin-synthetase-BioD	gnl\|CDD\|234625	PRK00090, bioD, ATP-dependent dethiobiotin synthetase BioD.	4.52132e-105
NZ_CP054303.1\|WP_002895575.1\|715175_715652_-\|kinase-inhibitor	gnl\|CDD\|182339	PRK10257, PRK10257, putative kinase inhibitor protein; Provisional.	7.58373e-117
NZ_CP054303.1\|WP_004142100.1\|719403_720159_+\|malonyl-ACP-O-methyltransferase-BioC	gnl\|CDD\|182340	PRK10258, PRK10258, biotin biosynthesis protein BioC; Provisional.	1.7976e-160
NZ_CP054303.1\|WP_004183463.1\|700000_701086_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	1.94626e-66
NZ_CP054303.1\|WP_004147680.1\|724518_725616_-\|two-component-system-sensor-histidine-kinase-PmrB	gnl\|CDD\|236751	PRK10755, PRK10755, two-component system sensor histidine kinase PmrB.	0
NZ_CP054303.1\|WP_002895580.1\|717225_718266_+\|biotin-synthase-BioB	gnl\|CDD\|185063	PRK15108, PRK15108, biotin synthase; Provisional.	0
NZ_CP054303.1\|WP_004152853.1\|720815_721538_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	3.17026e-74
NZ_CP054303.1\|WP_004183475.1\|718262_719420_+\|8-amino-7-oxononanoate-synthase	gnl\|CDD\|235655	PRK05958, PRK05958, 8-amino-7-oxononanoate synthase; Reviewed.	0
NZ_CP054303.1\|WP_004142109.1\|713013_714396_+\|amino-acid-permease	gnl\|CDD\|182566	PRK10580, proY, putative proline-specific permease; Provisional.	0
NZ_CP054303.1\|WP_074398601.1\|706501_707821_+\|imidazolonepropionase	gnl\|CDD\|236478	PRK09356, PRK09356, imidazolonepropionase; Validated.	0
NZ_CP054303.1\|WP_004179084.1\|702102_704790_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP054303.1\|WP_002895358.1\|708835_709561_+\|histidine-utilization-repressor	gnl\|CDD\|184961	PRK14999, PRK14999, histidine utilization repressor; Provisional.	3.37417e-172
NZ_CP054303.1\|WP_012737677.1\|711388_712915_+\|histidine-ammonia-lyase	gnl\|CDD\|236484	PRK09367, PRK09367, histidine ammonia-lyase; Provisional.	0
NZ_CP054303.1\|WP_004142122.1\|705063_706347_-\|putative-acyl-CoA-thioester-hydrolase	gnl\|CDD\|236709	PRK10531, PRK10531, putative acyl-CoA thioester hydrolase.	0
NZ_CP054303.1\|WP_160333877.1\|710453_711392_+\|urocanate-hydratase	gnl\|CDD\|235448	PRK05414, PRK05414, urocanate hydratase; Provisional.	0
NZ_CP054303.1\|WP_004176805.1\|715722_717012_-\|adenosylmethionine--8-amino-7-oxononanoate-transaminase	gnl\|CDD\|181189	PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated.	0
NZ_CP054303.1\|WP_038431914.1\|707817_708774_+\|formimidoylglutamase	gnl\|CDD\|234974	PRK01722, PRK01722, formimidoylglutamase; Provisional.	1.13028e-178
NZ_CP054303.1\|WP_004183465.1\|701619_702051_+\|universal-stress-protein	gnl\|CDD\|185353	PRK15456, PRK15456, universal stress protein UspG; Provisional.	1.69931e-44

>NZ_CP054303.1|WP_004142109.1|713013_714396_+|amino-acid-permease
MQQQHKPHLLRGLNARHIRFIALGSAIGTGLFYGSASAIKAAGPAVLLAYLIGGAAVFIVMRALGEMAVRNPVSGSFGSYARQYLGPLAGFITGWTYTFEMVIVALADVTAFGIYMGLWYPDVPRWIWILSIIFFIGAMNLCNVRVFGEMEFWLSLVKVVAIIAMMLAGAGIIFFGFGHSFPATGLENLWSHGGFAPNGWQGVIASLGIVMFAFGGVEIIGVTAAEAKDPKKVIPQAINTIPLRIILFYVCTLAVLMAIFPWNSFGEQGSPFVLIFDGLGIPAAATILNIIVISASISAINSDIFGAGRMMYGMSKEGLAPKSFQRIASNGVPWMTVVVMGGALLAAVVLNYLIPEQVFVLIASLAAFATVWVWLMILLSHFAMRRGLSAEERSQIAFPIPFWPVAPLLTLLFMGLVIAVLGMFAETRMALIAGLVWLGLLTVVWYARVRKTALQVVTEQ
>NZ_CP054303.1|WP_012737677.1|711388_712915_+|histidine-ammonia-lyase
MKSLTLIPGQLSLSQLRDVYSHPVNITLDSGAFAAIDESVACVNAILAEGRTAYGINTGFGLLAQTRISTEDLENLQRSLVLSHAAGVGEPLDDDLARLIMVLKINSLSRGFSGIRLSVIQALIGLVNAGVTPWIPAKGSVGASGDLAPLAHMSLTLLGEGKARVRGGDWLPATEALRQVGLEPITLAAKEGLALLNGTQASTAFALRGLFEAEDLFASAVVCGALTTEAALGSRRPFDARIHEVRGQRGQIDAAALYRHLLTDDSAISQSHHNCSKVQDPYSLRCQPQVMGACLTQIRQAAEVLLAEANAVSDNPLVFAAENDVISGGNFHAEPVAMAADNIALAIAEIGSLSERRIALMMDSHMSQLPPFLVKNGGVNSGFMIAQVTAAALASENKALSHPHSVDSLPTSANQEDHVSMAPAAGRRLWAMAENTRGVLAVEWLAAAQGLDMREGLTTSPLLEEARHLLRERVPHYTQDRYFAPDIDNAIALLAARHLTRLLPAVLH
>NZ_CP054303.1|WP_160333877.1|710453_711392_+|urocanate-hydratase
MKRGVRPDMVTDQTSAHDPLHGYLPKGWSWEEYQQKAESDPQGTILAAKRSMADHVQAMLAFHEMGVPTFDYGNNIRQMAQEVGVSNAFDFPGFVPAYIRPLFCRGIGPFRWVALSGDPQDIYKTDAKVKEIIKDDQHLHHWLDMARERISFQGLPARICWVGLEWRQKLGLAFNEMVRSGEVSAPIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAAARIARVLHNDPATGVMRHADAGYDIAIECAAEQGLNLPMVAATQGNAK
>NZ_CP054303.1|WP_002895358.1|708835_709561_+|histidine-utilization-repressor
MFAQQPRSAPAPFYEKVKQAISEKIHSGVWRPHDRIPSEAELVAQFGFSRMTINRALRELTDEGLLVRLQGVGTFVAEPKGQSALFEVRSIAAEIVARHHQHRCEVLLLEETRADHIQATALSVPEGTRIFHSLMVHYENEVPVQIEDRCVNAAVVPDYLHQDYTATTPHDYLSLIAPLTEGEHIVEAVQATAEECALLHIHAHDPCLLIRRRTWSTTHIVSHARLLFPGSRYRLQGRFGS
>NZ_CP054303.1|WP_038431914.1|707817_708774_+|formimidoylglutamase
MMLWQATPASLWQGRDDSAEAPNALRLFQTIARAERFAPQEMPGDIALLGFACDEGVRRNKGRTGAADGPATLRRALANMASHQGHDRCVDMGTISVDGEQLEVAHQALREAVADCQRAGKRTLVLGGGHETAFGHGAGVLDAFPGEKVGIINLDAHLDLRFADCASSGTPFRQLALECDAQQRGFHYTCIGVSRAANTQALWDEAARRQVAIVEDLEVLTAFETRVLPELERNIAQFDRLYLTIDLDVLPAREMPAVSAPAALGVPLATLLRIVEPLCRSGKLQAVDLVEFNPLFDIDGQGARVAARVAWQIAHWWR
>NZ_CP054303.1|WP_074398601.1|706501_707821_+|imidazolonepropionase
MVFSHKKITFPCAIVDFTGVMKINVYTTHDKLSAMTEATSELVIWRNGRLATLNPDHAQPYGLLERHALLVRDGRIAAIVAEDDVPSGRSIDLEGRLVTPGLIDCHTHLVFGGSRAQEWEQRLNGVSYQTISASGGGINSTVRATRDSSETELLALAQPRLERLLREGVTTLEIKSGYGLDLPNERKMLRVARQLADHNGVELSATLLSAHATPPEYQGDADGYITLVCETILPTLWQEGLFESVDVFCENVGFSPQQTERVFQAAQALGIPVKGHVEQLSSLGGAQLVSRYHGLSADHIEYLTEEGVAAMRESGTVAALLPGAFYFLNETRKPPVELLRKYQVPMAVATDFNPGTSPFASLHLAMNMACVKFGLTPEEAWAGVTRHAARALGRQASHGQLAPGFVANFAIWDAEHPVEMVYEPGRSPLWHRVVQGELQ
>NZ_CP054303.1|WP_004142122.1|705063_706347_-|putative-acyl-CoA-thioester-hydrolase
MNTYSVSRLALALAFGVTLSACSSTPADQQPSTQTAPGTTARPILNAEEAKNFTPAAYFQSLAPNAAAWTPSAISLPAQPDFIVGPAGTQGVTHTTIQAAVDAAIARHSNRRLYIAIMPGEYPGTVYVPAAPGALTLYGTGDKPIDVKISEAIDSEMDRNTWRRLVNPGGKYMPGKPAWYMFDSCQSKSAATVGVMCSAVFWSQNNGLQLQNLTIANNLGDSVDAGTHQAVALRSDGDQVQINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDFRVVNSRTQKEAYVFAPATLKSVTYGFLATNSRFTASGDNVAQLGRALDVDGNSNGQVVIRDSAINEGFNIAQPWAAAVGSGRPFSGNTGSADDKGNLQRNLNDNGFNRMWEYNNRGVGSTVVAEPKQ
>NZ_CP054303.1|WP_004179084.1|702102_704790_+|cation-transporting-P-type-ATPase
MNTDKPGAPYYQRSVEETLASVQSSPEGISGTEAATRLQQYGENALPQKPGKPAWLRFIAHFNDVLIYVLLAAALLKAVMGHWIDMAVILAVAVVNALIGFIQESNAEKSLQSIRNMLSSEAVAIRQGNHETIPTTSLVPGDIVVIRAGDRIPADLRVIEAHNLRVEEAILTGESTVVEKTTEPLSGDLPLGDRSNLLFSGTTVSSGAGKGIVVATGGDTELGHINQMMAGIEKHRTPLLVQMDKLGKAIFILILVMMAALFVFSLLFRDMPVSELMLSLISLAVASVPEGLPAIISIILSLGVQAMARQKAIIRKLPTVETLGAMTVICSDKTGTLTMNEMTVKAVITADSVYRVEGDSYEPVGKIHAIDDPTPVTIAPGSLFERYLRTIDLCNDSQLIKEESGLWKITGGPTEGALKVLAAKVTLPPLTSELRSKIPFDSQYKYMSTLYRLGEEEVVLVTGAPDVLFRLCQYQQSDSGLQPLDLPYWEGKIEEYAREGLRMVAAAWKPAAAGQTELTHQDLQQGVILLGVAGMMDPPRPEAITAIADCLQAGIRVKMITGDHPQTAMSIGKMLGIGNAGNAITGRELEVMDDAQLSVAAQQFDIFARTSPEDKFRLVQALQSKKEIVGMTGDGVNDAPALKQADVGVAMGIKGTEVTKEAADMVLTDDNFATIASAVREGRRVYDNLKKTILFVMPTNLAQGLLIVIALLAGNVLPLTPVLILWMNMATSATLSFGLAFEAGEKNIMRRPPRDPKIHVMDGFAIWRVAFVGSMIAVSAFILEAWLQPRGYSPEFIRTVLLQTLVTAQWFYMLNCRVSDGFSLTKGLLANKGIWIVSGVLLLLQLLIIYAPFMQMLFGTTGLPFRYWVITFIIGFAMFLIVELEKPLTRKWRSA
>NZ_CP054303.1|WP_004183465.1|701619_702051_+|universal-stress-protein
MYKNIVVPVDVFDAGLADKALSHAKFLAQHSAGQIHLIHVIPAFSPVLTRGFISDARKMEDHLLNTAKEKLSELVKKNGLAEDASHLYVRSGNVRDQVIALADELKADVVIVGSRNPGIQTHLLGSEAANIVRYAHVPVFVVR
>NZ_CP054303.1|WP_004183463.1|700000_701086_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MNRYFSLIPVVIIFTTACDQKAPTVESAPRMVKVAQVTAVGNTQQRTFPARIESGDSTELSFKRGGQVESLDIRQGASVAQGQTLARLNAREAQQRVNERQTAATLAQRQFDRFQTLAGRQAISQAEMDVQRANRDAANAALKIAREELAQMSLIAPFSGIAAGVHIRNHQVVAAGQPVITLTRTDLLDVVFSIPENLFTSLDIRNTAYRPVVRINTLPGREFTAEYKEHTGSSDNSTLTWQIVLTMPRPDDFPAVGGVSGTVTVNLGNLPASAGRETLIVPAEAVFNPDNRPKNEPVVWVVKGDNAHRYLEERKVAVGEVTSQGVAITDGLRAGEQVVAAGVSELHAGQPVRVWTRERGL
>NZ_CP054303.1|WP_002895575.1|715175_715652_-|kinase-inhibitor
MKLISHDLQDGGKLPNRHVFNGMGYDGDNISPHLMWDDVPAGTKSFVVTCYDPDAPTGSGWWHWVVANLPADTRVLPQGAGSGQAELPEEAVQTRTDFGKAGYGGAAPPKGETHRYIFTVHALDVEKIEVDAEASGAMVGFNVHFHSLASASITALFS
>NZ_CP054303.1|WP_004176805.1|715722_717012_-|adenosylmethionine--8-amino-7-oxononanoate-transaminase
MTLDDLAFDRRHIWHPYTSMTSPLPVYPVVSAHGCELSLAGGEQLVDGMSSWWAAIHGYNHPRLNAALKGQIDQMSHVMFGGITHPPAVALCRQLVAMTPASLECVFLADSGSVAVEVAMKMALQYWQAKGEPRRRFLTFRNGYHGDTFGAMSVCDPQNSMHSLWQGYLPDNLFAPAPQSRFDGEWDEMDMVPFARLMAAHRHEIAAVILEPIVQGAGGMRMYHPEWLKRVRKMCDREGILLIADEIATGFGRTGKLFACEHAGITADILCLGKALTGGTMTLSAAITTRTVAETISNGEAGCFMHGPTFMGNPLACAVASESLRLLESGEWQPQVAAIEAQLQAELAPARGSALVADVRVLGAIGVVETRRPVNMAALQRFFVEQGVWIRPFGRLIYLMPPYIITPEQLTRLTRAVNQAVQDETFFSE
>NZ_CP054303.1|WP_002895580.1|717225_718266_+|biotin-synthase-BioB
MAHQPRWTMSQVTELFNKPLIDLLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSARYKTGLEAERLMEVEQVLESARQAKNAGSTRFCMGAAWKNPNDRDMPYLEQMVKGVKALGLESCMTLGTLTDSQAQRLAEAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGIKVCSGGIVGLGESVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAIARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGINPQQTAVLEGDNEQQQRLEQALLTPDTEEYYNAAAL
>NZ_CP054303.1|WP_004183475.1|718262_719420_+|8-amino-7-oxononanoate-synthase
MSWQQRIDRALDERRAAEAFRRRLPVTHGAGRWLEREGERWLNFSSNDYLGLSQHPAIIAAWQQGATRYGVGAGGSGHVSGYSEAHRALEEALADWLGYPRALLFISGFAANQALIAALVEKDDRIVADRLSHASLLEAASLSPAQLRRFTHNDPQQLAQLLAKPLAGEQLAVTEGIFSMDGDSAPLAAIHAATQAAGAVLLVDDAHGVGVVGDEGRGSCAAQAVRPELLVVTFGKAFGVSGAAVLCDEAMADYLLQFARHLIYSTAMPPAQAVALSAALGIIRSDEGQQRRDILAARIRQFREGMGEVSLGLTDSVSAIQPLIVGDNARALNLACRLRDAGCWATAIRPPTVPVGSARLRLTLTAAHHTEDINRLLEVLHGHSE
>NZ_CP054303.1|WP_004142100.1|719403_720159_+|malonyl-ACP-O-methyltransferase-BioC
MATVNKQAVAAAFGRAASGYTQHDELQRRCADLLLRQLARRDFAQVLDAGCGPGSMSRYWREAGSVVTALDLSAGMLAQAQRNDAAQHYLLGDIEALPLPDACVDLAWSNLAVQWCDDLRAAIGELYRVARPGGRVAFSTLLADSLPELNQAWQAIDDRPHANRFLSEAAVRAALSGLRATGEVHQISLPFADALSAMRSLKGIGATHLHQGRTAAPLGRGKLRELQLAWPQRQGICPLTYSLFTGVIERD
>NZ_CP054303.1|WP_002895648.1|720151_720874_+|ATP-dependent-dethiobiotin-synthetase-BioD
MTKRFFVTGTDTEVGKTIASSALLQAANLLGFHTAGYKPVASGSELTGDGLRNEDALALQRHSRVALRYDQVNPYTFAEPTSPHIISADEGRPIAAARLSSGLRELEGLADWVLVEGAGGWFTPLSDSLTFADWAQAEQLPVILVVGVKLGCINHAMLTAQAVRQAGLPLAGWIANDVQPPGKRHAEYLATLKNRLAAPFLGEIPWLADIAQRDDLGQYLDLRALDPALSTAPAAAHPAP
>NZ_CP054303.1|WP_004152853.1|720815_721538_-|ATP-binding-cassette-domain-containing-protein
MLNLQAVNHFYGNQHSLWNVDLVLRPGECIGVLGREGMGKTTLVNCIAGHLPVASGRMTWHDIGAPPQDLTPLSAQSRSAIGIGYVPQDKRIFSQLSVEENLHIALAAGKPGANASGGEIYEHFPELYALRQRKGASLSDDDQYQLALARALIVQPRLLILDEPSRGRGPRCLQKLADLLLRLNRDIGLTVLLAEQHLPFIRRVADRFCVLHRGRNVAEGDIMALDEPLLAQWITPDPAP
>NZ_CP054303.1|WP_002895652.1|721624_721837_-|hypothetical-protein
MDNCPQPKTTAARRLSPFAVNRVAKNFYRTIFDNYPLKAARFLLLFAPPFSVGHRKSAAPALTRPDGIGV
>NZ_CP054303.1|WP_040211196.1|722248_724270_+|excinuclease-ABC-subunit-B
MSKSFVLHSAFRPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIEQMRLSATKALLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRVRGEVIDVFPAESDDIALRIELFDEEVERLSLFDPLTGHVEGTVPRYTIYPKTHYVTPRERIVQAMEEIKLELAERRKVLLANNKLLEEQRLTQRTQFDLEMMNELGYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVIDESHVTVPQIGGMYRGDRARKETLVEYGFRLPSALDNRPMKFEEFEALAPQTIYVSATPGAYELDKSGGEVVDQVVRPTGLLDPIIEVRPVATQVDDLLSEIRLRTAINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIGRAARNVNGKAILYGDKITPSMAKAIGETERRREKQQRYNEEHGIVPQGLNKKVVDILQLGQGLAKTKAKGRGKAKAVEPAGLSAVDMTPKALQQKIHELEGQMMQYAQNLEFEEAAQIRDQLHQLRELFIAAS
>NZ_CP054303.1|WP_004147680.1|724518_725616_-|two-component-system-sensor-histidine-kinase-PmrB
MALFATETWTMRHRLLLTIGAILVVCQLISVFWLWHESKEQIQLLVASAIEGHNNQKHVEHEVREAVASLLVPSLLIVGLALYISMLAVRKITRPLSRLQSELENRTPDNLTPIVLSESVPEVTAVTTALNQLVSRLNLTLDRERLFTADVAHELRTPLAGLRLHLELLAKVHGMGVDPLIQRLDQMTTSISQLLQLARVGQSFSAGSYQQVLLLDDVVKPLQDELEAMLAQRQQRLLLTDIENEAVVSGDATLIRVILRNLVENAHRYSPEGSTIRVSVKAGLMPVMAVEDEGPGIDEAKSGELSKAFVRMDSRYGGIGLGLSIVTRIAQLHDAQFFLHNRQPGPGVRAWVLFPQRGGQNVSTH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054303_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054303_2

946984-950564

Orphan

Consensus_repeat	Method
GACAGCGANTCGGANTCNGACAG	CRT

53 spacers

The CRISPR arrays of NZ_CP054303_2

>merge|NZ_CP054303|2|946984-950564|CRT
GACAGCGACTCTGACTCTGACAGCGACTCGGATTCGGACAGTGATTCGGACTCCGACAGCGACAGTGATTCGGATTCTGACAGCGACTCTGACTCTGACAGCGACTCGGACTCTGACTCCGATTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCTGACAGCGATTCGGATTCTGACAGCGACTCCGACTCGGACAGCGACTCTGACTCCGACAGCGACAGCGATTCGGATTCCGACAGTGACTCGGACTCTGACAGCGATTCGGACTCGGACAGTGATTCGGATTCGGACAGCGATTCCGACTCCGACAGTGACTCCGACTCTGATTCCGACAGCGATTCGGATTCCGACAGTGACTCCGACTCCGACAGCGACAGTGATTCGGATTCTGACAGCGACTCAGACTCCGACAGCGACTCTGACTCCGACAGCGACTCCGATTCGGACAGCGATTCGGATTCCGACAGCGACTCCGACTCTGATTCCGACAGCGATTCGGATTCCGACAGTGATTCCGATGCTGACAGCGATTCGGACTCCGACAGCGACTCGGATTCTGACAGCGACTCGGACTCTGACAGTGATTCGGACTCCGACAGCGACAGTGATTCGGATGCTGACAGCGACTCTGACTCTGACAGCGACAGTGATTCGGATGCTGACAGCGACTCTGACTCCGACAGCGATTCGGATTCTGACAGCGATTCGGACTCCGACAGCGACTCTGACTCCGATTCCGATTCCGACAGCGACTCGGACTCTGACAGTGACTCGGATTCTGACAGCGATTCTGACTCGGACAGCGACTCTGACTCCGACAGCGACTCTGACTCCGACAGCGACTCGGACTCCGACAGTGATTCGGATTCGGACAGCGACTCCGACTCTGACAGCGATTCGGACTCTGACAGCGACTCCGACTCCGACAGCGACAGTGATTCGGATTCCGACAGCGATTCGGACTCTGACAGTGACTCGGATTCTGACAGCGATTCCGACTCTGACAGCGACTCGGACGCTGACAGCGATTCGGATTCTGACAGCGATTCTGACTCTGACAGTGATTCCGATTCGGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCCGACAGCGACTCGGATTCCGACTCTGACAGCGACTCGGACTCTGACTCCGACTCCGATTCCGACAGCGACTCGGATTCTGACAGTGATTCGGACTCTGACAGCGACTCGGATTCTGACAGTGACTCGGATTCTGACAGCGACTCGGATGCTGACAGCGACTCGGATGCTGACAGCGACTCGGATTCTGACAGTGACTCCGACTCGGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCTGACAGTGATTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCCGATTCGGACAGCGATTCCGACAGCGACTCGGACTCCGACAGCGACTCGGACTCCGACAGCGACTCGGATTCTGACAGCGATTCCGACTCCGACAGTGACTCCGACTCTGACAGCGATTCGGACTCCGACAGCGACTCGGATTCTGACAGCGACTCGGATGCTGACAGCGACTCGGATGCTGACAGCGATTCGGACTCCGACAGCGACTCGGACTCCGACAGCGACTCGGATTCTGACTCCGACTCTGATTCCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCCGACAGTGATTCGGACTCGGACAGCGACTCTGATTCCGACAGCGACTCTGACTCCGACAGCGACTCCGATTCCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCTGACAGTGACTCCGACTCGGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCTGACAGTGATTCGGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCCGATTCGGACAGCGATTCCGACAGCGACTCGGACTCCGACAGCGACTCGGATTCTGACTCCGACTCTGATTCCGACAGCGACTCGGACTCCGACAGCGACTCTGACTCTGACAGCGACTCGGACTCCGACAGTGATTCGGACTCTGACAGCGACTCGGATTCCGACAGCGACTCGGACTCTGACAGCGACTCGGACTCCGACAGCGACTCGGACTCCGACAGCGACTCGGATTCTGACTCCGACTCTGATTCCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCGGACAGTGATTCGGACTCGGACAGCGACTCTGATTCCGACAGCGACTCTGACTCCGACAGCGACTCCGATTCCGACAGCGATTCGGATTCTGACAGTGATTCCGATTCCGACAGTGATTCGGATTCTGACAGTGATTCCGATTCCGACAGCGATTCGGATTCCGACAGCGATTCGGATTCCGACAGCGACTCCGATTCGGACAGTGACTCCGACTCTGACAGCGACTCCGATTCGGACAGTGATTCCGACTCTGACAGCGATTCGGACTCCGACAGTGACTCGGATGCTGACAGCGATTCGGATTCTGACAGCGATTCGGACTCTGACAGTGACTCGGATTCGGACAGCGACTCCGACTCCGACTCTGACAGTGACTCCGATTCGGACAGCGATTCCGACAGCGACTCCGACTCGGACAGCGACTCGGATTCCGACAGCGACTCGGATTCGGACAGCGATTCCGACTCTGACAGTGACTCGGATTCCGACAGCGATTCTGACTCGGACAGCGACTCCGACTCCGACAGCGATTCGGACTCTGATAGTGACTCCGATTCGGACAGCGACTCGGATGCTGACAGCGATTCGGATTCTGACAGTGATTCCGACTCGGACAGCGATTCCGATTCCGACAGTGATTCCGACTCTGACAGCGATTCGGACTCTGACAGTGATTCCGACTCTGACAGCGACTCGGACTCCGACAGCGATTCGGACTCTGACAGCGATTCGGACTCCGACAGCGACTCGGATTCTGACAGCGACTCTGACTCCGACAGCGACTCTGACTCTGACAGCGACTCTGACTCTGACAGCGATTCGGATTCTGACAGCGATTCGGACTCTGACAGTGACTCGGATTCGGACAGCGACTCCGACTCCGACTCTGACAGTGACTCCGATTCGGACAGCGATTCCGACAGCGACTCCGACTCGGACAGCGACTCGGATTCCGACAGCGACTCGGATTCGGACAGCGATTCCGACTCTGACAGTGACTCGGATTCCGACAGCGATTCTGACTCGGACAGCGACTCCGACTCCGACAGCGATTCGGACTCTGATAGTGACTCCGATTCGGACAGCGACTCGGATGCTGACAGCGATTCGGATTCTGACAGTGATTCCGACTCGGACAGCGATTCCGATTCCGACAGTGATTCGGACTCTGACAGTGATTCGGACTCTGACAGCGACTCGGATTCTGACAGTGATTCAGACTCTGACAGCGATTCCGACTCCGACAGCGACTCGGACTCTGACTC

>NZ_CP054303|2|1|946984-950564|CRT
GACAGCGACTCTGACTCTGACAG	CGACTCGGATTCGGACAGTGATTCGGACTCCGACAGCGACAGTGATTCGGATTCT
GACAGCGACTCTGACTCTGACAG	CGACTCGGACTCTGACTCCGATTCTGACAGCGATTCCGACTCCGACAGCGACTCGGATTCTGACAGCGATTCGGATTCT
GACAGCGACTCCGACTCGGACAG	CGACTCTGACTCCGACAGCGACAGCGATTCGGATTCCGACAGTGACTCGGACTCT
GACAGCGATTCGGACTCGGACAG	TGATTCGGATTCGGACAGCGATTCCGACTCCGACAGTGACTCCGACTCTGATTCC
GACAGCGATTCGGATTCCGACAG	TGACTCCGACTCCGACAGC
GACAGTGATTCGGATTCTGACAG	CGACTCAGACTCCGACAGCGACTCTGACTCCGACAGCGACTCCGATTCG
GACAGCGATTCGGATTCCGACAG	CGACTCCGACTCTGATTCC
GACAGCGATTCGGATTCCGACAG	TGATTCCGATGCTGACAGCGATTCGGACTCCGACAGCGACTCGGATTCT
GACAGCGACTCGGACTCTGACAG	TGATTCGGACTCCGACAGCGACAGTGATTCGGATGCT
GACAGCGACTCTGACTCTGACAG	CGACAGTGATTCGGATGCTGACAGCGACTCTGACTCC
GACAGCGATTCGGATTCTGACAG	CGATTCGGACTCCGACAGCGACTCTGACTCCGATTCCGATTCC
GACAGCGACTCGGACTCTGACAG	TGACTCGGATTCTGACAGCGATTCTGACTCGGACAGCGACTCTGACTCCGACAGCGACTCTGACTCC
GACAGCGACTCGGACTCCGACAG	TGATTCGGATTCGGACAGCGACTCCGACTCTGACAGCGATTCGGACTCT
GACAGCGACTCCGACTCCGACAG	CGACAGTGATTCGGATTCCGACAGCGATTCGGACTCTGACAGTGACTCGGATTCT
GACAGCGATTCCGACTCTGACAG	CGACTCGGACGCTGACAGCGATTCGGATTCT
GACAGCGATTCTGACTCTGACAG	TGATTCCGATTCGGACAGCGACTCTGACTCCGACAGC
GACAGTGATTCGGATTCCGACAG	CGACTCGGATTCCGACTCTGACAGCGACTCGGACTCTGACTCCGACTCCGATTCC
GACAGCGACTCGGATTCTGACAG	TGATTCGGACTCTGACAGCGACTCGGATTCT
GACAGTGACTCGGATTCTGACAG	CGACTCGGATGCTGACAGCGACTCGGATGCT
GACAGCGACTCGGATTCTGACAG	TGACTCCGACTCGGACAGCGACTCTGACTCCGACAGC
GACAGTGATTCGGATTCTGACAG	TGATTCGGACTCTGACAGCGATTCCGACTCC
GACAGCGACTCGGATTCCGACAG	CGACTCCGATTCGGACAGCGATTCC
GACAGCGACTCGGACTCCGACAG	CGACTCGGACTCCGACAGCGACTCGGATTCT
GACAGCGATTCCGACTCCGACAG	TGACTCCGACTCTGACAGCGATTCGGACTCC
GACAGCGACTCGGATTCTGACAG	CGACTCGGATGCTGACAGCGACTCGGATGCTGACAGCGATTCGGACTCC
GACAGCGACTCGGACTCCGACAG	CGACTCGGATTCTGACTCCGACTCTGATTCC
GACAGTGATTCGGACTCCGACAG	CGATTCCGATTCCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCC
GACAGTGATTCGGACTCGGACAG	CGACTCTGATTCCGACAGCGACTCTGACTCCGACAGCGACTCCGATTCC
GACAGTGATTCGGACTCCGACAG	CGATTCCGATTCTGACAGTGACTCCGACTCGGACAGCGACTCTGACTCCGACAGCGACAGTGATTCGGATTCT
GACAGTGATTCGGACTCTGACAG	CGATTCCGACTCCGACAGCGACTCGGATTCCGACAGCGACTCCGATTCGGACAGCGATTCC
GACAGCGACTCGGACTCCGACAG	CGACTCGGATTCTGACTCCGACTCTGATTCCGACAGCGACTCGGACTCCGACAGCGACTCTGACTCT
GACAGCGACTCGGACTCCGACAG	TGATTCGGACTCTGACAGCGACTCGGATTCCGACAGCGACTCGGACTCT
GACAGCGACTCGGACTCCGACAG	CGACTCGGACTCCGACAGCGACTCGGATTCTGACTCCGACTCTGATTCC
GACAGTGATTCGGACTCCGACAG	CGATTCCGATTCCGACAGTGATTCGGACTCCGACAGCGATTCCGATTCG
GACAGTGATTCGGACTCGGACAG	CGACTCTGATTCCGACAGCGACTCTGACTCCGACAGCGACTCCGATTCC
GACAGCGATTCGGATTCTGACAG	TGATTCCGATTCCGACAGTGATTCGGATTCTGACAGTGATTCCGATTCC
GACAGCGATTCGGATTCCGACAG	CGATTCGGATTCCGACAGCGACTCCGATTCGGACAGTGACTCCGACTCT
GACAGCGACTCCGATTCGGACAG	TGATTCCGACTCTGACAGCGATTCGGACTCCGACAGTGACTCGGATGCT
GACAGCGATTCGGATTCTGACAG	CGATTCGGACTCTGACAGTGACTCGGATTCGGACAGCGACTCCGACTCCGACTCT
GACAGTGACTCCGATTCGGACAG	CGATTCCGACAGCGACTCCGACTCGGACAGCGACTCGGATTCC
GACAGCGACTCGGATTCGGACAG	CGATTCCGACTCTGACAGTGACTCGGATTCC
GACAGCGATTCTGACTCGGACAG	CGACTCCGACTCCGACAGCGATTCGGACTCTGATAGTGACTCCGATTCGGACAGCGACTCGGATGCT
GACAGCGATTCGGATTCTGACAG	TGATTCCGACTCGGACAGCGATTCCGATTCCGACAGTGATTCCGACTCT
GACAGCGATTCGGACTCTGACAG	TGATTCCGACTCTGACAGCGACTCGGACTCC
GACAGCGATTCGGACTCTGACAG	CGATTCGGACTCCGACAGCGACTCGGATTCTGACAGCGACTCTGACTCC
GACAGCGACTCTGACTCTGACAG	CGACTCTGACTCTGACAGCGATTCGGATTCT
GACAGCGATTCGGACTCTGACAG	TGACTCGGATTCGGACAGCGACTCCGACTCCGACTCTGACAGTGACTCCGATTCGGACAGCGATTCC
GACAGCGACTCCGACTCGGACAG	CGACTCGGATTCCGACAGCGACTCGGATTCG
GACAGCGATTCCGACTCTGACAG	TGACTCGGATTCCGACAGCGATTCTGACTCG
GACAGCGACTCCGACTCCGACAG	CGATTCGGACTCTGATAGTGACTCCGATTCG
GACAGCGACTCGGATGCTGACAG	CGATTCGGATTCTGACAGTGATTCCGACTCG
GACAGCGATTCCGATTCCGACAG	TGATTCGGACTCTGACAGTGATTCGGACTCT
GACAGCGACTCGGATTCTGACAG	TGATTCAGACTCTGACAGCGATTCCGACTCC
GACAGCGACTCGGACTCTGACTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054303.1\|WP_173819884.1\|968143_969346_-\|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI	unknown	unknown	gnl\|CDD\|185082
NZ_CP054303.1\|WP_002898422.1\|938474_940610_-\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
NZ_CP054303.1\|WP_004144085.1\|943877_944291_+\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP054303.1\|WP_002898408.1\|935583_936654_-\|porin-OmpA	unknown	unknown	gnl\|CDD\|236764
NZ_CP054303.1\|WP_002898441.1\|967766_968084_-\|heat-shock-protein-HspQ	unknown	unknown	gnl\|CDD\|184526
NZ_CP054303.1\|WP_004210987.1\|960149_962297_+\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|274550
NZ_CP054303.1\|WP_004150835.1\|970945_971227_+\|acylphosphatase	unknown	unknown	gnl\|CDD\|184675
NZ_CP054303.1\|WP_009308304.1\|941198_943253_+\|DNA-helicase-IV	unknown	unknown	gnl\|CDD\|182930
NZ_CP054303.1\|WP_002898418.1\|937006_937516_-\|cell-division-inhibitor-SulA	unknown	unknown	gnl\|CDD\|182577
NZ_CP054303.1\|WP_004150836.1\|937864_938461_+\|TfoX/Sxy-family-DNA-transformation-protein	unknown	unknown	gnl\|CDD\|377439
NZ_CP054303.1\|WP_002898432.1\|943264_943723_-\|methylglyoxal-synthase	unknown	unknown	gnl\|CDD\|179969
NZ_CP054303.1\|WP_016529118.1\|933056_934814_-\|Lon-protease-family-protein	unknown	unknown	gnl\|CDD\|223994
NZ_CP054303.1\|WP_086627174.1\|963567_966702_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP054303.1\|WP_042939439.1\|969536_970091_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|182092
NZ_CP054303.1\|WP_042939438.1\|970108_970897_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP054303.1\|WP_004179227.1\|958716_960153_+\|TolC-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|273829
NZ_CP054303.1\|WP_042939447.1\|966848_967724_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054303.1\|WP_002898425.1\|940627_941074_-\|YccF-domain-containing-protein	unknown	unknown	gnl\|CDD\|225841
NZ_CP054303.1\|WP_004141638.1\|962293_963514_+\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP054303.1\|WP_002898404.1\|934999_935452_+\|macrodomain-Ter-protein-MatP	unknown	unknown	gnl\|CDD\|235344

Protein	Function_ID	Function_description	E-value
NZ_CP054303.1\|WP_173819884.1\|968143_969346_-\|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI	gnl\|CDD\|185082	PRK15128, PRK15128, 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI.	0
NZ_CP054303.1\|WP_002898422.1\|938474_940610_-\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
NZ_CP054303.1\|WP_004144085.1\|943877_944291_+\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	1.40083e-74
NZ_CP054303.1\|WP_002898408.1\|935583_936654_-\|porin-OmpA	gnl\|CDD\|236764	PRK10808, PRK10808, outer membrane protein A; Reviewed.	0
NZ_CP054303.1\|WP_002898441.1\|967766_968084_-\|heat-shock-protein-HspQ	gnl\|CDD\|184526	PRK14129, PRK14129, heat shock protein HspQ; Provisional.	3.13982e-74
NZ_CP054303.1\|WP_004210987.1\|960149_962297_+\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|274550	TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0
NZ_CP054303.1\|WP_004150835.1\|970945_971227_+\|acylphosphatase	gnl\|CDD\|184675	PRK14426, PRK14426, acylphosphatase; Provisional.	1.58986e-59
NZ_CP054303.1\|WP_009308304.1\|941198_943253_+\|DNA-helicase-IV	gnl\|CDD\|182930	PRK11054, helD, DNA helicase IV; Provisional.	0
NZ_CP054303.1\|WP_002898418.1\|937006_937516_-\|cell-division-inhibitor-SulA	gnl\|CDD\|182577	PRK10595, PRK10595, cell division inhibitor SulA.	1.30492e-94
NZ_CP054303.1\|WP_004150836.1\|937864_938461_+\|TfoX/Sxy-family-DNA-transformation-protein	gnl\|CDD\|377439	pfam04994, TfoX_C, TfoX C-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the C-terminal presumed domain of TfoX. The domain is found associated with pfam00383 in Neisseria meningitidis TadA. It is also found as an isolated domain in some proteins suggesting this is an autonomous domain.	1.39504e-31
NZ_CP054303.1\|WP_002898432.1\|943264_943723_-\|methylglyoxal-synthase	gnl\|CDD\|179969	PRK05234, mgsA, methylglyoxal synthase; Validated.	3.53529e-94
NZ_CP054303.1\|WP_016529118.1\|933056_934814_-\|Lon-protease-family-protein	gnl\|CDD\|223994	COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP054303.1\|WP_086627174.1\|963567_966702_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.22016e-48
NZ_CP054303.1\|WP_042939439.1\|969536_970091_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|182092	PRK09818, PRK09818, kinase inhibitor.	9.3869e-83
NZ_CP054303.1\|WP_042939438.1\|970108_970897_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	6.80227e-20
NZ_CP054303.1\|WP_004179227.1\|958716_960153_+\|TolC-family-outer-membrane-protein	gnl\|CDD\|273829	TIGR01844, Proteases_secretion_protein_PrtF, type I secretion outer membrane protein, TolC family. Members of this model are outer membrane proteins from the TolC subfamily within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT subfamily, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (E. coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa). [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Porins].	2.44996e-74
NZ_CP054303.1\|WP_002898425.1\|940627_941074_-\|YccF-domain-containing-protein	gnl\|CDD\|225841	COG3304, COG3304, Predicted membrane protein [Function unknown].	3.05694e-71
NZ_CP054303.1\|WP_004141638.1\|962293_963514_+\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	4.66714e-100
NZ_CP054303.1\|WP_002898404.1\|934999_935452_+\|macrodomain-Ter-protein-MatP	gnl\|CDD\|235344	PRK05097, PRK05097, macrodomain Ter protein MatP.	1.02992e-100

>NZ_CP054303.1|WP_004144085.1|943877_944291_+|CoA-binding-protein
MKENDIAGILTSTRTIALVGASDKPDRPSYRVMKYLLDQGYHVIPVSPKVAGKTLLGQQGYATLADVPEKVDMVDVFRNSEAAWGVAQEAIAIGAKTLWLQLGVINEQAAVLAREAGLSVVMDRCPAIELPRLGLAK
>NZ_CP054303.1|WP_002898432.1|943264_943723_-|methylglyoxal-synthase
MELTTRTLPAQKHIALVAHDHCKDMLMKWVARHQALLAQHILYATGTTGNLVSRATGLEVNAMLSGPMGGDQQVGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNVSTADFIIQSPHFGQPLDILIPDYPRYLAERLK
>NZ_CP054303.1|WP_009308304.1|941198_943253_+|DNA-helicase-IV
MELKATTLGKRMAQHPYDRVQLLNAGVKVSGDRHEYLIPFNQLLSVHCKRGLVWGELEFVLPDGKVVRLHGTEWSETQRFYHHLHTLWQQWSTEMSDIAAGVLKQQLATIEHTRAEGKWLTRQQVADVQDNIRHALTGLPMPTSRLDAFDNCRELWRECQRWLGDIEATRLAHNQAFTEAMLEQYREFFDSVESSPLNASQARAVVNGERSLLVLAGAGSGKTSVLVARAGWLLARGEAAADQILLLAFGRQAAQEMDERIRERLASDDITARTFHSLALHIIQQGSKKVPTISKLESDTAARHALLLKSWQKQCQEKKAQAKGWRLWLEEEMGWQLPEGDFWQDKKVQRRMASRLDRWVSLMRMHGGSQAEMIAGAPEAVRDLFSKRVKLMSPLMKDWKAALKAENAVDFSGLIHQAVNILDKGRFVSPWKHILVDEFQDISPQRASLLAALRRQNSQTTLFAVGDDWQAIYRFSGAQLSLTTAFNHYFGEGDCCALDTTYRFNGRIGEIANGFIQQNPHQLSKPLNSLMAGDKKAVTLLADDKLDDLLDKLSGYVKPEQRILLLARYHHLKPEALNKAATRWPHLQLDFMTIHASKGQQADFVIVLGLQEGEDAFPAPARESIMEQALLPQPEDFPDAEERRLLYVALTRARHRVWLLFNKAQPSPFVEILQALDVPVARKP
>NZ_CP054303.1|WP_002898425.1|940627_941074_-|YccF-domain-containing-protein
MRTILNILNFILGGFATTLGWLLATLVSIILIVTLPLTRSCWEITRLSLFPYGNEAIHVDELEPGRKNGLLNAGGTVLNILWFIFFGWWLCLMHIFSGIAQCLTIIGIPVGIANFKIAAIALWPVGRRVVSVETARAAREANARRRFQ
>NZ_CP054303.1|WP_002898422.1|938474_940610_-|TIGR01666-family-membrane-protein
MISPLLRRYTWNSAWLYNVRIFIALCGTTLFPWWIGEVKLTIPLTLGVVAAALTDLDDRLAGRLRNLAITLVCFFIASASVELLFPWPPLFALGLTVSTIGFILLGGLGQRYATIAFGALLIAIYTMLGVTLYDHWYLQPLFLLAGAVWYNLLTLSGHLIFPIRPLQDNLARSYEQLARYLELKSRLFDPDLEDESQAPLYDLALANGQLVATLNQTKVSLLTRLRGDRGQRGTRRTLQYYFVAQDIHERASSSHIQYQTLRDQFRYSDVMFRFQRMLSMQAQACQKLSRAILLREPYQHDAHFERAFMHLDAALERVRAGGASDEQLNALGYLLNNLRAIDAQLATIESVQTTAPAGSNTETLLADDRLGGLSDIWLRLQRNMSPESALFRHAVRMSLVLCAGYAFIQFTGLQHGYWILLTSLFVCQPNYNATRHRLALRIIGTLVGVAIGLPVLLLVPSVEGQLLLIVLTGVLFFAFRNVQYAHATMFITLLVLLCFNLLGEGFEVALPRIIDTLIGCAIAWAAVSFIWPDWKFRNLPRVLDRAMNANCRYLDAILEQYHQGRDNRLAYRVARRDAYNRDAELASVVSNLSTEPRADATQRETAFRLLCLNHTFTSYISALGAHREKLSTPEILALLDDAVCYVDDALHHTPADEQRVQQALNSLQSRIHHLEPRADSKEPLVLQQIGLLLALLPEICRLQQRVHAQTE
>NZ_CP054303.1|WP_004150836.1|937864_938461_+|TfoX/Sxy-family-DNA-transformation-protein
MRKLVCPRLPQFQACVSPLGQLHTRPLFGGYSLAIDDTVFAMVAEGNIYLKACEQSAAYRVEHRNPLLTLRRHGRIVPLKYYQIDDTLWRDEQQLFRLSLLSWQSAQREKNYRRASGRLKDLPNISFHMELQLIHAGIPDVRTLREVGAQEAWLRLRVNNASLSLSVLLALEGAIAGVHAAALPTPRRQELLEWAATR
>NZ_CP054303.1|WP_002898418.1|937006_937516_-|cell-division-inhibitor-SulA
MFTSAHANRSAQASAPAGHYAHRSGEQNTNGLISEIVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQSAGLPLSKVMQISQLSPSHTIDSMIRALRTGNYSVVICWLAEELTADEHERLVNAAQVGSAMGFIMRPVRNQGTLGRQLSGLKIHSNLYH
>NZ_CP054303.1|WP_002898408.1|935583_936654_-|porin-OmpA
MKKTAIAIAVALAGFATVAQAAPKDNTWYAGGKLGWSQYHDTGFYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGVEWAVTRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRFGQEDAAPVVAPAPAPAPEVATKHFTLKSDVLFNFNKATLKPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSEAYNQQLSEKRAQSVVDYLVAKGIPAGKISARGMGESNPVTGNTCDNVKARAALIDCLAPDRRVEIEVKGYKEVVTQPAA
>NZ_CP054303.1|WP_002898404.1|934999_935452_+|macrodomain-Ter-protein-MatP
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQAAVDDLLTLENEPVLVHAWIEQHMNPALMNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFVVWQRLAGLAQRRGKTLSETIVQLIEDAEHKEKYASKMSSLKHDLQVLLGKE
>NZ_CP054303.1|WP_016529118.1|933056_934814_-|Lon-protease-family-protein
MTITKLTRTDLAPDLEAYQALFAQAELSHPAPSLSGDLQPRLFYGLEQLLYTPAVSSFMLVKAPEEPEYLQWLAAETRTLHEPAAPLYGVRYEVTDAQVTLAPAQGAEDNFASTAPVVMADWVEAEQLFGCVRQFNGAITLQPGLVHQANGGVLVLSLRTLLAQPLLWVRLKNMVTRQRFDWLSMDESRPLPVSIPSMPLSLKIILVGERESLADFQEMEPELAAQAIYSEYEDTLQFADADTLKAWCQWVWQNAQQLALPGPAADAWPLLIDEGTRYTGDQETLPLSPLWITRQLREAAAFCEGEEITGEAMQTMLARRVWREGYLAERMQDEILQEQILIETEGECVGQINALSVIEFPGHPRAFGEPSRISCVVHIGDGEFIDVERKAELGGNIHAKGMMIMQAFLMSELELEQQLPFTASLTFEQSYSEVDGDSASMAELCALISALANVPINQSIAITGSVDQFGRVQPVGGLNEKIEGFFTICQQRGLTGKQGVIIPAANVRHLSLSHELRQAVADNQFAIWAIDDITEALPMLTQLMWDGEGQTLRQTIQERIAQATQQETRHRFPWPLRWLGGTSSN
>NZ_CP054303.1|WP_004179227.1|958716_960153_+|TolC-family-outer-membrane-protein
MRLFQKKGMVSVYSCSTIFLSICVVLTVDAEELSFPPTSISTQRLNDTQQVAGYSEELINPESHLAGPLDIATAVKSAVNWHPAINQQVSKLQEQVQKVDVAKAKYYPQVNAGMNNGYSNTYSDSGYSPSLVVSVSQMLYDFGKVSSSVRAADAAVAQQQAMVMLNIDQVAHDTAGAVVQLQGYQKLVKIAQAQVDSLKHIGDLIRQRNDAGATSLSDVVQTDTRVEGAQATLIQYQAALERWKATLATYLGLGSITSVTESVPQAMDAACAVSKIDYRTVPAVLAALAQATQAQAQVDNATAQMLPTISLEPQVTHYLNDNYANSAVLNKTQYSAWVKVEMPIYQGGALTASREAAQQTLSAANAGIRNAQLDASQKLSASRDEAVNLKQSIAIQRRQQLLGEQTRALYQDQYLQLGTRPLLDLLNVDQEIYQAQFNQVLTEAQLRNLELDCLFSTGKMRAVFALDNQRIQGVEIRP
>NZ_CP054303.1|WP_004210987.1|960149_962297_+|type-I-secretion-system-permease/ATPase
MSEQPQRSDIPHLQDWANAMAFVASHYRQSYSPGTLHAAAEWATQKTLPDALKHLCRHAGLHCQFLNGNDRKMSAWRLPLVVQLKDGQIGIIESFDLHNSVGIRFVKELTLLSHCPLDSLLDEIEFTVAFRPASPEKDIRTESYLTRFQPDWLRKIVLKDWRPYTHVMLASLAINILALAGILFSMQVYDRVIPAQSYPTLYVLFSGVLIAAVFNFVLKITRGHVTDLLGKRGDIRISDRVFGHALRLKNTAVPRSTGSFISQIRELEQVREMMTSTMMTVIADLPFFLLFQLVLFIVSPWLSWIAPVATILMLLPGLLLQKKLAELANKNQHESTLRNAILVESIQGLPDIKMMQAESRFLQQWNSYVAITAESGVQTRKVTHGLVSWGMSIQNLLYATVVAVGAPLVINGDITTGAMVAASMLSSRMVAPMTALCGVLARWQQVKVAKASLDNLMALPVEGGLDEPRIHRAVLHGNYEFRNAEFRYGKDNGPAPLRIKQLSIKAGEKIAVLGRIGAGKSTLLQAMMGNVELTSGELRLDDLSLPQIDLADIRRNATLLTQEARLFHGTLRENVTLGRPMASDDELVKVLELCGALEFVNKLPMGLEHLVMEGGLGLSGGQRQSLLLARALIRDPNIILLDEPTSFFDERTEKAFVEQLARWAGERTLIIATHKAAVLNIVDRILVIQDGQLALDKPKATVFEQEKARAQVVNI
>NZ_CP054303.1|WP_004141638.1|962293_963514_+|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit
MNKPTAAIFPLVKELDPVAAMADNERDEAELVKSRRLIALLALLLVVTGVWAWFATLDEVSTGTGKVIPSSREQVLQTLDGGILTELNVREGSRVAAGQVVARLDPTRSESNVGESQAKYRASLAASIRLTAEVNNQPLIFPPSLKAWPGLLAEETRLYHSRREQLTKSMRQLEQSLSLVNSELAINEKLAKTGAASNVEVLRLRQQAADIELKKIDLNTRYYVDAREQLSKANADVASLAEVIKGRADSVARLTVRSPVQGIVKNIKVNTIGGVIAPNGELMDIVPIDGRLLIEARISPRDIAFIHPDQKALVKITAYDYAIYGALNGVVETISPDTIQDEAKPDVYYYRVFIRTDHNYLENKRGKRFLIGPGMIATVDIKTGEKTVMDYLVKPFNRAKEALRER
>NZ_CP054303.1|WP_086627174.1|963567_966702_+|glycosyltransferase
MALSDLLQQACFQCKPLKTTALPADYPGWVIFFSVSDGKQRAHVHVSTAASFDQAWLAGARALQEWRKKQDNETQWLRIDIVDSVEKLTWENLLKKLNITKRNYFRFGISFDTQFTQAILEQEIAANALLYDGDNGVAAPNDINLENYGQRRFKRSLNWPSEPQQILWRFKTRSVFCDRNGAKLIEHTGRSSGYRVIGDEWQKNYLPEVIKKGSDYLARQVKKDGLYYYGWFPCFDRPVRSYNALRHASSTYSLIEGWEATKQPHLRQAIDRAIAYLVNNLISVRTLADGRQAAFLCDVENEIKLGGNAVSILALVKYTETTGDRQYLDLLSQLATGIAFMQDAQSGEFVHVLNSHDLSLKAKHRIIYYDGEAAFALMRLYSLTLAPQWLVMVEKAFEYFIRQKHWQHHDHWLSYCVNELTRFRPEERYFRFGLDNVRDHLDFVLQRVTTYPTLLELMMAAAEMIARLEASTTQRHLLDDFDKDKFYQALEARARYLLDGFFWPELAMFFKNPARIVNSFFIRHHSYRVRIDDVEHYLSGYIAYQKYFQAASKRQQSPIAAPPAPRGTTLFLLENLRDVGNGIEVAATRRARLFVEHLHTVPWLITAVWNPDLNDAVKALKARGALPEAVPVYNLYNALASCLSAGKIVPLPGLKGEVELRQTVVPKAEAPIGKNNYQLRPQGQLVEDYVDSAGNVLLRKYFDIKKANLQIIRMDVALPGGEVKSFNQQEAFFAWMLEMMLPAAGNWHFIVDKNKAWKDFVCSQPAQRMNCTVSAVIHSHHQLLNGGIKASYRHLLEQPQLVDRLIVLTDEQWQDLQQEGIPGARLVVIPNHMDDSKIPVNPQKEPSETVIYLARYSEEKQHLTLFNAFRKVSAQRPDARLHTYGVGPLRRKLSDQVKAWGLEDVIKINGFTSDIAAVHRHACCTVLCSNQEGQSLSAVEAMVYGTPLISFAIKYGPRDILQDRQAGILVPYGDEEALAAALVRVISDKALQKEMQAAAIRNARRYYATAIAGRWESWLQHNEQRMKEQEEKPLNVASLKQRVV
>NZ_CP054303.1|WP_042939447.1|966848_967724_+|hypothetical-protein
MVQESRCVKGSILLNHRLEKEYVEDDFHIFYSLQGRDALKYQYDSSGSGVPDSIKDIAGQLQAAKYLYSSVLGLRFPLQQKIYAQARQINVYVLQLPKGNGLAFDRVAAETMSDGRQLPCGLKFVLNAALEPARNITPAHEFFHLYQYGYAVFKQKWYLEGMARWMENGFKAPEKNTRRLSPLPHCDSNFTRGYNAANYWASFAQAHFADVAIPAAAQRFRYSDGSPVLIAQEVKGGAMLAPFFNQLAQGSAAQSRQLNQANIRWSEAQQRSPQFNEAICQALAAVVAEKK
>NZ_CP054303.1|WP_002898441.1|967766_968084_-|heat-shock-protein-HspQ
MIASKFGIGQQVRHTLLGYLGVIVDVDPEYSLAEPEEDEIAANDELRAAPWYHVVMEDDDGQPIHTYLAEAQLSSETRDEHPEQPSLDELAKTIRQQLQAPRLRN
>NZ_CP054303.1|WP_173819884.1|968143_969346_-|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI
MTDPLFPRLVLAKGREKSLLRRHPWIFSGGVARMEGKARSGETIDIVDHQGKWLARGAYSPSSQIRARVWTFDRNEAIDSAFFERRLQQAQTWRAWLAERDGLDSYRLIAGESDGLPGVTIDRFGNFFVLQLLSAGAEYQRAAIISALQNLFPDCAIYDRSDVAVRKKEGLELAQGPVVGKLPPALLPITEHGMKLLVDIQGGHKTGYYLDQRDSRLATRRYVADKRVLNCFSYTGGFAVSALMGGCRQVTSVDTSQEALDVARQNVEINGLDLSKAEFVRDDVFKLLRKYRDQGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGVLLTFSCSGLMTTDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
>NZ_CP054303.1|WP_042939439.1|969536_970091_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MKTGIRMAVAMVAAVSSGAMAAPFSVSSNDMRDGQPLAQQHWFAGFGCTGGNVSPQLGWKNAPAGTRSFAVTVRDPDAPTGSGWWHWTVVNIASSVFSLPAGAGDKNSATLPGGAVQGRNDFGYAGFGGACPPAGDKPHRYRFTVWALDVPTLPVDAGASGALVGYLLHSHALASAQLTAMAGR
>NZ_CP054303.1|WP_042939438.1|970108_970897_+|AraC-family-transcriptional-regulator
MESIHFQHNALTAAEITTRRLCRLHRVRLFSPALCRVKRGSKVIVQGESRVLATPQQLIVLPADVELEVINQPENGLFCSDLLSLTPELLTRFKTRYLSEPPPGRLTSLCAPLTTELAFMWQSVLQAVREGLSVALQQHQTMGLLLALYEAGYAGPLLVERQQDLSAQVRQLIMLSPAQAWSVSRVAKMLFLGESTLRRRLQQESQSFRQIVEEVRMAHALGQLQTTSRPIGEVAQNSGYQSGSRFTARFRQHYGLLPKHVR
>NZ_CP054303.1|WP_004150835.1|970945_971227_+|acylphosphatase
MASICTMAWVYGSVQGVGFRYSTQREALQLGVTGYARNLDDGGVEVLACGEAEQVEKLIAWLKAGGPRSARVDRVLTEPHQPTRSWDKFAILY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054303_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054303_3

5338132-5338217

Orphan

Consensus_repeat	Method
AATAAAAACCATAAAAACCACAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054303_3

>merge|NZ_CP054303|3|5338132-5338217|CRISPRCasFinder
AATAAAAACCATAAAAACCACAGTCATAAATCAGAGATATATCACTCCCGGGCAGTTCAGCGAATAAAAACCATAAAAACCATAGT

>NZ_CP054303|3|2|5338132-5338217|CRISPRCasFinder
AATAAAAACCATAAAAACCACAGT	CATAAATCAGAGATATATCACTCCCGGGCAGTTCAGCG
AATAAAAACCATAAAAACCATAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054303.1\|WP_173820033.1\|5344238_5346596_-\|DNA-polymerase-II	unknown	unknown	gnl\|CDD\|235595
NZ_CP054303.1\|WP_086627069.1\|5341144_5344051_-\|RNA-polymerase-associated-protein-RapA	unknown	unknown	gnl\|CDD\|235319
NZ_CP054303.1\|WP_004147026.1\|5332224_5334573_-\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|235158
NZ_CP054303.1\|WP_002888353.1\|5346771_5347467_-\|L-ribulose-5-phosphate-4-epimerase	unknown	unknown	gnl\|CDD\|236181
NZ_CP054303.1\|WP_002888324.1\|5329070_5329892_-\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	unknown	unknown	gnl\|CDD\|234708
NZ_CP054303.1\|WP_023279864.1\|5349117_5350827_-\|ribulokinase	unknown	unknown	gnl\|CDD\|235221
NZ_CP054303.1\|WP_002888345.1\|5338314_5339679_+\|2-hydroxycarboxylate-transporter-family-protein	unknown	unknown	gnl\|CDD\|377030
NZ_CP054303.1\|WP_086627065.1\|5336364_5337990_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225827
NZ_CP054303.1\|WP_002888332.1\|5334816_5335644_+\|co-chaperone-DjlA	unknown	unknown	gnl\|CDD\|236512
NZ_CP054303.1\|WP_002888347.1\|5339858_5340398_+\|citrate-lyase-holo-[acyl-carrier-protein]-synthase	unknown	unknown	gnl\|CDD\|163145
NZ_CP054303.1\|WP_004145972.1\|5351164_5352010_+\|arabinose-operon-transcriptional-regulator-AraC	unknown	unknown	gnl\|CDD\|236717
NZ_CP054303.1\|WP_004894323.1\|5329888_5330878_-\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	unknown	unknown	gnl\|CDD\|234696
NZ_CP054303.1\|WP_004177424.1\|5347604_5349107_-\|L-arabinose-isomerase	unknown	unknown	gnl\|CDD\|179503
NZ_CP054303.1\|WP_002888323.1\|5328690_5329068_-\|Co2+/Mg2+-efflux-protein-ApaG	unknown	unknown	gnl\|CDD\|180098
NZ_CP054303.1\|WP_002888321.1\|5327837_5328686_-\|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)	unknown	unknown	gnl\|CDD\|273208
NZ_CP054303.1\|WP_002888320.1\|5327105_5327585_+\|type-3-dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|182714
NZ_CP054303.1\|WP_002888329.1\|5330883_5332170_-\|peptidylprolyl-isomerase-SurA	unknown	unknown	gnl\|CDD\|236758
NZ_CP054303.1\|WP_023279867.1\|5335676_5336375_-\|response-regulator	unknown	unknown	gnl\|CDD\|226931
NZ_CP054303.1\|WP_002888373.1\|5352138_5352906_+\|DedA-family-protein	unknown	unknown	gnl\|CDD\|223659
NZ_CP054303.1\|WP_086627067.1\|5340472_5341132_-\|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA	unknown	unknown	gnl\|CDD\|236659

Protein	Function_ID	Function_description	E-value
NZ_CP054303.1\|WP_173820033.1\|5344238_5346596_-\|DNA-polymerase-II	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
NZ_CP054303.1\|WP_086627069.1\|5341144_5344051_-\|RNA-polymerase-associated-protein-RapA	gnl\|CDD\|235319	PRK04914, PRK04914, RNA polymerase-associated protein RapA.	0
NZ_CP054303.1\|WP_004147026.1\|5332224_5334573_-\|LPS-assembly-protein-LptD	gnl\|CDD\|235158	PRK03761, PRK03761, LPS assembly outer membrane complex protein LptD; Provisional.	0
NZ_CP054303.1\|WP_002888353.1\|5346771_5347467_-\|L-ribulose-5-phosphate-4-epimerase	gnl\|CDD\|236181	PRK08193, araD, L-ribulose-5-phosphate 4-epimerase AraD.	0
NZ_CP054303.1\|WP_002888324.1\|5329070_5329892_-\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	3.65731e-147
NZ_CP054303.1\|WP_023279864.1\|5349117_5350827_-\|ribulokinase	gnl\|CDD\|235221	PRK04123, PRK04123, ribulokinase; Provisional.	0
NZ_CP054303.1\|WP_002888345.1\|5338314_5339679_+\|2-hydroxycarboxylate-transporter-family-protein	gnl\|CDD\|377030	pfam03390, 2HCT, 2-hydroxycarboxylate transporter family. The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom. They function in the metabolism of the di- and tricarboxylates malate and citrate, mostly in fermentative pathways involving decarboxylation of malate or oxaloacetate.	4.87969e-169
NZ_CP054303.1\|WP_086627065.1\|5336364_5337990_-\|sensor-histidine-kinase	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	1.84478e-173
NZ_CP054303.1\|WP_002888332.1\|5334816_5335644_+\|co-chaperone-DjlA	gnl\|CDD\|236512	PRK09430, djlA, co-chaperone DjlA.	2.63694e-164
NZ_CP054303.1\|WP_002888347.1\|5339858_5340398_+\|citrate-lyase-holo-[acyl-carrier-protein]-synthase	gnl\|CDD\|163145	TIGR03124, citrate_citX, holo-ACP synthase CitX. Members of this protein family are the CitX protein, or CitX domain of the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems. [Energy metabolism, Fermentation, Protein fate, Protein modification and repair].	5.54697e-86
NZ_CP054303.1\|WP_004145972.1\|5351164_5352010_+\|arabinose-operon-transcriptional-regulator-AraC	gnl\|CDD\|236717	PRK10572, PRK10572, arabinose operon transcriptional regulator AraC.	0
NZ_CP054303.1\|WP_004894323.1\|5329888_5330878_-\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	gnl\|CDD\|234696	PRK00232, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed.	0
NZ_CP054303.1\|WP_004177424.1\|5347604_5349107_-\|L-arabinose-isomerase	gnl\|CDD\|179503	PRK02929, PRK02929, L-arabinose isomerase; Provisional.	0
NZ_CP054303.1\|WP_002888323.1\|5328690_5329068_-\|Co2+/Mg2+-efflux-protein-ApaG	gnl\|CDD\|180098	PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Reviewed.	7.84855e-74
NZ_CP054303.1\|WP_002888321.1\|5327837_5328686_-\|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)	gnl\|CDD\|273208	TIGR00668, Bis5'-nucleosyl-tetraphosphatase_symmetrical, bis(5'-nucleosyl)-tetraphosphatase (symmetrical). Diadenosine 5',5"'-P1,P4-tetraphosphate (Ap4A) is a regulatory metabolite of stress conditions. It is hydrolyzed to two ADP by this enzyme. Alternate names include diadenosine-tetraphosphatase and Ap4A hydrolase. [Cellular processes, Adaptations to atypical conditions].	0
NZ_CP054303.1\|WP_002888320.1\|5327105_5327585_+\|type-3-dihydrofolate-reductase	gnl\|CDD\|182714	PRK10769, folA, type 3 dihydrofolate reductase.	1.71656e-127
NZ_CP054303.1\|WP_002888329.1\|5330883_5332170_-\|peptidylprolyl-isomerase-SurA	gnl\|CDD\|236758	PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional.	0
NZ_CP054303.1\|WP_023279867.1\|5335676_5336375_-\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	8.0242e-66
NZ_CP054303.1\|WP_002888373.1\|5352138_5352906_+\|DedA-family-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	1.35562e-48
NZ_CP054303.1\|WP_086627067.1\|5340472_5341132_-\|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA	gnl\|CDD\|236659	PRK10158, PRK10158, bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA.	2.67916e-161

>NZ_CP054303.1|WP_086627065.1|5336364_5337990_-|sensor-histidine-kinase
MKLSFQYKLFISLVAFFSVLFIALGIYYYFDASRQLYQEMSARAKIQAEEIALMPNLRQQVSRHDPQAIQAFMQQIAAHSDASFIVIGDRQGVHLFHSVHPEWVGTRLVGGDNQAVLEGKSITTIRKGGLGVSLRSKTPIVDDAGRVIGIVSVGYLTSYLDSITLTKVINIFIAAVLLLIALFIFSWYFTRSIKKQIFSLEPREIGLLVRQQKAMMESIFEGVIVIDRQRRIEVINHAARSLLGLSQPARQLRGQSIDSVISPQPFFASSDMLERDTHDELCRFNQLTVLASRVRIMLENTLQGWVITFRDRNEINALTAQLSQVKRYVDNLRIMRHEQLNRMTTLSGLLHMGHYDEAIRYIQAQSEHAQELLDFISSHFHSPTLCGLLLGKATRAREKGVALSFDPACRIDRPLPSLMESELISIIGNLLDNAIEATQRAELPHEPVEVLIQLNARELIIEVADRGVGIRPDIRERIFERGVTTKTRGDHGIGLYLIEHYVTQAGGTIEVADNAPRGTIFTLFIPADAHACPQPEVHDAS
>NZ_CP054303.1|WP_023279867.1|5335676_5336375_-|response-regulator
MHHDLVDVLIIEDESELARLHAELVQKHPRLRLAGMAASLAQARQLLHATPPQLVLLDNYLPDGKGVTLMTDPALATSQCSVIFITAASDMETCSQAIRNGAFDYILKPVSWKRLSQSLERFIQFYDQQREWKIVDQQNVDSLYQLQAKNYRVDSGSKGIEEKTLALVQGLFSGREAHCFSVDEVVSAVGLSKTTARRYLEHGVETGFLEVEMLYGKIGHPRRLYRRAKVKS
>NZ_CP054303.1|WP_002888332.1|5334816_5335644_+|co-chaperone-DjlA
MQYLGKVIGVAVALLMGGGFWGVVLGFLVGHMFDRARSRRLNLFANQQERQSLFFSTTFEVMGHLTKSKGRVTEADIHVANVLMDRMNLHGASRTAAQQAFRDGKADNYPLREKMRQLRSVCFGRFDLIRMFLEIQLQAAFADGELHPNEREVLFVIADELGISRAQFDQFLRMMQGGAQFGGGSQQRSYGQHGGNAGWQQAQRGPTLEDACNVLGVKPTDDAATVKRAYRKLMNEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAWELIKEQRGF
>NZ_CP054303.1|WP_004147026.1|5332224_5334573_-|LPS-assembly-protein-LptD
MKKRIPSLLATMIASALYSQQGLAADLATQCMLGVPSYDRPLVEGRPGDLPVTINADHAKGNYPDNAVFTGNVDINQGNSRLRADEVQLHQQQAAGQAQPVRTVDALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDYQMVGRQGRGTADLMKQRGENRYTILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKLGSVPIFYSPYLQLPVGDKRRSGFLIPNAKYSTKNGVEFSLPYYWNIAPNFDATITPHYMNKRGGVMWENEFRYLTQLGSGLTEFDYLPSDKVYEDDHSSDSNSRRWLFYWNHSGVIDQVWRLNADYTKVSDPDYFNDFSSKYGSSTDGYATQKFSAGYVNQNFDATVSTKQFQVFDRESSNSYSAEPQLDVNYYQNDVGPFDTHLYGQVAHFVNSNNNMPEATRVHFEPTINLPLSNGWGSLNTEAKLLATHYQQSNLDKYNAANGTDYKESVSRVMPQFKVDGKMVFERDLQEGFTQTLEPRVQYLYVPYRDQSEIGNYDSTLLQSDYTGLFRDRTYSGLDRIASANQVTTGLTSRVYDAAAVERFNISVGQIYYFTESRTGDDNINWENNDTTGSLVWAGDTYWRIADEWGLRGGIQYDTRLDNVATGNGTIEYRRDENRLVQLNYRYASPEYIQATLPSYSTAAQYKQGISQVGMTASWPIVDRWSVVGAYYYDTNTRKAANQMLGVQYNSCCYAIRLGYERKVNGWNSNDNGGESKYDNTFGINIELRGLSSNYGLGTQQMLRSNILPYQSSL
>NZ_CP054303.1|WP_002888329.1|5330883_5332170_-|peptidylprolyl-isomerase-SurA
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIVLQMGQKMGVKISDDQLDQAIANIAKQNNMTLDQMRSRLAYEGINYNTYRNQIRKEMLISEVRNNEVRRRITVLPQEVEALAKQIGDQNDASTELNLSHILIPLPENPTSDEVAAAQEQANSIVEQARNGANFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGGTQNISVTEVHARHILLKPSPIMNDAQAQAKLEQIAAEIKSGKITFAQAAKTYSEDPGSANQGGDLGWATPDIFDPAFRDALMRLNKGQTSGPVHSSFGWHLIELLDSRQVDRTDAAQKDRAYRMLMNRKFSEEAATWMQEQRASAYVKILSN
>NZ_CP054303.1|WP_004894323.1|5329888_5330878_-|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA
MPETRKVVITPGEPAGIGPDLVVQLAQRDWPVELVICADGALLTDRAKRLGLPLSLLPYDPAQPPVPQRAGTLTLLNVPLNVPAEPGVLNVQNGAYVVETLARACDGCLSGEFAALVTGPVHKGNINDAGIAFTGHTEFFEERAKASKVVMMLATEELRVALVTTHLPLKAISEAITPELLREIITILDHDLRTKFGIGQPHVLVCGLNPHAGEGGHMGTEEIDTIIPVLEEMRAKGMNLSGPLPADTLFQPKYLDHADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGQGKADVGSFITALNLAIKMIVNTQ
>NZ_CP054303.1|WP_002888324.1|5329070_5329892_-|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA
MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELAEKMGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHSTMPYPVKEIRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTELGIDPAMRAENISVAQYCLMANWLSDNLPTKES
>NZ_CP054303.1|WP_002888323.1|5328690_5329068_-|Co2+/Mg2+-efflux-protein-ApaG
MIHSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRETEVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAVPTLIH
>NZ_CP054303.1|WP_002888321.1|5327837_5328686_-|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)
MSTYLIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLKPLLEAPDADELLNWLRRQPLLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNELSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFGHWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQYFTQPSNRQKSLDEGEAVAS
>NZ_CP054303.1|WP_002888320.1|5327105_5327585_+|type-3-dihydrofolate-reductase
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNIVISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
>NZ_CP054303.1|WP_002888345.1|5338314_5339679_+|2-hydroxycarboxylate-transporter-family-protein
MSTTDNAFSATLEPIDTPKTTLKQRWWHIMDNWKVGIVPLPLFLLAGGLIALDCLGGKLPSDIVVMVATLAFFGFACGEFGKRLPVLGKLGAAAICATFIPSALVHYGLLPDVVIESTTKFYKSTNILYLYICCIIVGSIMSMNRTTLIQGFLKIFFPMLCGEVVGMLVGIGVGTLLGMEPFQVFFFIVLPIMAGGVGEGAIPLSMGYAALMHMEQGVALGRVLPMVMLGSLTAIVISGCLNQLGKRFPHLTGEGQLMPNRSHETRSLSESEGVSGKTDVGTLASGALLAVLLYMMGMLGHKLIGLPAPVGMLFLAVLLKLANVVSPRLQEGSQMVYKFFRTAVTYPILFAVGVAITPWQELVNAFTLTNLLVIVSTVSALVATGFLVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTAGNRMSLMPFAQIATRIGGAINVSLGLLFLSHYLA
>NZ_CP054303.1|WP_002888347.1|5339858_5340398_+|citrate-lyase-holo-[acyl-carrier-protein]-synthase
MSVDTPAQAGVSIDALLAAKEQRAARQADWLAHYQQPVISLTLVTPGAVKDSIRYRNMMGVALQACDQLLWKHRWQTLDRQVLWLPTGPEALWCVAHPASEIKAMCSTLEQSHPLGRLWDIDVICPQNGLVGRQSLGESQRRCLLCDEPAHACARSRRHDTDLVVARVEQMIDAWFARD
>NZ_CP054303.1|WP_086627067.1|5340472_5341132_-|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA
MAMENYNPPQDPWLVILYQDEHIMVVNKPSGLLSVPGRLEEHKDSVMTRIQRDFPQAESVHRLDMATSGVIVVALNKAAERELKRQFREREPKKQYVARVWGHPQPAEGLVDLPLICDWPNRPKQKVCYETGKAAQTEYEVLEYAEDNTARVRLKPITGRSHQLRVHMLALGHPILGDRFYATPEALAMAPRLLLHAETLTITHPAYGNTMTFRAPIDF
>NZ_CP054303.1|WP_086627069.1|5341144_5344051_-|RNA-polymerase-associated-protein-RapA
MPFTLGQRWISDTESELGLGTVVALDARMVTLLFPAIGENRLYSRNDSPITRVMFNPGDTITSHEGWQLHVDKVNEENGLLSYTGTRLDTQEANVTLREVLLDSKLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPWSGLRGQRTSLIPHQLHIAHDVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIVVPETLQHQWLVEMLRRFNLRFSLFDDERYAEAQHDAYNPFETEQLVICSLDFVRRSKQRLEHLCDAEWDLMVVDEAHHLVWSEEAPSREYQAIEQLAERVPGILLLTATPEQLGMESHFARLRLLDPNRFHDFEQFVEEQQNYRPVADAVALLLAGNKLSDSELNTLGDLIGEQDIEPLLQAANSDREDAQAARQELISMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIRLPLPTQYQTAIKVSGIMGARKTAEERARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATALQLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFASNLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHTCPTGRTVYDSVHDELINYLAAPESTDGFDDLIKSCRQQHDALKAQLEQGRDRLLEIHSNGGEKAQALAESIEEQDDDTSLIAFSMNLFDIVGINQDDRGENLIVLTPSDHMLVPEFPGLPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVGTLLLELIYVVEAQAPKQLQLNRFLPATPVRMLLDKNGNNLAAQVEFESFNRQLSAVNRHTGSKLVNAVQQDVHAILQQGEAQIAKAAQGLIDAARNEADEKLTAELSRLEALKAVNPNIRDDELAAIESNRQQVMDALAQAGWRLDALRLIVVTHQ
>NZ_CP054303.1|WP_173820033.1|5344238_5346596_-|DNA-polymerase-II
MTQPRAGFLLTRHWRDTPQGTELSFWLATDDGPLQVTLPPQESVAFIPEAQRAQAERLLQGEKGLRFAPLALKDFHRQPIVGLYCRAHRQLMRLEKMLRDSGVTVYEGDIRPPERYLMERFITAPVWVEGETRGSQLVNARMKPNPDYRPPLKWVSLDIETSRHGELYCIGLEGCGQRVVYMLGPEPETPPDVDFELVFIASRPLLLEKLNAWFAEHDPDVLIGWNVVQFDLRVLQKHAERYRIPLRLGRGNSELEWREHGFKNGVFFAQANGRLIIDGIDALKSAFWNFSSFSLEAVARELLGEGKAIDNPWDRMDEIDRRFHEDKPALAIYNLQDCELVTRIFHKTEIMPFLLERATVNGLPADRHGGSVAAFSHLYFPRMHRLGYVAPNLGDVPPQASPGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGLAQPDDQHSIEGFLGARFSRDKHCLPGIVSQIWHGRDEAKRQHNKPLSQALKIIMNAFYGVLGTSACRFFDPRLASSITMRGHAIMRQTKALIEAKGYDVIYGDTDSTFVWLKRPHSEAQAAEIGRELVSDVNAWWAQELSKNQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGMIQEGDAQRMVFKGLETVRTDWTPLAQQFQQELYLRIFRNQPYQDYVRETIARLMNGELDEQLVYRKRLRRPLAEYQRNVPPHVRAARLADEHNLKLGRAQQYQQRGTIKYVWTTSGPEPVDYQQSPLDYDHYLTKQLQPVAEGILPFVNDDFATIVTGQLGLF
>NZ_CP054303.1|WP_002888353.1|5346771_5347467_-|L-ribulose-5-phosphate-4-epimerase
MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDREKGVFVIKPSGVDYRVMTADDMVVVSLESGEVVEGNKKPSSDTPTHRLLYQAFPTLGGIVHTHSRHATIWAQAGQSIPATGTTHADYFYGPVPCTRLMTDAEINGDYEWETGNVIVETFRQQGIDPAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEIAYMGIFCRQLAPQLPAMQQTLLDKHYLRKHGAKAYYGQ
>NZ_CP054303.1|WP_004177424.1|5347604_5349107_-|L-arabinose-isomerase
MTIFDNYEVWFVIGSQHLYGPEALRQVTKHAEHVVNSLNAEAKLPCKLVLKPLGTTPDEITHICRDANYDDKCAGLVVWLHTFSPAKMWINGLTILNKPLLQFHTQYNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHSVVTGHWQDKEAHQRIGGWMRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDISALVDEYESSYRLTPAAQVHGEKRQNVLDAARIELGMKRFLEQGGFHAFTTTFEDLHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFDNGNDLVLGSHMLEVCPTIATAEKPILDVQPLGIGGKADPARLIFNTQTGPAIVASLIDLGDRFRLLVNTIETVPTPHDLPKLPVANALWKAQPDLRTASEAWIIAGGAHHTVFSHALNLDDMRQFAELHDIELTVIDNDTRLPSFKDALRWNEVYYGSKR
>NZ_CP054303.1|WP_023279864.1|5349117_5350827_-|ribulokinase
MAIAIGLDFGSDSVRALAVECASGAELATSVEWYPRWREGQYCDGANNRFRHHPRDYIESMEAALKSVLASLSAEQRADVVGIGVDSTGSTPAPVDAEGNVLALREEFADNPNAMFVLWKDHTAVEEAEAITRLCHQPGKEDYSRYIGGIYSSEWFWAKILHVTREDSAVAQAAASWVELCDWVPALLSGTTRPQDLRRGRCSAGHKSLWHESWGGLPPASFFDELDPIINQHLAWPLFTDTWTADVPVGTLSAEWAQRLGLSQTVAISGGAFDCHMGAVGAGAQPNALVKVIGTSTCDILIADKESVGERTVKGICGQVDGSVVPHFIGMEAGQSAFGDIYAWFGRILGWPLEQLAQQQPALREQIKASQKQLLPALTEAWANNPSLEHLPVVLDWFNGRRTPNANQRLKGVITDLNLATDAPALFGGLIAATAFGARAIMECFTEQGIPVNNVMALGGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAGVYEDIPAAQQRMASQVETTLQPRPAQAQRFEQLYQRYQQWSVSAEQHYLPSAAKAEKAPQSQAALTH
>NZ_CP054303.1|WP_004145972.1|5351164_5352010_+|arabinose-operon-transcriptional-regulator-AraC
MAETQNDPLLPGYSFNAHLVTGLTPIEAQGYLDFFIDRPLGMKGYILNLTIRGEGVINNHGEQFVCRPGDMLLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYWHEWLNWPTIFAQTGFFRPDEQWQARFGELFGQIVDAGQGAGRYSELLAINLLEQLLLRRMEAINESLHPPLDNRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGVSVLGWREDQRISQAKLLLSTTRMPIATVGRNVGFEDQLYFSRVFKKCTGASPSEFRAGCE
>NZ_CP054303.1|WP_002888373.1|5352138_5352906_+|DedA-family-protein
MQALLEHFITQSTVYSLLAVMLVAFLESLALVGLILPGTVMMAGLGALIGGGEVNFWQAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFMKKNRALLEKTEHALHQHSMITILIGRFVGPTRPLVPMVAGMLDLPVAKFVLPNIIGCLLWPPLYFLPGILAGAAIDIPADENSASFKWLLLGAALLAWLAGWLCWRLWRSAKTSGDRLTRWLPRGRLLWLSPLMVALAATALTFVFRHPLMPVYLAILHKVIAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	NZ_CP054303.1	951576-951612	0	1.0
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	NZ_CP054303.1	955245-955281	0	1.0
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	955539-955569	0	1.0
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	951654-951672	1	0.947
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	951930-951948	1	0.947
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	952164-952182	1	0.947
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	952410-952428	1	0.947
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	952908-952926	1	0.947
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	953088-953106	1	0.947
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	953688-953706	1	0.947
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	955323-955341	1	0.947
NZ_CP054303_2	2.14\|947919\|55\|NZ_CP054303\|CRT	947919-947973	55	NZ_CP054303.1	951942-951996	1	0.982
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP054303.1	951744-951774	1	0.968
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP054303.1	953490-953520	1	0.968
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP054303.1	955593-955623	1	0.968
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	952608-952638	1	0.968
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	952644-952674	1	0.968
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	953886-953916	1	0.968
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_CP054303.1	953268-953292	1	0.96
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	952296-952326	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	953388-953418	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	954174-954204	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	955341-955371	1	0.968
NZ_CP054303_2	2.26\|948639\|31\|NZ_CP054303\|CRT	948639-948669	31	NZ_CP054303.1	952464-952494	1	0.968
NZ_CP054303_2	2.26\|948639\|31\|NZ_CP054303\|CRT	948639-948669	31	NZ_CP054303.1	952944-952974	1	0.968
NZ_CP054303_2	2.26\|948639\|31\|NZ_CP054303\|CRT	948639-948669	31	NZ_CP054303.1	953580-953610	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	NZ_CP054303.1	952278-952308	1	0.968
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	NZ_CP054303.1	951816-951864	1	0.98
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	NZ_CP054303.1	952200-952248	1	0.98
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	953352-953382	1	0.968
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	NZ_CP054303.1	952110-952140	1	0.968
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	NZ_CP054303.1	952554-952584	1	0.968
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	NZ_CP054303.1	953796-953826	1	0.968
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	NZ_CP054303.1	953424-953454	1	0.968
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	NZ_CP054303.1	953724-953754	1	0.968
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	951780-951798	2	0.895
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	952242-952260	2	0.895
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	952278-952296	2	0.895
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	953742-953760	2	0.895
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	953850-953868	2	0.895
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	NZ_CP054303.1	955593-955611	2	0.895
NZ_CP054303_2	2.7\|947457\|19\|NZ_CP054303\|CRT	947457-947475	19	NZ_CP054303.1	950547-950565	2	0.895
NZ_CP054303_2	2.7\|947457\|19\|NZ_CP054303\|CRT	947457-947475	19	NZ_CP054303.1	952464-952482	2	0.895
NZ_CP054303_2	2.7\|947457\|19\|NZ_CP054303\|CRT	947457-947475	19	NZ_CP054303.1	953580-953598	2	0.895
NZ_CP054303_2	2.14\|947919\|55\|NZ_CP054303\|CRT	947919-947973	55	NZ_CP054303.1	951666-951720	2	0.964
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	NZ_CP054303.1	951798-951828	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	NZ_CP054303.1	952182-952212	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	NZ_CP054303.1	952782-952812	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	NZ_CP054303.1	952872-952902	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP054303.1	951504-951534	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP054303.1	952536-952566	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP054303.1	953034-953064	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP054303.1	955173-955203	2	0.935
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	NZ_CP054303.1	953508-953538	2	0.935
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	NZ_CP054303.1	955359-955389	2	0.935
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	NZ_CP054303.1	955377-955407	2	0.935
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	NZ_CP054303.1	955557-955587	2	0.935
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	NZ_CP054303.1	951576-951612	2	0.946
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	NZ_CP054303.1	955245-955281	2	0.946
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	951540-951570	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	951708-951738	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	952278-952308	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	953850-953880	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	954210-954240	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_CP054303.1	955209-955239	2	0.935
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_CP054303.1	953670-953694	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_CP054303.1	955413-955437	2	0.92
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	951816-951846	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	952200-952230	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	952764-952794	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	953508-953538	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	954084-954114	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	955359-955389	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	955377-955407	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	955431-955461	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_CP054303.1	955557-955587	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	NZ_CP054303.1	952644-952674	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	NZ_CP054303.1	953886-953916	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	NZ_CP054303.1	955323-955353	2	0.935
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	NZ_CP054303.1	952002-952044	2	0.953
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	NZ_CP054303.1	953286-953328	2	0.953
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	NZ_CP054303.1	953634-953664	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	NZ_CP054303.1	951636-951666	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	NZ_CP054303.1	951912-951942	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	NZ_CP054303.1	952644-952674	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	NZ_CP054303.1	953688-953718	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	NZ_CP054303.1	953886-953916	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	NZ_CP054303.1	955305-955335	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	951798-951828	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	952182-952212	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	952764-952794	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	952782-952812	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	952872-952902	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	953760-953790	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	953940-953970	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	954084-954114	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP054303.1	954174-954204	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	NZ_CP054303.1	953214-953244	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	NZ_CP054303.1	953316-953346	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	NZ_CP054303.1	951558-951588	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	NZ_CP054303.1	953016-953046	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	NZ_CP054303.1	953526-953556	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	NZ_CP054303.1	955227-955257	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	NZ_CP054303.1	951618-951648	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	NZ_CP054303.1	951894-951924	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	NZ_CP054303.1	955287-955317	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	NZ_CP054303.1	952278-952308	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	NZ_CP054303.1	952608-952638	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	NZ_CP054303.1	952644-952674	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	NZ_CP054303.1	953886-953916	2	0.935

1. spacer 2.16|948051|37|NZ_CP054303|CRT matches to position: 951576-951612, mismatch: 0, identity: 1.0

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactctgactccgacagc	Protospacer
*************************************

2. spacer 2.16|948051|37|NZ_CP054303|CRT matches to position: 955245-955281, mismatch: 0, identity: 1.0

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactctgactccgacagc	Protospacer
*************************************

3. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 955539-955569, mismatch: 0, identity: 1.0

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactcggattct	Protospacer
*******************************

4. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 951654-951672, mismatch: 1, identity: 0.947

tgactccgactccgacagc	CRISPR spacer
tgactctgactccgacagc	Protospacer
******.************

5. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 951930-951948, mismatch: 1, identity: 0.947

tgactccgactccgacagc	CRISPR spacer
tgactctgactccgacagc	Protospacer
******.************

6. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 952164-952182, mismatch: 1, identity: 0.947

tgactccgactccgacagc	CRISPR spacer
tgattccgactccgacagc	Protospacer
***.***************

7. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 952410-952428, mismatch: 1, identity: 0.947

tgactccgactccgacagc	CRISPR spacer
tgactcggactccgacagc	Protospacer
****** ************

8. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 952908-952926, mismatch: 1, identity: 0.947

tgactccgactccgacagc	CRISPR spacer
tgactcggactccgacagc	Protospacer
****** ************

9. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 953088-953106, mismatch: 1, identity: 0.947

tgactccgactccgacagc	CRISPR spacer
tgactctgactccgacagc	Protospacer
******.************

10. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 953688-953706, mismatch: 1, identity: 0.947

tgactccgactccgacagc	CRISPR spacer
tgattccgactccgacagc	Protospacer
***.***************

11. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 955323-955341, mismatch: 1, identity: 0.947

tgactccgactccgacagc	CRISPR spacer
tgactctgactccgacagc	Protospacer
******.************

12. spacer 2.14|947919|55|NZ_CP054303|CRT matches to position: 951942-951996, mismatch: 1, identity: 0.982

cgacagtgattcggattccgacagcgattcggactctgacagtgactcggattct	CRISPR spacer
cgacagcgattcggattccgacagcgattcggactctgacagtgactcggattct	Protospacer
******.************************************************

13. spacer 2.18|948189|31|NZ_CP054303|CRT matches to position: 951744-951774, mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactcggacagcgactcggattct	Protospacer
************ ******************

14. spacer 2.18|948189|31|NZ_CP054303|CRT matches to position: 953490-953520, mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgactcggactctgacagcgactcggattct	Protospacer
***.***************************

15. spacer 2.18|948189|31|NZ_CP054303|CRT matches to position: 955593-955623, mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactccgacagcgactcggattct	Protospacer
************.******************

16. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 952608-952638, mismatch: 1, identity: 0.968

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattccgattcc	Protospacer
***************************.***

17. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 952644-952674, mismatch: 1, identity: 0.968

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
************************ ******

18. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 953886-953916, mismatch: 1, identity: 0.968

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
************************ ******

19. spacer 2.22|948411|25|NZ_CP054303|CRT matches to position: 953268-953292, mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgactcggacagcgattcc	Protospacer
*********.***************

20. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 952296-952326, mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgactccgacagcgactcggattct	Protospacer
****** ************************

21. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 953388-953418, mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgactccgacagcgactcggattct	Protospacer
****** ************************

22. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 954174-954204, mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactctgactccgacagcgactcggattct	Protospacer
****** ************************

23. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 955341-955371, mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.***************************

24. spacer 2.26|948639|31|NZ_CP054303|CRT matches to position: 952464-952494, mismatch: 1, identity: 0.968

cgactcggattctgactccgactctgattcc	CRISPR spacer
cgactccgattctgactccgactctgattcc	Protospacer
****** ************************

25. spacer 2.26|948639|31|NZ_CP054303|CRT matches to position: 952944-952974, mismatch: 1, identity: 0.968

cgactcggattctgactccgactctgattcc	CRISPR spacer
cgattcggattctgactccgactctgattcc	Protospacer
***.***************************

26. spacer 2.26|948639|31|NZ_CP054303|CRT matches to position: 953580-953610, mismatch: 1, identity: 0.968

cgactcggattctgactccgactctgattcc	CRISPR spacer
cgactccgattctgactccgactctgattcc	Protospacer
****** ************************

27. spacer 2.44|949971|31|NZ_CP054303|CRT matches to position: 952278-952308, mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactccgactcc	Protospacer
************************ ******

28. spacer 2.45|950025|49|NZ_CP054303|CRT matches to position: 951816-951864, mismatch: 1, identity: 0.98

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
cgattcggactctgacagcgactcggattctgacagcgactctgactcc	Protospacer
************.************************************

29. spacer 2.45|950025|49|NZ_CP054303|CRT matches to position: 952200-952248, mismatch: 1, identity: 0.98

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
cgattcggactctgacagcgactcggattctgacagcgactctgactcc	Protospacer
************.************************************

30. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 953352-953382, mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgattctgactctgacagcgattcggattct	Protospacer
***.***************************

31. spacer 2.49|950295|31|NZ_CP054303|CRT matches to position: 952110-952140, mismatch: 1, identity: 0.968

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattctgacagcgattctgactcg	Protospacer
************.******************

32. spacer 2.49|950295|31|NZ_CP054303|CRT matches to position: 952554-952584, mismatch: 1, identity: 0.968

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattctgacagcgattctgactcg	Protospacer
************.******************

33. spacer 2.49|950295|31|NZ_CP054303|CRT matches to position: 953796-953826, mismatch: 1, identity: 0.968

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattctgacagcgattctgactcg	Protospacer
************.******************

34. spacer 2.50|950349|31|NZ_CP054303|CRT matches to position: 953424-953454, mismatch: 1, identity: 0.968

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
***************.***************

35. spacer 2.50|950349|31|NZ_CP054303|CRT matches to position: 953724-953754, mismatch: 1, identity: 0.968

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
***************.***************

36. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 951780-951798, mismatch: 2, identity: 0.895

tgactccgactccgacagc	CRISPR spacer
tgattctgactccgacagc	Protospacer
***.**.************

37. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 952242-952260, mismatch: 2, identity: 0.895

tgactccgactccgacagc	CRISPR spacer
tgactccgacagcgacagc	Protospacer
**********  *******

38. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 952278-952296, mismatch: 2, identity: 0.895

tgactccgactccgacagc	CRISPR spacer
tgattccgactctgacagc	Protospacer
***.********.******

39. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 953742-953760, mismatch: 2, identity: 0.895

tgactccgactccgacagc	CRISPR spacer
tgactccgattcggacagc	Protospacer
*********.** ******

40. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 953850-953868, mismatch: 2, identity: 0.895

tgactccgactccgacagc	CRISPR spacer
tgattcggactccgacagc	Protospacer
***.** ************

41. spacer 2.5|947343|19|NZ_CP054303|CRT matches to position: 955593-955611, mismatch: 2, identity: 0.895

tgactccgactccgacagc	CRISPR spacer
tgattcggactccgacagc	Protospacer
***.** ************

42. spacer 2.7|947457|19|NZ_CP054303|CRT matches to position: 950547-950565, mismatch: 2, identity: 0.895

cgactccgactctgattcc	CRISPR spacer
cgactcggactctgactcc	Protospacer
****** ********.***

43. spacer 2.7|947457|19|NZ_CP054303|CRT matches to position: 952464-952482, mismatch: 2, identity: 0.895

cgactccgactctgattcc	CRISPR spacer
cgactccgattctgactcc	Protospacer
*********.*****.***

44. spacer 2.7|947457|19|NZ_CP054303|CRT matches to position: 953580-953598, mismatch: 2, identity: 0.895

cgactccgactctgattcc	CRISPR spacer
cgactccgattctgactcc	Protospacer
*********.*****.***

45. spacer 2.14|947919|55|NZ_CP054303|CRT matches to position: 951666-951720, mismatch: 2, identity: 0.964

cgacagtgattcggattccgacagcgattcggactctgacagtgactcggattct	CRISPR spacer
cgacagcgattcggattctgacagcgattcggactctgacagtgactcggattct	Protospacer
******.***********.************************************

46. spacer 2.15|947997|31|NZ_CP054303|CRT matches to position: 951798-951828, mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggactct	Protospacer
********** ****************.***

47. spacer 2.15|947997|31|NZ_CP054303|CRT matches to position: 952182-952212, mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggactct	Protospacer
********** ****************.***

48. spacer 2.15|947997|31|NZ_CP054303|CRT matches to position: 952782-952812, mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggattct	Protospacer
*********. ********************

49. spacer 2.15|947997|31|NZ_CP054303|CRT matches to position: 952872-952902, mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggatgct	Protospacer
********** ***************** **

50. spacer 2.18|948189|31|NZ_CP054303|CRT matches to position: 951504-951534, mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgactcggattctgacagcgactcggattct	Protospacer
***.*****.*********************

51. spacer 2.18|948189|31|NZ_CP054303|CRT matches to position: 952536-952566, mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagtgactcggattct	Protospacer
****** ***********.************

52. spacer 2.18|948189|31|NZ_CP054303|CRT matches to position: 953034-953064, mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactcggacagcgactcggactct	Protospacer
************ **************.***

53. spacer 2.18|948189|31|NZ_CP054303|CRT matches to position: 955173-955203, mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgactcggattctgacagcgactcggattct	Protospacer
***.*****.*********************

54. spacer 2.19|948243|31|NZ_CP054303|CRT matches to position: 953508-953538, mismatch: 2, identity: 0.935

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggattct	Protospacer
********** ***************** **

55. spacer 2.19|948243|31|NZ_CP054303|CRT matches to position: 955359-955389, mismatch: 2, identity: 0.935

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggattct	Protospacer
********** ***************** **

56. spacer 2.19|948243|31|NZ_CP054303|CRT matches to position: 955377-955407, mismatch: 2, identity: 0.935

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggattct	Protospacer
********** ***************** **

57. spacer 2.19|948243|31|NZ_CP054303|CRT matches to position: 955557-955587, mismatch: 2, identity: 0.935

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggattct	Protospacer
********** ***************** **

58. spacer 2.20|948297|37|NZ_CP054303|CRT matches to position: 951576-951612, mismatch: 2, identity: 0.946

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactctgactccgacagc	Protospacer
***.*****.***************************

59. spacer 2.20|948297|37|NZ_CP054303|CRT matches to position: 955245-955281, mismatch: 2, identity: 0.946

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactctgactccgacagc	Protospacer
***.*****.***************************

60. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 951540-951570, mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggattcc	Protospacer
************************ **.***

61. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 951708-951738, mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgactcggattctgacagcgattccgactcc	Protospacer
***.*****.*********************

62. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 952278-952308, mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgactccgactcc	Protospacer
****** **************.*********

63. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 953850-953880, mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactccgacagcgattccgattcc	Protospacer
************.**************.***

64. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 954210-954240, mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggattctgacagcgactccgactcc	Protospacer
*********.***********.*********

65. spacer 2.21|948357|31|NZ_CP054303|CRT matches to position: 955209-955239, mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggattcc	Protospacer
************************ **.***

66. spacer 2.22|948411|25|NZ_CP054303|CRT matches to position: 953670-953694, mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagtgattcc	Protospacer
****** ***********.******

67. spacer 2.22|948411|25|NZ_CP054303|CRT matches to position: 955413-955437, mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattccgacagcgactcc	Protospacer
************ ********.***

68. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 951816-951846, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
***.********.******************

69. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 952200-952230, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
***.********.******************

70. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 952764-952794, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgactctgacagcgactcggattct	Protospacer
****** *****.******************

71. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 953508-953538, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattct	Protospacer
*********.**.******************

72. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 954084-954114, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgactccgacagcgattcggattct	Protospacer
****** **************.*********

73. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 955359-955389, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattct	Protospacer
*********.**.******************

74. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 955377-955407, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattct	Protospacer
*********.**.******************

75. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 955431-955461, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgattccgacagcgactcggattct	Protospacer
****** **.*********************

76. spacer 2.23|948459|31|NZ_CP054303|CRT matches to position: 955557-955587, mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattct	Protospacer
*********.**.******************

77. spacer 2.24|948513|31|NZ_CP054303|CRT matches to position: 952644-952674, mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
***.** ************************

78. spacer 2.24|948513|31|NZ_CP054303|CRT matches to position: 953886-953916, mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
***.** ************************

79. spacer 2.24|948513|31|NZ_CP054303|CRT matches to position: 955323-955353, mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactctgactccgacagcgattcggactcc	Protospacer
******.*****.******************

80. spacer 2.40|949689|43|NZ_CP054303|CRT matches to position: 952002-952044, mismatch: 2, identity: 0.953

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
cgattccgacagcgactccgactcggacagcgactctgactcc	Protospacer
************************************ **.***

81. spacer 2.40|949689|43|NZ_CP054303|CRT matches to position: 953286-953328, mismatch: 2, identity: 0.953

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
cgattccgacagcgactcggactctgacagcgactcggattcc	Protospacer
****************** ***** ******************

82. spacer 2.41|949755|31|NZ_CP054303|CRT matches to position: 953634-953664, mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagtgattcggattcc	Protospacer
****** **************.*********

83. spacer 2.44|949971|31|NZ_CP054303|CRT matches to position: 951636-951666, mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagtgactctgactcc	Protospacer
******************.***** ******

84. spacer 2.44|949971|31|NZ_CP054303|CRT matches to position: 951912-951942, mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagtgactctgactcc	Protospacer
******************.***** ******

85. spacer 2.44|949971|31|NZ_CP054303|CRT matches to position: 952644-952674, mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
****** **************.*********

86. spacer 2.44|949971|31|NZ_CP054303|CRT matches to position: 953688-953718, mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactccgacagcgactcggattcc	Protospacer
************.**************.***

87. spacer 2.44|949971|31|NZ_CP054303|CRT matches to position: 953886-953916, mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
****** **************.*********

88. spacer 2.44|949971|31|NZ_CP054303|CRT matches to position: 955305-955335, mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagtgactctgactcc	Protospacer
******************.***** ******

89. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 951798-951828, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggactct	Protospacer
****** ********************.***

90. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 952182-952212, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggactct	Protospacer
****** ********************.***

91. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 952764-952794, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactccgactctgacagcgactcggattct	Protospacer
******.**************.*********

92. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 952782-952812, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggattct	Protospacer
****** **.*********************

93. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 952872-952902, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggatgct	Protospacer
****** ********************* **

94. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 953760-953790, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactctgacagtgattccgattct	Protospacer
******************.***** ******

95. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 953940-953970, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactccgactctgacagtgattcggattct	Protospacer
******.***********.************

96. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 954084-954114, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactccgactccgacagcgattcggattct	Protospacer
******.*****.******************

97. spacer 2.46|950097|31|NZ_CP054303|CRT matches to position: 954174-954204, mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactccgacagcgactcggattct	Protospacer
************.********.*********

98. spacer 2.48|950241|31|NZ_CP054303|CRT matches to position: 953214-953244, mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagtgactcggattcg	Protospacer
************ *****.************

99. spacer 2.48|950241|31|NZ_CP054303|CRT matches to position: 953316-953346, mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactccgactcg	Protospacer
************************ **.***

100. spacer 2.51|950403|31|NZ_CP054303|CRT matches to position: 951558-951588, mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattccgacagtgattccgattcg	Protospacer
************.**************.***

101. spacer 2.51|950403|31|NZ_CP054303|CRT matches to position: 953016-953046, mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattccgattctgacagtgattcggactcg	Protospacer
****** ***************** ******

102. spacer 2.51|950403|31|NZ_CP054303|CRT matches to position: 953526-953556, mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactcggattctgacagtgattccgattcg	Protospacer
***.***********************.***

103. spacer 2.51|950403|31|NZ_CP054303|CRT matches to position: 955227-955257, mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattccgacagtgattccgattcg	Protospacer
************.**************.***

104. spacer 2.52|950457|31|NZ_CP054303|CRT matches to position: 951618-951648, mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgactcggactctgacagtgattccgactct	Protospacer
***.******************** ******

105. spacer 2.52|950457|31|NZ_CP054303|CRT matches to position: 951894-951924, mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgactcggactctgacagtgattccgactct	Protospacer
***.******************** ******

106. spacer 2.52|950457|31|NZ_CP054303|CRT matches to position: 955287-955317, mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgactcggactctgacagtgattccgactct	Protospacer
***.******************** ******

107. spacer 2.53|950511|31|NZ_CP054303|CRT matches to position: 952278-952308, mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgactccgactcc	Protospacer
****** **************.*********

108. spacer 2.53|950511|31|NZ_CP054303|CRT matches to position: 952608-952638, mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattccgattcc	Protospacer
******.********************.***

109. spacer 2.53|950511|31|NZ_CP054303|CRT matches to position: 952644-952674, mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
******.***************** ******

110. spacer 2.53|950511|31|NZ_CP054303|CRT matches to position: 953886-953916, mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
******.***************** ******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155725-155743	0	1.0
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2632-2650	0	1.0
NZ_CP054303_2	2.5\|947343\|19\|NZ_CP054303\|CRT	947343-947361	19	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2782-2800	0	1.0
NZ_CP054303_2	2.10\|947631\|37\|NZ_CP054303\|CRT	947631-947667	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2446-2482	0	1.0
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1042-1072	0	1.0
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151239-151269	0	1.0
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156205-156235	0	1.0
NZ_CP054303_2	2.26\|948639\|31\|NZ_CP054303\|CRT	948639-948669	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1204-1234	0	1.0
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156223-156253	0	1.0
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3118-3148	0	1.0
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2974-3004	0	1.0
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2542-2572	0	1.0
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1006-1036	0	1.0
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1078-1108	1	0.968
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1906-1936	1	0.968
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153439-153469	1	0.968
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154615-154645	1	0.968
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154849-154879	1	0.968
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155599-155629	1	0.968
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155635-155665	1	0.968
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154993-155023	1	0.968
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2506-2536	1	0.968
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	970-1000	1	0.968
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1006-1036	1	0.968
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1786	1	0.968
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156019-156043	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151612-151636	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154015-154039	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154159-154183	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155533-155557	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156745-156769	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156895-156919	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157165-157189	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3232-3256	1	0.96
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3718-3742	1	0.96
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153277-153307	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153403-153433	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153529-153559	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153757-153787	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155047-155077	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155281-155311	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155671-155701	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156757-156787	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156907-156937	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157213-157243	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1060-1090	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1222-1252	1	0.968
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2392-2422	1	0.968
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154261-154291	1	0.968
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156625-156655	1	0.968
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1162	1	0.968
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3412	1	0.968
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3724	1	0.968
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155209-155257	1	0.98
NZ_CP054303_2	2.33\|949179\|49\|NZ_CP054303\|CRT	949179-949227	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1204-1252	1	0.98
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154345-154375	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155443-155473	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156775-156805	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154777-154807	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155173-155203	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155227-155257	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155407-155437	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156625-156655	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3412	1	0.968
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3724	1	0.968
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1042-1090	1	0.98
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	31-61	1	0.968
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1078-1108	1	0.968
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1294-1324	1	0.968
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1906-1936	1	0.968
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2428-2458	1	0.968
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2692-2722	1	0.968
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154435-154465	1	0.968
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1024-1054	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154687-154717	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154705-154735	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154903-154933	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155101-155131	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155335-155365	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151846-151876	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153385-153415	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153475-153505	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153493-153523	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153511-153541	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154669-154699	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154885-154915	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154975-155005	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155083-155113	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155317-155347	1	0.968
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155545-155575	1	0.968
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1312-1342	1	0.968
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1384-1414	1	0.968
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2014-2044	1	0.968
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156697-156727	1	0.968
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157603	1	0.968
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1132-1162	1	0.968
NZ_CP054303_2	2.10\|947631\|37\|NZ_CP054303\|CRT	947631-947667	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2596-2632	2	0.946
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2032-2062	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2374-2404	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2506-2536	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2974-3004	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3628-3658	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155941-155971	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151816	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153403-153433	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155671-155701	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157213-157243	2	0.935
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157585	2	0.935
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2944	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1234-1270	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1360-1396	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1468-1504	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1990-2026	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151858-151894	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153307-153343	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154717-154753	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154915-154951	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155113-155149	2	0.946
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155347-155383	2	0.946
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1696-1726	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2392-2422	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3184	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2260-2290	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153955-153985	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154171-154201	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151816	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153121-153151	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153403-153433	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153895-153925	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154777-154807	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155047-155077	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155173-155203	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155227-155257	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155281-155311	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155407-155437	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155671-155701	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157213-157243	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157249-157279	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157465-157495	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157585	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154345-154375	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155443-155473	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157411-157441	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157603	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1060-1090	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1114-1144	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16754-16784	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17750-17780	2	0.935
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19232-19262	2	0.935
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2050-2080	2	0.935
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2878-2908	2	0.935
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2944	2	0.946
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1360-1396	2	0.946
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1990-2026	2	0.946
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154399-154429	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153271	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153751	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154255	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156307-156337	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156877	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157045	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157153	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157603	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1006-1036	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1132-1162	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1582-1612	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1942-1972	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2242-2272	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1162	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1870-1900	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3184	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3412	2	0.935
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3724	2	0.935
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151396-151420	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151432-151456	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151468-151492	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151504-151528	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151942-151966	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153109-153133	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153463-153487	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153883-153907	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157183-157207	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157273-157297	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151540-151564	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151576-151600	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153265-153289	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153337-153361	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153745-153769	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155857-155881	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156475-156499	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156493-156517	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156511-156535	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156799-156823	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156967-156991	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157633-157657	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1642-1666	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3574-3598	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1822-1846	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2920-2944	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3754-3778	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1984-2008	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3304-3328	2	0.92
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3322-3346	2	0.92
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151408-151438	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153295-153325	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153349-153379	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154687-154717	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154705-154735	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154903-154933	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155101-155131	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155335-155365	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156811-156841	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156979-157009	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151372-151402	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151660-151690	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151714-151744	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151972-152002	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153157-153187	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153439-153469	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154615-154645	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154849-154879	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155209-155239	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155599-155629	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155635-155665	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155959-155989	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155977-156007	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156943-156973	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157231-157261	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	952-982	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1696-1726	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	31-61	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1078-1108	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1096-1126	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1114-1144	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1906-1936	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2206-2236	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2296-2326	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2428-2458	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2692-2722	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2860-2890	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2896-2926	2	0.935
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3646-3676	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153103-153133	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153973-154003	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157033-157063	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157087-157117	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151257-151287	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153691-153721	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156223-156253	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1786	2	0.935
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3118-3148	2	0.935
NZ_CP054303_2	2.26\|948639\|31\|NZ_CP054303\|CRT	948639-948669	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2314-2344	2	0.935
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153421-153469	2	0.959
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154759-154807	2	0.959
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155155-155203	2	0.959
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155389-155437	2	0.959
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	952-1000	2	0.959
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154777-154807	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155173-155203	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155227-155257	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155407-155437	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151552-151582	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151588-151618	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153955-153985	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154063-154093	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154327-154357	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155539	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156289-156319	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156775-156805	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157609-157639	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2068-2098	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2104-2134	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3490-3520	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2188-2218	2	0.935
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2788-2818	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152995-153025	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154993-155023	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151257-151287	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153313-153343	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156397-156427	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3280-3310	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1786	2	0.935
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	970-1000	2	0.935
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156925-156973	2	0.959
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1402-1432	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2374-2404	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2560-2590	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3628-3658	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3646-3676	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155941-155971	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157033-157063	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157087-157117	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151816	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153403-153433	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155671-155701	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157213-157243	2	0.935
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157585	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151239-151269	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151972-152002	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154759-154789	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155155-155185	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155209-155239	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155389-155419	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156205-156235	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151408-151438	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151444-151474	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151462-151492	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151954-151984	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153349-153379	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153619-153649	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153937-153967	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154045-154075	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155905-155935	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2170-2200	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2296-2326	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2860-2890	2	0.935
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2932-2962	2	0.935
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2086-2116	2	0.935
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153085-153115	2	0.935
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154579-154609	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153913-153943	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154363-154393	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154525-154555	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154795-154825	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155011-155041	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155245-155275	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156451-156481	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151317-151347	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151918-151948	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157195-157225	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1060-1090	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2242-2272	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2674-2704	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3136-3166	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1720-1750	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2278-2308	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2356-2386	2	0.935
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3610-3640	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154273	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154525-154555	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154795-154825	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155011-155041	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155245-155275	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154453-154483	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157375-157405	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1060-1090	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1786	2	0.935
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1600-1630	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1786	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3412	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3724	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153271	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153751	2	0.935
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	970-1000	2	0.935
NZ_CP054303_2	2.6\|947385\|49\|NZ_CP054303\|CRT	947385-947433	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153277-153325	3	0.939
NZ_CP054303_2	2.8\|947499\|49\|NZ_CP054303\|CRT	947499-947547	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2392-2440	3	0.939
NZ_CP054303_2	2.10\|947631\|37\|NZ_CP054303\|CRT	947631-947667	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2488-2524	3	0.919
NZ_CP054303_2	2.10\|947631\|37\|NZ_CP054303\|CRT	947631-947667	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1474-1510	3	0.919
NZ_CP054303_2	2.13\|947847\|49\|NZ_CP054303\|CRT	947847-947895	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157189	3	0.939
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1696-1726	3	0.903
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2878-2908	3	0.903
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153349-153379	3	0.903
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154435-154465	3	0.903
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	43-79	3	0.919
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2704-2740	3	0.919
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156391-156427	3	0.919
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	7-43	3	0.919
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1078-1108	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1096-1126	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1114-1144	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1786	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1888-1918	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1906-1936	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1942-1972	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2068-2098	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3118-3148	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3646-3676	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151408-151438	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151480-151510	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151954-151984	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152995-153025	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153349-153379	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155563-155593	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156811-156841	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156979-157009	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151239-151269	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151372-151402	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151660-151690	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151714-151744	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151732-151762	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151750-151780	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151768-151798	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153157-153187	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154273	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155815-155845	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155959-155989	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156205-156235	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156223-156253	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156541-156571	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156943-156973	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157231-157261	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157285-157315	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157537-157567	3	0.903
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	970-1000	3	0.903
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2032-2062	3	0.903
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153385-153415	3	0.903
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153511-153541	3	0.903
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154975-155005	3	0.903
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153421-153451	3	0.903
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	43-79	3	0.919
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1414-1450	3	0.919
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1918-1954	3	0.919
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2704-2740	3	0.919
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3742-3778	3	0.919
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156619-156655	3	0.919
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	7-43	3	0.919
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154273	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154525-154555	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154795-154825	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155011-155041	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155245-155275	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152995-153025	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153655-153685	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153673-153703	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156829-156859	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156997-157027	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1600-1630	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2410-2440	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3262-3292	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3514-3544	3	0.903
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3532-3562	3	0.903
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151996-152020	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153019-153043	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153073-153097	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153571-153595	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153979-154003	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154033-154057	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154567-154591	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155875-155899	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156685-156709	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151852-151876	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151978-152002	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153181-153205	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153373-153397	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153481-153505	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153499-153523	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153589-153613	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154603-154627	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154639-154663	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154657-154681	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154675-154699	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154837-154861	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154873-154897	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154891-154915	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154963-154987	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155035-155059	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155071-155095	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155089-155113	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155269-155293	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155305-155329	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155323-155347	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155551-155575	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155587-155611	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155623-155647	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155659-155683	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155803-155827	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155893-155917	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156529-156553	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157309-157333	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157597-157621	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1372-1396	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2002-2026	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2530-2554	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	55-79	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1300-1324	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1408-1432	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1516-1540	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1876-1900	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1930-1954	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2302-2326	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2380-2404	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2566-2590	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2716-2740	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3088-3112	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3424-3448	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3598-3622	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3634-3658	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21097-21121	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	19-43	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1084-1108	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15484-15508	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15592-15616	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15718-15742	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9655-9679	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9835-9859	3	0.88
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9961-9985	3	0.88
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153211-153241	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153775-153805	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153895-153925	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156049-156079	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151480-151510	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151516-151546	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151552-151582	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151588-151618	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151846-151876	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153385-153415	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153475-153505	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153493-153523	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153511-153541	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153637-153667	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153955-153985	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154063-154093	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154171-154201	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154309-154339	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154327-154357	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154669-154699	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154759-154789	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154885-154915	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154975-155005	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155083-155113	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155155-155185	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155317-155347	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155389-155419	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155545-155575	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155563-155593	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155941-155971	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156031-156061	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156379-156409	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157321-157351	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157447-157477	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2170-2200	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2824-2854	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1042-1072	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1258-1288	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2188-2218	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2332-2362	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2770-2800	3	0.903
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3100-3130	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157171	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153139-153169	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153271	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153751	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154255	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154345-154375	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154435-154465	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155443-155473	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155539	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155713-155743	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156289-156319	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156739-156769	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156775-156805	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156877	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156889-156919	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157045	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157153	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157447-157477	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157603	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1510-1540	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2770-2800	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1024-1054	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1078-1108	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1114-1144	3	0.903
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1150-1180	3	0.903
NZ_CP054303_2	2.25\|948567\|49\|NZ_CP054303\|CRT	948567-948615	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2032-2080	3	0.939
NZ_CP054303_2	2.30\|948933\|61\|NZ_CP054303\|CRT	948933-948993	61	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154033-154093	3	0.951
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154309-154357	3	0.939
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154597-154645	3	0.939
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155617-155665	3	0.939
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157231-157279	3	0.939
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157537-157585	3	0.939
NZ_CP054303_2	2.38\|949539\|49\|NZ_CP054303\|CRT	949539-949587	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3364-3412	3	0.939
NZ_CP054303_2	2.39\|949611\|55\|NZ_CP054303\|CRT	949611-949665	55	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3340-3394	3	0.945
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151552-151594	3	0.93
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154993-155023	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151516-151546	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153157-153187	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153439-153469	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153991-154021	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154171-154201	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154579-154609	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154615-154645	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154849-154879	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155599-155629	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155635-155665	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155863	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156223-156253	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156541-156571	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156697-156727	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156721-156751	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156871-156901	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156943-156973	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1384-1414	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1888-1918	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2014-2044	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3118-3148	3	0.903
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3646-3676	3	0.903
NZ_CP054303_2	2.43\|949899\|49\|NZ_CP054303\|CRT	949899-949947	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154363-154411	3	0.939
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155995-156025	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157171	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157249-157279	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157465-157495	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151552-151582	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151588-151618	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151678-151708	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153271	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153751	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153955-153985	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154063-154093	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154255	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154261-154291	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155539	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156289-156319	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156877	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157045	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157153	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157339-157369	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157411-157441	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157447-157477	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157603	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157609-157639	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	988-1018	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1042-1072	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1276-1306	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1582-1612	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1798-1828	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1942-1972	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2224-2254	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2788-2818	3	0.903
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1114-1144	3	0.903
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153421-153469	3	0.939
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155029-155077	3	0.939
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155263-155311	3	0.939
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1096-1144	3	0.939
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1348-1378	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1510-1540	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1696-1726	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1978-2008	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2770-2800	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3436-3466	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151299-151329	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153349-153379	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154261-154291	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155863	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1078-1108	3	0.903
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1114-1144	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154309-154339	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151624-151654	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151936-151966	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153175-153205	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153193-153223	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153211-153241	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153277-153307	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153295-153325	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153367-153397	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153403-153433	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153421-153451	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153529-153559	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153757-153787	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153895-153925	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154027-154057	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154957-154987	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155047-155077	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155281-155311	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155671-155701	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155815-155845	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155923-155953	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156343-156373	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156757-156787	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156811-156841	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156907-156937	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156925-156955	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156979-157009	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157213-157243	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1222-1252	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1312-1342	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1330-1360	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2374-2404	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2392-2422	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2728-2758	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2878-2908	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3316-3346	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3628-3658	3	0.903
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1060-1090	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1816-1846	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1678-1708	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1870-1900	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151534-151564	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151570-151600	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153175-153205	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155851-155881	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156793-156823	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156961-156991	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151498-151528	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151846-151876	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153013-153043	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153139-153169	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153691-153721	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154309-154339	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154669-154699	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154885-154915	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155083-155113	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155317-155347	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155581-155611	3	0.903
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156523-156553	3	0.903
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153121-153151	3	0.903
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153889	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153259-153289	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153739-153769	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153811-153841	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153889	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154399-154429	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154417-154447	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155191-155221	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155425-155455	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156085-156115	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156187-156217	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156559-156589	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156661-156691	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157627-157657	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1024-1054	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1546-1576	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2410-2440	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2638-2668	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3298-3328	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3532-3562	3	0.903
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1132-1162	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153913-153943	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154255	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155539	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156289-156319	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156877	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157045	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157153	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151816	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154399-154429	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154417-154447	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154471-154501	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155191-155221	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155425-155455	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156559-156589	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157069-157099	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157171	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157249-157279	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157393-157423	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157465-157495	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157483-157513	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157585	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3676-3706	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1162	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1546-1576	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3184	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3412	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3532-3562	3	0.903
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3724	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1582-1612	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1942-1972	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2242-2272	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154399-154429	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154255	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156307-156337	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156877	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157045	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157153	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157603	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1006-1036	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1132-1162	3	0.903
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19910-19940	3	0.903
NZ_CP054303_2	2.6\|947385\|49\|NZ_CP054303\|CRT	947385-947433	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153757-153805	4	0.918
NZ_CP054303_2	2.10\|947631\|37\|NZ_CP054303\|CRT	947631-947667	37	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1096-1132	4	0.892
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1162	4	0.871
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3184	4	0.871
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3472-3502	4	0.871
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152074	4	0.871
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153211-153241	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1276-1306	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1384-1414	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1582-1612	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1834-1864	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2014-2044	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2188-2218	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3730-3760	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151444-151474	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151516-151546	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151552-151582	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151588-151618	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153193-153223	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153385-153415	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153511-153541	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153637-153667	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154063-154093	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154255	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154327-154357	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154579-154609	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154975-155005	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155863	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155923-155953	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155941-155971	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156697-156727	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156775-156805	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156877	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157045	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157153	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157321-157351	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157447-157477	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157609-157639	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1006-1036	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16796-16826	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17630-17660	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17792-17822	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18878-18908	4	0.871
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19274-19304	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1438-1468	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2932-2962	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1096-1126	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2488-2518	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2860-2890	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156925-156955	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151954-151984	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153349-153379	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153475-153505	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153493-153523	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154687-154717	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154705-154735	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154903-154933	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155101-155131	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155335-155365	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155545-155575	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151660-151690	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151714-151744	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151732-151762	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153367-153397	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154597-154627	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155029-155059	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155209-155239	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155263-155293	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155617-155647	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155653-155683	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155959-155989	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157231-157261	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157537-157567	4	0.871
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1042-1072	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151816	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153121-153151	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153889	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154381-154411	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154417-154447	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155191-155221	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155425-155455	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157171	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157249-157279	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157465-157495	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157483-157513	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157585	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157627-157657	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2806-2836	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3610-3640	4	0.871
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3112	4	0.871
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151870-151894	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153145-153169	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154267-154291	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154729-154753	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154927-154951	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155125-155149	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155359-155383	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155719-155743	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156331-156355	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156367-156391	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157507-157531	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2092-2116	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2662-2686	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2776-2800	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3052-3076	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3178-3202	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3478-3502	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21025-21049	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1156-1180	4	0.84
NZ_CP054303_2	2.22\|948411\|25\|NZ_CP054303\|CRT	948411-948435	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9547-9571	4	0.84
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153691-153721	4	0.871
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153793-153823	4	0.871
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156067-156097	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151660-151690	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151714-151744	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154273	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154597-154627	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155029-155059	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155263-155293	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155581-155611	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155617-155647	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155653-155683	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155863	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155941-155971	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155959-155989	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156169-156199	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157231-157261	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157267-157297	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155779	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1078-1108	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1096-1126	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1402-1432	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1906-1936	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1924-1954	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2560-2590	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2974-3004	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3646-3676	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3748-3778	4	0.871
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	952-982	4	0.871
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155581-155629	4	0.918
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157447-157495	4	0.918
NZ_CP054303_2	2.38\|949539\|49\|NZ_CP054303\|CRT	949539-949587	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3676-3724	4	0.918
NZ_CP054303_2	2.38\|949539\|49\|NZ_CP054303\|CRT	949539-949587	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3100-3148	4	0.918
NZ_CP054303_2	2.38\|949539\|49\|NZ_CP054303\|CRT	949539-949587	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154327-154375	4	0.918
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151516-151558	4	0.907
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153529-153571	4	0.907
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154027-154069	4	0.907
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156943-156985	4	0.907
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1222-1264	4	0.907
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1294-1336	4	0.907
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153031-153061	4	0.871
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154345-154375	4	0.871
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155443-155473	4	0.871
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1042-1072	4	0.871
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1114-1144	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151372-151402	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151516-151546	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151660-151690	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151714-151744	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151732-151762	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153439-153469	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154171-154201	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154273	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154615-154645	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154849-154879	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155599-155629	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155635-155665	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155863	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155959-155989	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156169-156199	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156943-156973	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157231-157261	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157537-157567	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1096-1126	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1114-1144	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1924-1954	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3646-3676	4	0.871
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	952-982	4	0.871
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151354-151402	4	0.918
NZ_CP054303_2	2.45\|950025\|49\|NZ_CP054303\|CRT	950025-950073	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1678-1726	4	0.918
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1162	4	0.871
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3184	4	0.871
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3472-3502	4	0.871
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152074	4	0.871
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151257-151287	4	0.871
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153211-153241	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151990-152020	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153565-153595	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153775-153805	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155869-155899	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156049-156079	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156523-156553	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156679-156709	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1696-1726	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2050-2080	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2824-2854	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3472-3502	4	0.871
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2896-2926	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2806-2836	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2860-2890	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151390-151420	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151426-151456	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151636	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151972-152002	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153457-153487	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153877-153907	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154039	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154183	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154597-154627	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154759-154789	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155029-155059	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155155-155185	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155209-155239	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155263-155293	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155389-155419	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155557	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155617-155647	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155653-155683	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157267-157297	4	0.871
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1042-1072	4	0.871
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1600-1630	4	0.871
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1870-1900	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152995-153025	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153655-153685	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153673-153703	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153811-153841	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153889	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156085-156115	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156661-156691	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156829-156859	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156997-157027	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157429-157459	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1492-1522	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1720-1750	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2278-2308	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2356-2386	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2410-2440	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2842-2872	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3364-3394	4	0.871
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3028-3058	4	0.871
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154273	4	0.871
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154381-154411	4	0.871
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154525-154555	4	0.871
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154795-154825	4	0.871
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155011-155041	4	0.871
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155245-155275	4	0.871
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157171	4	0.871
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157627-157657	4	0.871
NZ_CP054303_2	2.6\|947385\|49\|NZ_CP054303\|CRT	947385-947433	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3766-3814	5	0.898
NZ_CP054303_2	2.9\|947571\|37\|NZ_CP054303\|CRT	947571-947607	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1774-1810	5	0.865
NZ_CP054303_2	2.10\|947631\|37\|NZ_CP054303\|CRT	947631-947667	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	13-49	5	0.865
NZ_CP054303_2	2.10\|947631\|37\|NZ_CP054303\|CRT	947631-947667	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155473-155509	5	0.865
NZ_CP054303_2	2.10\|947631\|37\|NZ_CP054303\|CRT	947631-947667	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156253-156289	5	0.865
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154861	5	0.839
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155827	5	0.839
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3340-3376	5	0.865
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156169-156199	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1276-1306	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1678-1708	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2170-2200	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3010-3040	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3472-3502	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154861	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155827	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153547-153577	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154759-154789	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154957-154987	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155155-155185	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155389-155419	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155581-155611	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157447-157477	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153139-153169	5	0.839
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154309-154339	5	0.839
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3586-3622	5	0.865
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3028-3058	5	0.839
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887844	5	0.839
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152074	5	0.839
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154291-154321	5	0.839
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153859	5	0.839
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156133	5	0.839
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156607	5	0.839
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157645-157675	5	0.839
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	5	0.839
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152074	5	0.839
NZ_CP054303_2	2.38\|949539\|49\|NZ_CP054303\|CRT	949539-949587	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157105-157153	5	0.898
NZ_CP054303_2	2.39\|949611\|55\|NZ_CP054303\|CRT	949611-949665	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154147-154201	5	0.909
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1456-1498	5	0.884
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156169-156199	5	0.839
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	5	0.839
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155473-155503	5	0.839
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156253-156283	5	0.839
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154861	5	0.839
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155827	5	0.839
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	5	0.839
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153859	5	0.839
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156133	5	0.839
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156607	5	0.839
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154861	5	0.839
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155827	5	0.839
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2524-2554	5	0.839
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	5	0.839
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	5	0.839
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155491	5	0.839
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156271	5	0.839
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1738-1768	5	0.839
NZ_CP054303_2	2.4\|947265\|55\|NZ_CP054303\|CRT	947265-947319	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153985-154039	6	0.891
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153859	6	0.806
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	6	0.806
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156133	6	0.806
NZ_CP054303_2	2.15\|947997\|31\|NZ_CP054303\|CRT	947997-948027	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156607	6	0.806
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	13-43	6	0.806
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-31	6	0.806
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152074	6	0.806
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154291-154321	6	0.806
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	6	0.806
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1168-1198	6	0.806
NZ_CP054303_2	2.19\|948243\|31\|NZ_CP054303\|CRT	948243-948273	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2446-2476	6	0.806
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3778-3814	6	0.838
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154291-154321	6	0.806
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	6	0.806
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152074	6	0.806
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155779	6	0.806
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	6	0.806
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155491	6	0.806
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156271	6	0.806
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1738-1768	6	0.806
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156169-156199	6	0.806
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	31-61	6	0.806
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	67-97	6	0.806
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154861	6	0.806
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155827	6	0.806
NZ_CP054303_2	2.40\|949689\|43\|NZ_CP054303\|CRT	949689-949731	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154063-154105	6	0.86
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	6	0.806
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-31	6	0.806
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2134-2164	6	0.806
NZ_CP054303_2	2.41\|949755\|31\|NZ_CP054303\|CRT	949755-949785	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1168-1198	6	0.806
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155779	6	0.806
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	6	0.806
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154561-154591	6	0.806
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156169-156199	6	0.806
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157645-157675	6	0.806
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16976-17006	6	0.806
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	67-97	6	0.806
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	31-61	6	0.806
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3784-3814	6	0.806
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157696-157726	6	0.806
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3112	6	0.806
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	6	0.806
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155779	6	0.806
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	6	0.806
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155491	6	0.806
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156271	6	0.806
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887844	6	0.806
NZ_CP054303_2	2.13\|947847\|49\|NZ_CP054303\|CRT	947847-947895	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155845	7	0.857
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3586-3622	7	0.811
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155467-155503	7	0.811
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156247-156283	7	0.811
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153859	7	0.774
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156133	7	0.774
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156607	7	0.774
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1654-1690	7	0.811
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2116-2152	7	0.811
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2134-2164	7	0.774
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3334-3364	7	0.774
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3784-3814	7	0.774
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887844	7	0.774
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154099-154129	7	0.774
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154165	7	0.774
NZ_CP054303_2	2.26\|948639\|31\|NZ_CP054303\|CRT	948639-948669	31	KP790009	Gordonia phage Gmala1, complete genome	62625-62655	7	0.774
NZ_CP054303_2	2.26\|948639\|31\|NZ_CP054303\|CRT	948639-948669	31	KP790008	Gordonia phage GordTnk2, complete genome	63343-63373	7	0.774
NZ_CP054303_2	2.32\|949107\|49\|NZ_CP054303\|CRT	949107-949155	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154879	7	0.857
NZ_CP054303_2	2.38\|949539\|49\|NZ_CP054303\|CRT	949539-949587	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154207-154255	7	0.857
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154099-154129	7	0.774
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154165	7	0.774
NZ_CP054303_2	2.46\|950097\|31\|NZ_CP054303\|CRT	950097-950127	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-25	7	0.774
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152062-152092	7	0.774
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153859	7	0.774
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156133	7	0.774
NZ_CP054303_2	2.48\|950241\|31\|NZ_CP054303\|CRT	950241-950271	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156607	7	0.774
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154861	7	0.774
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155827	7	0.774
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-31	7	0.774
NZ_CP054303_2	2.50\|950349\|31\|NZ_CP054303\|CRT	950349-950379	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1168-1198	7	0.774
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155491	7	0.774
NZ_CP054303_2	2.51\|950403\|31\|NZ_CP054303\|CRT	950403-950433	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156271	7	0.774
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152074	7	0.774
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155779	7	0.774
NZ_CP054303_2	2.8\|947499\|49\|NZ_CP054303\|CRT	947499-947547	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154171-154219	8	0.837
NZ_CP054303_2	2.9\|947571\|37\|NZ_CP054303\|CRT	947571-947607	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1564-1600	8	0.784
NZ_CP054303_2	2.11\|947691\|43\|NZ_CP054303\|CRT	947691-947733	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156037-156079	8	0.814
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1168-1204	8	0.784
NZ_CP054303_2	2.16\|948051\|37\|NZ_CP054303\|CRT	948051-948087	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	7-43	8	0.784
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155779	8	0.742
NZ_CP054303_2	2.18\|948189\|31\|NZ_CP054303\|CRT	948189-948219	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887844	8	0.742
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1168-1204	8	0.784
NZ_CP054303_2	2.21\|948357\|31\|NZ_CP054303\|CRT	948357-948387	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2122-2152	8	0.742
NZ_CP054303_2	2.23\|948459\|31\|NZ_CP054303\|CRT	948459-948489	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-25	8	0.742
NZ_CP054303_2	2.38\|949539\|49\|NZ_CP054303\|CRT	949539-949587	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154171-154219	8	0.837
NZ_CP054303_2	2.44\|949971\|31\|NZ_CP054303\|CRT	949971-950001	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2122-2152	8	0.742
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887844	8	0.742
NZ_CP054303_2	2.52\|950457\|31\|NZ_CP054303\|CRT	950457-950487	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887844	8	0.742
NZ_CP054303_2	2.53\|950511\|31\|NZ_CP054303\|CRT	950511-950541	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2122-2152	8	0.742
NZ_CP054303_2	2.9\|947571\|37\|NZ_CP054303\|CRT	947571-947607	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3064-3100	9	0.757
NZ_CP054303_2	2.9\|947571\|37\|NZ_CP054303\|CRT	947571-947607	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3208-3244	9	0.757
NZ_CP054303_2	2.11\|947691\|43\|NZ_CP054303\|CRT	947691-947733	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1786-1828	9	0.791
NZ_CP054303_2	2.11\|947691\|43\|NZ_CP054303\|CRT	947691-947733	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151360-151402	9	0.791
NZ_CP054303_2	2.24\|948513\|31\|NZ_CP054303\|CRT	948513-948543	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-25	9	0.71
NZ_CP054303_2	2.38\|949539\|49\|NZ_CP054303\|CRT	949539-949587	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155731-155779	9	0.816
NZ_CP054303_2	2.42\|949809\|67\|NZ_CP054303\|CRT	949809-949875	67	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2524-2590	9	0.866
NZ_CP054303_2	2.1\|947007\|55\|NZ_CP054303\|CRT	947007-947061	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154129-154183	10	0.818
NZ_CP054303_2	2.20\|948297\|37\|NZ_CP054303\|CRT	948297-948333	37	KX752698	Mycobacterium phage Tonenili, complete genome	37355-37391	10	0.73
NZ_CP054303_2	2.49\|950295\|31\|NZ_CP054303\|CRT	950295-950325	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-25	10	0.677
NZ_CP054303_2	2.12\|947757\|67\|NZ_CP054303\|CRT	947757-947823	67	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1642-1708	16	0.761

1. spacer 2.5|947343|19|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

tgactccgactccgacagc	CRISPR spacer
tgactccgactccgacagc	Protospacer
*******************

2. spacer 2.5|947343|19|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgactccgactccgacagc	CRISPR spacer
tgactccgactccgacagc	Protospacer
*******************

3. spacer 2.5|947343|19|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgactccgactccgacagc	CRISPR spacer
tgactccgactccgacagc	Protospacer
*******************

4. spacer 2.10|947631|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cgacagtgattcggatgctgacagcgactctgactcc	CRISPR spacer
cgacagtgattcggatgctgacagcgactctgactcc	Protospacer
*************************************

5. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactctgacagcgactcggattct	Protospacer
*******************************

6. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactcggattct	Protospacer
*******************************

7. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactcggattct	Protospacer
*******************************

8. spacer 2.26|948639|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cgactcggattctgactccgactctgattcc	CRISPR spacer
cgactcggattctgactccgactctgattcc	Protospacer
*******************************

9. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggactcc	Protospacer
*******************************

10. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggactcc	Protospacer
*******************************

11. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactctgacagcgattcggattct	Protospacer
*******************************

12. spacer 2.50|950349|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgatagtgactccgattcg	Protospacer
*******************************

13. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcagactctgacagcgattccgactcc	Protospacer
*******************************

14. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
********** ********************

15. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
********** ********************

16. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.******************************

17. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.******************************

18. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.******************************

19. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.******************************

20. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.******************************

21. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggattct	Protospacer
****** ************************

22. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggatgctgacagcgattcggatgct	Protospacer
*********************.*********

23. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgactccgactcc	Protospacer
*********************.*********

24. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcagactctgacagcgattccgactcc	Protospacer
******.************************

25. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
************************ ******

26. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgattcc	Protospacer
.************************

27. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcc	Protospacer
****** ******************

28. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcc	Protospacer
****** ******************

29. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcc	Protospacer
****** ******************

30. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcc	Protospacer
****** ******************

31. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagcgattcc	Protospacer
************ ************

32. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagcgattcc	Protospacer
************ ************

33. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgattccgattcggacagcgattcc	Protospacer
***.*********************

34. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgattcc	Protospacer
.************************

35. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattcggacagtgattcc	Protospacer
******************.******

36. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactccgattct	Protospacer
************************ ******

37. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
************.******************

38. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgactccgacagcgactcggattct	Protospacer
****** ************************

39. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactccgattct	Protospacer
************************ ******

40. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.***************************

41. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.***************************

42. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
************.******************

43. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactccgattct	Protospacer
************************ ******

44. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactccgattct	Protospacer
************************ ******

45. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
************.******************

46. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.***************************

47. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgactccgacagcgactcggattct	Protospacer
****** ************************

48. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.***************************

49. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactccgactctgacagcgattcggactct	Protospacer
******************************.

50. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactccgactctgacagcgactcggactcc	Protospacer
*********************.*********

51. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactcggactctgacagcgattcggactcc	Protospacer
****** ************************

52. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
***.***************************

53. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
***.***************************

54. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.98

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
tgattccgactctgacagcgactcggattccgacagcgactcggactct	Protospacer
****** ******************************************

55. spacer 2.33|949179|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.98

cgactcggactccgacagcgactcggattctgactccgactctgattcc	CRISPR spacer
cgactccgactccgacagcgactcggattctgactccgactctgattcc	Protospacer
****** ******************************************

56. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggactct	Protospacer
******************************.

57. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggactct	Protospacer
******************************.

58. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactctgacagcgactcggactcc	Protospacer
.******************************

59. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
***************************.***

60. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
***************************.***

61. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
***************************.***

62. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
***************************.***

63. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgactccgactctgacagcgactcggactcc	Protospacer
***.***************************

64. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
*********************.*********

65. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
*********************.*********

66. spacer 2.45|950025|49|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.98

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
cgattcggactccgacagcgactcggattctgacagcgactctgactct	Protospacer
************************************************.

67. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactccgacagcgattcggattct	Protospacer
************.******************

68. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
****** ************************

69. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactcggacagcgattcggattct	Protospacer
************ ******************

70. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
****** ************************

71. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactccgacagcgattcggattct	Protospacer
************.******************

72. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactccgacagcgattcggattct	Protospacer
************.******************

73. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactctgactctgacagcgattcggattct	Protospacer
.******************************

74. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.968

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactctgacagcgattcggactct	Protospacer
***************************.***

75. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
******************************

76. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
******************************

77. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
******************************

78. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
******************************

79. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
******************************

80. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********************.*********

81. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
************.******************

82. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
************ ******************

83. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
************ ******************

84. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
************.******************

85. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********************.*********

86. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********************.*********

87. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
************.******************

88. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********************.*********

89. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********************.*********

90. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
************ ******************

91. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattccgacagcgactctgactcg	Protospacer
*********************.*********

92. spacer 2.50|950349|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
***************.***************

93. spacer 2.50|950349|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
***************.***************

94. spacer 2.50|950349|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
***************.***************

95. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggactctgacagcgattcggactct	Protospacer
******************.************

96. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.968

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggactctgacagtgattccgactct	Protospacer
************************ ******

97. spacer 2.10|947631|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

cgacagtgattcggatgctgacagcgactctgactcc	CRISPR spacer
cgacagtgattcggattctgacagcgactcagactcc	Protospacer
**************** ************* ******

98. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggatgctgacagcgattcggactct	Protospacer
*********.*****************.***

99. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggattct	Protospacer
*********. ********************

100. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggatgctgacagcgattcggatgct	Protospacer
*********.****************** **

101. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactctgactctgacagcgattcggattct	Protospacer
****** *** ********************

102. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggattct	Protospacer
*********. ********************

103. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattcg	Protospacer
********** *******************

104. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
***.****** ********************

105. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
********** **********.*********

106. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
********** **********.*********

107. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
********** **********.*********

108. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
***.****** ********************

109. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgattcggacagcgactctgactccgacagc	Protospacer
.**.*********************************

110. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattcggattcggacagcgactccgactccgacagc	Protospacer
****** *****************.************

111. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgactccgattcggacagcgactctgactctgacagc	Protospacer
***.**************************.******

112. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattcggattcggacagcgactctgactcggacagc	Protospacer
****** *********************** ******

113. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgactccgattcggacagcgactctgactcggacagc	Protospacer
***.************************** ******

114. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactcggattccgacagc	Protospacer
************************ **.*********

115. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattccgacagcgactcggactccgacagc	Protospacer
************ *********** ************

116. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactcggattccgacagc	Protospacer
************************ **.*********

117. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactcggattccgacagc	Protospacer
************************ **.*********

118. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactcggattccgacagc	Protospacer
************************ **.*********

119. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattcggacagcgactcggattccgacagc	Protospacer
************************ **.*********

120. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
ggactcggactctgacagcgactcggattct	Protospacer
 **.***************************

121. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
.***********.******************

122. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactctgacagcgattcggattcc	Protospacer
*********************.********.

123. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactcggacagcgattcggattct	Protospacer
************ ********.*********

124. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattcc	Protospacer
.*****************************.

125. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattcg	Protospacer
.*****************************

126. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
.********************.*********

127. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactccgattct	Protospacer
.*********************** ******

128. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
.**.***************************

129. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactccgacagcgactcggattcg	Protospacer
************.*****************

130. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
****** ***********************.

131. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
.***********.******************

132. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
****** ***********************.

133. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
****** ***********************.

134. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
.***********.******************

135. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
****** ***********************.

136. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
.**.***************************

137. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
.**.***************************

138. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggactct	Protospacer
.**************************.***

139. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggactct	Protospacer
.**************************.***

140. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
.********************.*********

141. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggactct	Protospacer
****** ********************.***

142. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggactct	Protospacer
****** ********************.***

143. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactcggacagcgactcggactct	Protospacer
************ **************.***

144. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactctgacagcgattcggactct	Protospacer
*********************.*****.***

145. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
.***********.******************

146. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgattcggattct	Protospacer
****** **************.*********

147. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcagactctgacagcgactctgattct	Protospacer
******.***************** ******

148. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcagactctgacagcgactctgattct	Protospacer
******.***************** ******

149. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcagactctgacagcgactctgattct	Protospacer
******.***************** ******

150. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
tgactcggattctgacagcgactcggatgct	Protospacer
.********* ********************

151. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggatgctgacagcgactcggattcc	Protospacer
**************************** *.

152. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgattcggacagcgactctgactccgacagc	Protospacer
.********.***************************

153. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
tgactccgattcggacagcgactctgactctgacagc	Protospacer
*********.********************.******

154. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
tgactccgattcggacagcgactctgactcggacagc	Protospacer
*********.******************** ******

155. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattccgactct	Protospacer
.*****************************.

156. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattccgactct	Protospacer
****** ***********************.

157. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattccgactct	Protospacer
****** ***********************.

158. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*********************** ******

159. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactcggacagcgattccgactct	Protospacer
************ *****************.

160. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*********************** ******

161. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*********************** ******

162. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*********************** ******

163. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggactct	Protospacer
************************ *****.

164. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattccgattcc	Protospacer
.**************************.***

165. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagtgattccgactct	Protospacer
******************.***********.

166. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgactccgactcc	Protospacer
.********************.*********

167. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgactccgactcg	Protospacer
*********************.********

168. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggattctgacagcgattccgactcc	Protospacer
.********.*********************

169. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgactcggactctgacagcgattcggactcc	Protospacer
***.******************** ******

170. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgactcggattctgacagcgattccgactcc	Protospacer
***.*****.*********************

171. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggattcc	Protospacer
************************ **.***

172. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
****** ***************** ******

173. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
****** ***************** ******

174. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcg	Protospacer
****** *****************

175. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcg	Protospacer
****** *****************

176. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcg	Protospacer
****** *****************

177. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcg	Protospacer
****** *****************

178. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcg	Protospacer
****** *****************

179. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagcgattcg	Protospacer
************ ***********

180. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcg	Protospacer
****** *****************

181. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgattcg	Protospacer
****** *****************

182. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattcggacagcgattcc	Protospacer
.**.*********************

183. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattccgacagcgattcg	Protospacer
************ ***********

184. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcc	Protospacer
****** ***** ************

185. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcc	Protospacer
****** ***** ************

186. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagtgattcc	Protospacer
************ *****.******

187. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagtgattcc	Protospacer
****** ***********.******

188. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagtgattcc	Protospacer
************ *****.******

189. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcc	Protospacer
****** ***** ************

190. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgattccgattctgacagcgattcc	Protospacer
***.******** ************

191. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgattccgattctgacagcgattcc	Protospacer
***.******** ************

192. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgattccgattctgacagcgattcc	Protospacer
***.******** ************

193. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcc	Protospacer
****** ***** ************

194. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcc	Protospacer
****** ***** ************

195. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgattccgattctgacagcgattcc	Protospacer
***.******** ************

196. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
ggactccgattcggacagcgattcg	Protospacer
 ***********************

197. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgattcg	Protospacer
.***********************

198. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattccgacagcgattct	Protospacer
************ ***********.

199. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattcggacagcgactct	Protospacer
*********************.**.

200. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgactcggacagcgattct	Protospacer
*********.**************.

201. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactctgactcggacagcgattcc	Protospacer
******.**.***************

202. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagtgattcc	Protospacer
************ *****.******

203. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgactcc	Protospacer
****** **************.***

204. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattcg	Protospacer
***.**************************

205. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactcggactcc	Protospacer
***************************.**.

206. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattcg	Protospacer
************.*****************

207. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
*********.********************.

208. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
*********.********************.

209. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
*********.********************.

210. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
*********.********************.

211. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
*********.********************.

212. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattcc	Protospacer
***.**************************.

213. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattcc	Protospacer
***.**************************.

214. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggactct	Protospacer
***.***********************.***

215. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
************.**************.***

216. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
************.**************.***

217. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgattcggattct	Protospacer
*********.***********.*********

218. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagtgactcggattct	Protospacer
***.**************.************

219. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
***.********.******************

220. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
***.********.******************

221. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
***.********.******************

222. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggactct	Protospacer
*********.*****************.***

223. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
***.********.******************

224. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
***.********.******************

225. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
************.**************.***

226. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactcagacagcgactcggactct	Protospacer
************ **************.***

227. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattct	Protospacer
***.** ************************

228. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
************.**************.***

229. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgactccgacagcgactcggactct	Protospacer
****** ********************.***

230. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
ggactcggactctgacagcgactcggattct	Protospacer
 ***********.******************

231. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactctgactccgacagcgattcggattct	Protospacer
****** **************.*********

232. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
************.********.*********

233. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
************.**************.***

234. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggactct	Protospacer
***.***********************.***

235. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
************.********.*********

236. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcagactccgacagcgactcggactct	Protospacer
******.********************.***

237. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgattccgacagcgactcggattct	Protospacer
****** **.*********************

238. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactctgactccgacagcgattcggattct	Protospacer
****** **************.*********

239. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactctgactccgacagcgattcggattct	Protospacer
****** **************.*********

240. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggactct	Protospacer
*********.*****************.***

241. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactctgactccgacagcgactcggatgct	Protospacer
****** ********************* **

242. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactccgactctgacagcgactcggattct	Protospacer
****** *****.******************

243. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactccgattctgacagcgattcggactcc	Protospacer
.********.*********************

244. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactccgattctgacagcgattcggactct	Protospacer
*********.********************.

245. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactctgactctgacagcgattcggactct	Protospacer
******.***********************.

246. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactctgactctgacagcgattcggactct	Protospacer
******.***********************.

247. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactctgactctgacagcgactcggactcc	Protospacer
******.**************.*********

248. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactcggactccgacagcgattcggactcc	Protospacer
****** *****.******************

249. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggactcc	Protospacer
***.*****************.*********

250. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
***.** ************************

251. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggactcc	Protospacer
***.*****************.*********

252. spacer 2.26|948639|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggattctgactccgactctgattcc	CRISPR spacer
cgactcggactctgactccgactccgattcc	Protospacer
*********.**************.******

253. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.959

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgattcggactctgacagcgactcggattctgacagcgactcggactct	Protospacer
.*****************************.******************

254. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.959

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
tgattccgactctgacagcgactcggattccgacagcgactcggactcc	Protospacer
****** *****************************************.

255. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.959

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
tgattccgactctgacagcgactcggattccgacagcgactcggactcc	Protospacer
****** *****************************************.

256. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.959

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
tgattccgactctgacagcgactcggattccgacagcgactcggactcc	Protospacer
****** *****************************************.

257. spacer 2.32|949107|49|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.959

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
tgattcggactctgacagcgactccgactccgacagcgactcggactct	Protospacer
************************ **.*********************

258. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
.*****************.************

259. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
.*****************.************

260. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
.*****************.************

261. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggattcc	Protospacer
.*****************.************

262. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
************.*****.************

263. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
************.*****.************

264. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagcgactcggattcc	Protospacer
****** ***********.************

265. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
************.*****.************

266. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgactcggactctgacagtgactcggattcc	Protospacer
***.** ************************

267. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactctgacagtgattcggactcc	Protospacer
*********************.*****.***

268. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactctgacagtgattcggactcc	Protospacer
*********************.*****.***

269. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactctgacagcgactcggactcc	Protospacer
******************.********.***

270. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactctgacagcgactccgattcc	Protospacer
******************.***** ******

271. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattctgactctgacagtgactcggattct	Protospacer
******.***********************.

272. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgactccgactctgacagtgactcggattct	Protospacer
***.**************************.

273. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgactccgactctgacagtgactcggattct	Protospacer
***.**************************.

274. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgactcggactctgacagtgactcggattcc	Protospacer
***.** ************************

275. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactctgacagtgactccgactcc	Protospacer
************************ **.***

276. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggactcc	Protospacer
.***** ************************

277. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggattct	Protospacer
***************************.**.

278. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgactctgactctgacagcgactcggactcc	Protospacer
***.**.************************

279. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgattccgacagcgactcggactcc	Protospacer
*********.**.******************

280. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgattccgacagcgactcggactcc	Protospacer
*********.**.******************

281. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactccgacagcgactcggactct	Protospacer
************.*****************.

282. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
****** **************.*********

283. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattcggactctgacagcgactccgactcc	Protospacer
****** ***************** ******

284. spacer 2.45|950025|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.959

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
cgattccgactccgacagcgactcggattctgacagcgactcggactcc	Protospacer
****** *********************************** ******

285. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactcggacagcgattcggactct	Protospacer
************ **************.***

286. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggattct	Protospacer
****** **.*********************

287. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactcggacagcgattcggactct	Protospacer
************ **************.***

288. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggattct	Protospacer
****** **.*********************

289. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactccgactctgacagcgactcggattct	Protospacer
******.**************.*********

290. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattcg	Protospacer
****** ***********************

291. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactctgactctgacagcgattcggactct	Protospacer
.**************************.***

292. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactctgactctgacagcgattcggactct	Protospacer
.**************************.***

293. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
***.** ************************

294. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
****** **************.*********

295. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
****** **************.*********

296. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
****** **************.*********

297. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
***.** ************************

298. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactccgacagcgactcggattct	Protospacer
*********.********************

299. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgattcggattct	Protospacer
*********************.********

300. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
***************************.**

301. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
***************************.**

302. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggactct	Protospacer
***************************.**

303. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
***************************.**

304. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactccgacagcgactcggattct	Protospacer
*********.********************

305. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggactccgacagcgactcggattcg	Protospacer
***.*****.*********************

306. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggattcggacagcgactcggattcg	Protospacer
***.******** ******************

307. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagcgattcggattcg	Protospacer
************ ********.*********

308. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggattctgacagcgactcggattcg	Protospacer
***.********.******************

309. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactctgacagcgactcggattcg	Protospacer
*********.**.******************

310. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggattccgacagcgattcggattcg	Protospacer
***.*****************.*********

311. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagtgactccgattcg	Protospacer
******************.***** ******

312. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagtgactccgattcg	Protospacer
******************.***** ******

313. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagtgactccgattcg	Protospacer
******************.***** ******

314. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggattccgacagcgactcggattcc	Protospacer
.*****************************

315. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactccgattccgacagcgactcggattct	Protospacer
****** ***********************

316. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgactcggactct	Protospacer
***************************.**

317. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgactccgattcg	Protospacer
************.*********** ******

318. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattctgacagcgattctgactct	Protospacer
************.*****************

319. spacer 2.50|950349|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactccgacagtgactccgattcg	Protospacer
************.**.***************

320. spacer 2.50|950349|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgacagtgactctgattcg	Protospacer
***************.********.******

321. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgattcggactcc	Protospacer
************************ *****

322. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattccgattctgacagtgattccgactct	Protospacer
****** ***********************

323. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
*********.********************

324. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
*********.********************

325. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
*********.********************

326. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
*********.********************

327. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattccgattctgacagtgattccgactcc	Protospacer
****** ***********************

328. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgactctgactcg	Protospacer
*********************.**.******

329. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgactctgactcg	Protospacer
*********************.**.******

330. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactcggattctgacagtgattccgattcg	Protospacer
***.***********************.***

331. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgattcggactct	Protospacer
************************ *****

332. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagcgattccgactcc	Protospacer
******************.***********

333. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgattccgattcc	Protospacer
***************************.**

334. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattccgacagtgattccgactct	Protospacer
************.*****************

335. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggatgctgacagtgattcggactcg	Protospacer
********** ************* ******

336. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactcggattctgacagtgattcggactcg	Protospacer
***.******************** ******

337. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgactcggactcg	Protospacer
*********************.** ******

338. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagcgactccgactcg	Protospacer
******************.**.*********

339. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgattcggactct	Protospacer
.*****************.************

340. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*********************** ******

341. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*********************** ******

342. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*********************** ******

343. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*********************** ******

344. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggactctgacagtgactctgactct	Protospacer
*********************.** ******

345. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgactcggactctgacagtgactcggactct	Protospacer
***.*****************.*********

346. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggattctgacagtgattcggactct	Protospacer
.********.*********************

347. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
******************.***********.

348. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggattctgacagcgattcggactct	Protospacer
*********.********.************

349. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
******.***************** ******

350. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
****** ***************** ******

351. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
****** ***************** ******

352. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattccgactct	Protospacer
****** ***********************.

353. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattccgactct	Protospacer
****** ***********************.

354. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgactccgactcc	Protospacer
******.**************.*********

355. spacer 2.6|947385|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

cgactcagactccgacagcgactctgactccgacagcgactccgattcg	CRISPR spacer
cgactcggactccgacagcgactcggactccgacagcgactccgattct	Protospacer
******.***************** ***********************

356. spacer 2.8|947499|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.939

tgattccgatgctgacagcgattcggactccgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgattcggactccgacagcgactcggattct	Protospacer
.***** *** **************************************

357. spacer 2.10|947631|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgacagtgattcggatgctgacagcgactctgactcc	CRISPR spacer
tgacagcgattcggatgctgacagcgactctgactct	Protospacer
.*****.*****************************.

358. spacer 2.10|947631|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgacagtgattcggatgctgacagcgactctgactcc	CRISPR spacer
cgacagtgattcggattcggacagcgactctgactcg	Protospacer
**************** * *****************

359. spacer 2.13|947847|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

tgattcggattcggacagcgactccgactctgacagcgattcggactct	CRISPR spacer
cgattccgattcggacagcgattccgactctgacagcgattcggactct	Protospacer
.***** **************.***************************

360. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggacgctgacagcgattcggattct	CRISPR spacer
ggactcggactctgacagcgactcggattct	Protospacer
 ********* **********.*********

361. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggatgctgacagcgactcggattcc	Protospacer
*********.***********.********.

362. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattcg	Protospacer
********** **********.********

363. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggacgctgacagcgattcggattct	CRISPR spacer
tgactctgactctgacagcgattcggattct	Protospacer
.***** *** ********************

364. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgattctgacagcgactctgactccgacagc	Protospacer
.**.******** ************************

365. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgattctgacagcgactctgactccgacagc	Protospacer
.**.******** ************************

366. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattccgacagcgactcggactccgacagt	Protospacer
************ *********** ***********.

367. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.919

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgattctgacagcgactctgactccgacagc	Protospacer
.**.******** ************************

368. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
.**.*****************.*********

369. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.***********************.***

370. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggactct	Protospacer
.***********.**************.***

371. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactctgacagcgattcggactcc	Protospacer
*********************.*****.**.

372. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagtgactcggattct	Protospacer
.********.********.************

373. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
.**.*****************.*********

374. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactctgacagcgactccgactcg	Protospacer
************************ **.**

375. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattctgactctgacagtgactcggattct	Protospacer
.***** ***********.************

376. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggactcc	Protospacer
****** ********************.**.

377. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactccgactctgacagcgactcggattct	Protospacer
.**.** ************************

378. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattcg	Protospacer
.***********.*****************

379. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactcggacagcgactcggattcg	Protospacer
.*********** *****************

380. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgactcggattcg	Protospacer
.********.********************

381. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggactcc	Protospacer
.**************************.**.

382. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattcg	Protospacer
.**.**************************

383. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactcggacagcgactcggattcg	Protospacer
.*********** *****************

384. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattcc	Protospacer
.***********.*****************.

385. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggattcc	Protospacer
.***********.*****************.

386. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactcggattct	Protospacer
.**.********.******************

387. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgactcggactct	Protospacer
.***********.**************.***

388. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.***********************.***

389. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.***********************.***

390. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgactcggactct	Protospacer
.********.*****************.***

391. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgattcggattct	Protospacer
.********.***********.*********

392. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgattcggattct	Protospacer
.********.***********.*********

393. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagtgactcggattct	Protospacer
.***********.*****.************

394. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgattcggactct	Protospacer
.********************.*****.***

395. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattcggacagcgactcggattct	Protospacer
.********.** ******************

396. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.***********************.***

397. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagcgactcggattct	Protospacer
.**.********.******************

398. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgactcggactcc	Protospacer
****** ********************.**.

399. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggattctgacagtgactcggattcc	Protospacer
*********.********.***********.

400. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattct	Protospacer
.***** *****.******************

401. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.***********************.***

402. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactcggacagcgactccgattcc	Protospacer
************ *********** *****.

403. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgactcggactct	Protospacer
.********.*****************.***

404. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattcggactctgacagcgactccgactcc	Protospacer
************************ **.**.

405. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggatgctgacagcgattcggactct	Protospacer
*********************.*****. **

406. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
********** ***************** *

407. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
********** ***************** *

408. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
********** ***************** *

409. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggactct	Protospacer
********** ****************. **

410. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgattctgacagcgactctgactccgacagc	Protospacer
.********.** ************************

411. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgactccgacagcgactctgactcggacagc	Protospacer
.*********** ***************** ******

412. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgactcggacagcgactcggactctgacagc	Protospacer
.*********************** *****.******

413. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgattctgacagcgactctgactccgacagc	Protospacer
.********.** ************************

414. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgactcggacagcgattctgactctgacagc	Protospacer
.********************.********.******

415. spacer 2.20|948297|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
tgactccgactctgacagcgactcggactccgacagt	Protospacer
************ *********** ***********.

416. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.919

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgattctgacagcgactctgactccgacagc	Protospacer
.********.** ************************

417. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactct	Protospacer
.*********************** *****.

418. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*****************.***********.

419. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*****************.***********.

420. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*****************.***********.

421. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*****************.***********.

422. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgactcggactcc	Protospacer
.********************.** ******

423. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactccgacagcgattcggactcc	Protospacer
.***********.*********** ******

424. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactccgacagcgattcggactcc	Protospacer
.***********.*********** ******

425. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactccgacagcgattcggactcc	Protospacer
.***********.*********** ******

426. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactccgacagcgattcggactcc	Protospacer
.***********.*********** ******

427. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggattctgacagcgattcggactct	Protospacer
*********.************** *****.

428. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggattctgacagcgattcggactcc	Protospacer
.********.************** ******

429. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgactcggactctgacagcgactccgactcc	Protospacer
.**.*****************.*********

430. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactcggacagcgactccgactcc	Protospacer
.*********** ********.*********

431. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggattctgacagcgattcggactcg	Protospacer
*********.************** *****

432. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgactcg	Protospacer
.********************.**

433. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactcggattcggacagcgattcg	Protospacer
.***** *****************

434. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagtgattcg	Protospacer
.*****************.*****

435. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgactcg	Protospacer
.********************.**

436. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattctgacagcgattcg	Protospacer
.*********** ***********

437. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgactcg	Protospacer
.********************.**

438. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactctgattcggacagcgattcg	Protospacer
.*****.*****************

439. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgactcg	Protospacer
.********************.**

440. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgactcg	Protospacer
.********************.**

441. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcg	Protospacer
****** ***** ***********

442. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcg	Protospacer
****** ***** ***********

443. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcg	Protospacer
****** ***** ***********

444. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgactcg	Protospacer
****** **************.**

445. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgactcg	Protospacer
****** **************.**

446. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgactcg	Protospacer
****** **************.**

447. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagtgactcc	Protospacer
.*****************.**.***

448. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

449. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgattcggattcggacagcgattcg	Protospacer
***.** *****************

450. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgattcggattcggacagcgattcg	Protospacer
***.** *****************

451. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcg	Protospacer
****** ***** ***********

452. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

453. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgattcggattcggacagcgattcg	Protospacer
***.** *****************

454. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcg	Protospacer
****** ***** ***********

455. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgactcg	Protospacer
****** **************.**

456. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

457. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgattcggattcggacagcgattcg	Protospacer
***.** *****************

458. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcg	Protospacer
****** ***** ***********

459. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

460. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgattcggattcggacagcgattcg	Protospacer
***.** *****************

461. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattccgacagcgattcg	Protospacer
****** ***** ***********

462. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattcggacagcgactcg	Protospacer
****** **************.**

463. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

464. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

465. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

466. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

467. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagtgactcc	Protospacer
.*****************.**.***

468. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactcggattccgacagcgattcc	Protospacer
.***** ***** ************

469. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattccgacagtgattcg	Protospacer
************ *****.*****

470. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattccgacagtgattcg	Protospacer
************ *****.*****

471. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgactct	Protospacer
.********************.**.

472. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgactct	Protospacer
.********************.**.

473. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagcgactcg	Protospacer
.********************.**

474. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagcgactct	Protospacer
************ ********.**.

475. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactctgactcggacagcgattcg	Protospacer
******.**.**************

476. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactctgactcggacagcgattcg	Protospacer
******.**.**************

477. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactctgactcggacagcgattcg	Protospacer
******.**.**************

478. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgactcggattctgacagcgattcc	Protospacer
.***** ***** ************

479. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgactcggacagcgactcg	Protospacer
*********.***********.**

480. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattccgacagcgactcg	Protospacer
************ ********.**

481. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

482. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactctgactcggacagcgattcg	Protospacer
******.**.**************

483. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagcgactct	Protospacer
************ ********.**.

484. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
tgattcggattcggacagcgattcc	Protospacer
.**.** ******************

485. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagcgactct	Protospacer
************ ********.**.

486. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgactcggacagcgactct	Protospacer
*********.***********.**.

487. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcggattctgacagcgattcg	Protospacer
****** ***** ***********

488. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattcagacagtgattca	Protospacer
************.*****.*****

489. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattctgacagcgactct	Protospacer
************ ********.**.

490. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactctgactcggacagcgattcg	Protospacer
******.**.**************

491. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattcagacagtgattca	Protospacer
************.*****.*****

492. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattcagacagtgattca	Protospacer
************.*****.*****

493. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattcagacagtgattca	Protospacer
************.*****.*****

494. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattcagacagtgattca	Protospacer
************.*****.*****

495. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactcagattcagacagcgattca	Protospacer
****** *****.***********

496. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

cgactccgattcggacagcgattcc	CRISPR spacer
cgactccgattcagatagcgattcg	Protospacer
************.**.********

497. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggactccgacagcgattcggattcg	Protospacer
.********************.********

498. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggactccgacagcgactcggactcc	Protospacer
.**************************.**.

499. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgattcggactccgacagcgactcggattcg	Protospacer
.**.**************************

500. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggactccgacagcgactcggactcc	Protospacer
.**************************.**.

501. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactcggacagcgactcggattcg	Protospacer
***.******** *****************

502. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattcg	Protospacer
***.** ***********************

503. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
***.** ***********************.

504. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
***.** ***********************.

505. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********.***********.********

506. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
*********.**.*****************

507. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
*********.** *****************

508. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
*********.** *****************

509. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
*********.**.*****************

510. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgattcggattcc	Protospacer
***.*****************.********.

511. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattcc	Protospacer
***.********.*****************.

512. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
***.** ***********************.

513. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactcggattcg	Protospacer
***.********.*****************

514. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggattccgacagcgactcggactct	Protospacer
.********.*****************.***

515. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagtgactcggattcc	Protospacer
************.*****.***********.

516. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********.***********.********

517. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
*********.*****************.**.

518. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********.***********.********

519. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
*********.**.*****************

520. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********.***********.********

521. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
*********.*****************.**.

522. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
*********.***********.********

523. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
*********.*****************.**.

524. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
*********.** *****************

525. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactcggacagcgactcggattcg	Protospacer
***.******** *****************

526. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattcg	Protospacer
************.********.********

527. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagtgactccgattcg	Protospacer
******************.***** *****

528. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagtgactccgattcg	Protospacer
******************.***** *****

529. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactccgattcc	Protospacer
************.*********** *****.

530. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactcc	Protospacer
************.**************.**.

531. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggattccgacagcgactcggattcc	Protospacer
.********.********************.

532. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggactccgacagcgactcggactcc	Protospacer
.**************************.**.

533. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgattcggactctgacagcgactcggattct	Protospacer
.**.********.******************

534. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagtgattcggattcg	Protospacer
******************.**.********

535. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagtgactcggattcc	Protospacer
************.*****.***********.

536. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
ggactcggactcggacagcgactcggactct	Protospacer
 *********** **************.***

537. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactccgactccgacagcgattcggattct	Protospacer
.***** **************.*********

538. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactccgacagtgattcggattcg	Protospacer
******************.**.********

539. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattccgactctgacagcgattcggactct	Protospacer
.**.**************************.

540. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactcggattctgacagcgattcggactct	Protospacer
****** **.********************.

541. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgattccgactct	Protospacer
***.******************** *****.

542. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgattccgactct	Protospacer
***.******************** *****.

543. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.**.** ************************

544. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggactct	Protospacer
***.*****************.********.

545. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactctgactctgacagcgattcggattct	Protospacer
******.********************.**.

546. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgactcggactct	Protospacer
***.*****************.********.

547. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattccgactctgacagtgattcggactcc	Protospacer
.**.**************.************

548. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactccgactccgacagcgattcagactcg	Protospacer
************.***********.*****

549. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattccgactctgacagtgattcggactcc	Protospacer
.**.**************.************

550. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactccgattctgacagcgattccgactcc	Protospacer
.********.************** ******

551. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattccgactctgacagcgactcggactcc	Protospacer
.**.*****************.*********

552. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.**.** ************************

553. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactccgattctgacagcgattccgactcc	Protospacer
.********.************** ******

554. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.**.** ************************

555. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.**.** ************************

556. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactcc	Protospacer
.***** **************.*********

557. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattcggactctgacagcgattcggactct	Protospacer
***.** ***********************.

558. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactctgactcggacagcgattcggactcc	Protospacer
.*****.***** ******************

559. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactccgactccgacagcgattcggattct	Protospacer
************.**************.**.

560. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactctgactctgacagcgattcggactct	Protospacer
.*****.***********************.

561. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactctgactcggacagcgattcggactcc	Protospacer
.*****.***** ******************

562. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgattcggattct	Protospacer
***.***********************.**.

563. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactccgattctgacagtgattcggactct	Protospacer
*********.********.***********.

564. spacer 2.25|948567|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.939

cgactcggatgctgacagcgactcggatgctgacagcgattcggactcc	CRISPR spacer
tgactcggattctgacagcgactcggatgctgacagcgattcggactct	Protospacer
.********* *************************************.

565. spacer 2.30|948933|61|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.951

cgattccgactccgacagcgactcggattccgacagcgactccgattcggacagcgattc	CRISPR spacer
cgattccgactccgacagcgactcggattccgacagtgactccgattcggacagcgactc	Protospacer
************************************.********************.**

566. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgactcggactctgacagtgactcggattccgacagcgactcggactct	Protospacer
.**.**************.******************************

567. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgattcggactctgacagcgactcggattctgacagcgattcggactct	Protospacer
.*****************************.********.*********

568. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgattcggactctgacagcgactcggattctgacagcgattcggactct	Protospacer
.*****************************.********.*********

569. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgattcggactctgacagcgactcggactctgacagcgactcggactct	Protospacer
.**************************.**.******************

570. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgattcggactctgacagcgattcggattctgacagcgactcggactct	Protospacer
.********************.********.******************

571. spacer 2.38|949539|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.939

tgattccgactctgacagcgattcggactccgacagtgactcggatgct	CRISPR spacer
tgattccgactctgacagcgattcggactccgacagtgattcggattcg	Protospacer
***************************************.****** *

572. spacer 2.39|949611|55|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.945

cgattcggactctgacagtgactcggattcggacagcgactccgactccgactct	CRISPR spacer
cgattcggactccgacagtgattcggattcggacagcgactccgactccgactcg	Protospacer
************.********.********************************

573. spacer 2.40|949689|43|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggattccgacagcgattccgactccgacagcgactcggattcc	Protospacer
 **************.******** ******************

574. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggattct	Protospacer
.*****************.***********.

575. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactccgacagcgactcggattcg	Protospacer
************.*****.***********

576. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactccgacagtgactcggattct	Protospacer
****** *****.*****************.

577. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
****** ***********.***********.

578. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactccgacagtgactccgattct	Protospacer
************.*********** *****.

579. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagcgactcggattcg	Protospacer
****** ***********.***********

580. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagtgactctgattcg	Protospacer
****** ***************** *****

581. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
****** ***********.***********.

582. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
****** ***********.***********.

583. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
****** ***********.***********.

584. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
****** ***********.***********.

585. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactctgacagcgattcggattcg	Protospacer
******************.**.********

586. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggactcc	Protospacer
.*****************.********.***

587. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattcggattctgacagtgactcggattcc	Protospacer
.***** **.*********************

588. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
****** ***************** *****

589. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactccgacagtgactccgattcg	Protospacer
************.*********** *****

590. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactccgacagtgactccgattcg	Protospacer
************.*********** *****

591. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattccgactccgacagcgactcggattct	Protospacer
************.*****.***********.

592. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
****** ***************** *****

593. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggattctgacagtgactcggattct	Protospacer
****** **.********************.

594. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
****** ***************** *****

595. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggactcc	Protospacer
.*****************.********.***

596. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattccgactctgacagtgactcggattcc	CRISPR spacer
cgactccgactctgacagcgactcggattct	Protospacer
***.**************.***********.

597. spacer 2.43|949899|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

tgattccgactcggacagcgattccgattccgacagtgattccgactct	CRISPR spacer
cgattccgactctgacagcgattccgattctgacagtgattccgactct	Protospacer
.*********** *****************.******************

598. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactcagacagcgactcggactca	Protospacer
.*********** *****************

599. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactctgacagcgattcggactct	Protospacer
.********************.********.

600. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggactct	Protospacer
.***** ***********************.

601. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggactct	Protospacer
.***** ***********************.

602. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
.***********.**************.***

603. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
.***********.**************.***

604. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgattccgacagcgactcggactct	Protospacer
*********.**.*****************.

605. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgattccgactct	Protospacer
*********************.** *****.

606. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgattccgactct	Protospacer
*********************.** *****.

607. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggattcc	Protospacer
.***** ********************.***

608. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
.***********.**************.***

609. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.***** **************.*********

610. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgactccgactctgacagcgattcggactct	Protospacer
***.*****************.********.

611. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactctgacagtgattcggactcc	Protospacer
.*****************.**.*********

612. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactctgacagtgattcggactcc	Protospacer
.*****************.**.*********

613. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.***** **************.*********

614. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.***** **************.*********

615. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.***** **************.*********

616. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgattccgacagcgactcggactct	Protospacer
*********.**.*****************.

617. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattcggactcggacagcgactcggactct	Protospacer
****** ***** *****************.

618. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactcc	Protospacer
.**.** ************************

619. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattcggactctgacagcgattcggactct	Protospacer
****** **************.********.

620. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactctgacagcgactccgattcc	Protospacer
.*********************** **.***

621. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgactcggactct	Protospacer
.***********.*****************.

622. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattcggactctgacagcgactcggattct	Protospacer
****** ********************.**.

623. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggattctgacagcgactcggactcc	Protospacer
.***** **.*********************

624. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactccgactcc	Protospacer
.***** ***************** ******

625. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattctgactctgacagcgactctgactcc	Protospacer
.*****.***************** ******

626. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattcggactctgacagcgactccgactcg	Protospacer
****** ***************** *****

627. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgactcagactcc	Protospacer
.***********.***********.******

628. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactctgacagtgactccgactcc	Protospacer
.*****************.***** ******

629. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgattcggattct	Protospacer
*********************.*****.**.

630. spacer 2.45|950025|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
cgattcggactctgacagcgactcggattctgacagcgactcggactct	Protospacer
************.***************************** *****.

631. spacer 2.45|950025|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
cgattcggactccgacagcgactcggattctgacagcgattcggactct	Protospacer
***************************************.** *****.

632. spacer 2.45|950025|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
cgattcggactccgacagcgactcggattctgacagcgattcggactct	Protospacer
***************************************.** *****.

633. spacer 2.45|950025|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.939

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
cgattcggactccgacagcgactcggactctgacagcgactcggactct	Protospacer
***************************.************** *****.

634. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactctgacagcgactccgattcc	Protospacer
*********************.** *****.

635. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactcggacagcgattcggactcc	Protospacer
************ **************.**.

636. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
ggactcggactctgacagcgactcggattct	Protospacer
 ***** **************.*********

637. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactcggacagcgattccgattcc	Protospacer
************ *********** *****.

638. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactccgactccgacagcgattcggattct	Protospacer
.*****.*****.******************

639. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactctgactctgacagcgactccgattct	Protospacer
.********************.** ******

640. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactctgactcggatagcgattcggattct	Protospacer
.*********** **.***************

641. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgactcggattcg	Protospacer
****** **************.********

642. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactccgactctgacagcgattcggactct	Protospacer
.*****.********************.***

643. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgattccgactctgacagcgattcggattcg	Protospacer
***.**.***********************

644. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactcggacagcgattcggactcc	Protospacer
************ **************.**.

645. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgattccgactctgacagcgattcggattct	Protospacer
.**.**.************************

646. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggattccgacagcgactcggactct	Protospacer
.**************************.**

647. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgattccgattccgacagcgactcggattcg	Protospacer
.**.** ************************

648. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagcgattcggattct	Protospacer
************ ********.********

649. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattccgacagcgattcggactcc	Protospacer
*********************.*****.**

650. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggattcggacagcgactcggattcc	Protospacer
***.******** *****************

651. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggactccgacagcgattcggattcg	Protospacer
.********.***********.*********

652. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactccgacagcgactccgattct	Protospacer
*********.************** *****

653. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactccgacagcgactcggactcc	Protospacer
*********.*****************.**

654. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagcgactcggactct	Protospacer
************ **************.**

655. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
*********.**.*****************

656. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgactcggactct	Protospacer
************.**************.**

657. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactccgactccgacagcgactcggattct	Protospacer
****** **.********************

658. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactccgacagcgactccgattct	Protospacer
*********.************** *****

659. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgattcggactccgacagcgactcggattcg	Protospacer
.**.*****.*********************

660. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactccgattcggacagcgactcggattcg	Protospacer
.***** ***** ******************

661. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagcgactcggactcc	Protospacer
************ **************.**

662. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.*****.********************

663. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.*****.********************

664. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
*********.**.*****************

665. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggattcggacagcgactcggattct	Protospacer
***.******** *****************

666. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggattcggacagcgactcggattcc	Protospacer
***.******** *****************

667. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggattcggacagtgactcggattcg	Protospacer
.*********** *****.************

668. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactccgacagcgactccgattct	Protospacer
*********.************** *****

669. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggactccgacagcgactcggattcc	Protospacer
***.*****.********************

670. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactccgacagcgactccgattct	Protospacer
*********.************** *****

671. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgactcggactcc	Protospacer
************.**************.**

672. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggactccgacagcgactcggattcc	Protospacer
***.*****.********************

673. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggactctgacagcgactcggattct	Protospacer
*********.**.*****************

674. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactccgactccgacagcgactcggattct	Protospacer
****** **.********************

675. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggattccgacagcgactctgactcg	Protospacer
.*********************** **.***

676. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactccgattccgacagtgactcggattcc	Protospacer
****** ***********.***********

677. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgattcggattct	Protospacer
************.********.********

678. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.*****.********************

679. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgactccgattct	Protospacer
************.*********** *****

680. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggatgctgacagcgactcggattcc	Protospacer
********** *.*****************

681. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattcggacagcgactccgattct	Protospacer
************ *********** *****

682. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgattcggattct	Protospacer
************.********.********

683. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgattcggactccgacagcgactcggattct	Protospacer
***.*****.********************

684. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactccgattccgacagcgattctgactct	Protospacer
.***** ***********************

685. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgactctgactcg	Protospacer
.***********.********.*********

686. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattctgacagcgattccgactcc	Protospacer
************.***********.*****

687. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattccgactcc	Protospacer
.***********************.*****

688. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattccgactcc	Protospacer
.***********************.*****

689. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattcggactcc	Protospacer
.*********************** *****

690. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattccgactct	Protospacer
.***********************.*****

691. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattccgactct	Protospacer
.***********************.*****

692. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattccgactcc	Protospacer
.***********************.*****

693. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattcggactcg	Protospacer
.*********** *********** ******

694. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
.*********************** **.***

695. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattcggacagcgattcggactct	Protospacer
************ *********** *****

696. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattctgacagcgattcggactct	Protospacer
************.*********** *****

697. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggactccgacagcgattcggactcc	Protospacer
*********.************** *****

698. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattccgacagcgactcggactct	Protospacer
*********************.** *****

699. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
.*********************** **.***

700. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
.*********************** **.***

701. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
.*********************** **.***

702. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattcggattcg	Protospacer
.*********************** **.***

703. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgattcggactcg	Protospacer
.***********.*********** ******

704. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgactcggattccgacagcgattctgactcg	CRISPR spacer
tgactcggattccgacagcgattccgattct	Protospacer
************************.**.**

705. spacer 2.50|950349|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgacagcgactccgattct	Protospacer
***************.**.***********

706. spacer 2.50|950349|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggactctgatagtgactccgattcg	CRISPR spacer
cgattcggactctgacagtgattccgattca	Protospacer
***************.*****.********.

707. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactccgattctgacagtgattccgactct	Protospacer
***.** ***********************

708. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactccgattctgacagtgattccgactct	Protospacer
***.** ***********************

709. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgactcggactcc	Protospacer
*********************.** *****

710. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggactctgacagtgattccgattca	Protospacer
*********.*****************.**.

711. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggactctgacagcgattccgactct	Protospacer
*********.********.***********

712. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagcgattcggactct	Protospacer
******************.***** *****

713. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactcggactctgacagtgattccgactct	Protospacer
***.*****.********************

714. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactcggactctgacagtgattccgactct	Protospacer
***.*****.********************

715. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgactcggactcc	Protospacer
*********************.** *****

716. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactcggattctgacagtgactccgactct	Protospacer
***.*****************.********

717. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagtgattcggattct	Protospacer
************************ **.**

718. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactcggattctgacagtgattcggactcc	Protospacer
***.******************** *****

719. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattccgattctgacagcgattccgactct	Protospacer
****** ***********.***********

720. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactcggattctgacagtgattcagactct	Protospacer
***.******************** *****

721. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
tgattcggattccgacagtgattcggactcg	Protospacer
.***********.*********** ******

722. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattctgacagcgattcggactcc	Protospacer
******************.***** *****

723. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgattcggattccgacagtgactccgactcc	Protospacer
************.********.********

724. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
cgactccgattctgacagtgattccgactcc	Protospacer
***.** ***********************

725. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
tgattcggattctgacagcgattcggactcg	Protospacer
.*****************.***** ******

726. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

cgattcggattctgacagtgattccgactcg	CRISPR spacer
tgattcggactctgacagtgattccgactct	Protospacer
.********.********************

727. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggattctgacagtgattcggactcc	Protospacer
.********.********************.

728. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*****************.***********.

729. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattccgactctgacagtgattcggactcc	Protospacer
.***** ***********************.

730. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattccgactctgacagtgattcggactcc	Protospacer
.***** ***********************.

731. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*****************.***********.

732. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*****************.***********.

733. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*****************.***********.

734. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
.*****************.********.***

735. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgattccgactct	Protospacer
.*****************.***** ******

736. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggattctgacagcgattcggactct	Protospacer
.********.********.************

737. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattccgactccgacagtgattcggactct	Protospacer
.***** *****.******************

738. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgactcggactctgacagtgattccgactct	Protospacer
.**.******************** ******

739. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgactcggactctgacagtgattccgactct	Protospacer
.**.******************** ******

740. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggattctgacagtgattcggattct	Protospacer
.********.*****************.***

741. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagtgactctgactct	Protospacer
.********************.** ******

742. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattccgactctgacagcgattcggactct	Protospacer
.***** ***********.************

743. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgactcggactct	Protospacer
.*****************.**.*********

744. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgactcggactctgacagtgactcggactct	Protospacer
.**.*****************.*********

745. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgactcggactct	Protospacer
.*****************.**.*********

746. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactcggacagcgattcggactct	Protospacer
.*********** *****.************

747. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
.*****************.********.***

748. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagtgattcggactcc	Protospacer
.***********.*****************.

749. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgactcggactctgacagcgattcggactcc	Protospacer
***.**************.***********.

750. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggattccgacagtgattcggactcg	Protospacer
*********.**.*****************

751. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggactctgacagcgattcggattcc	Protospacer
******************.********.**.

752. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
****** ***********.***********.

753. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggattctgacagcgattcggactcg	Protospacer
*********.********.***********

754. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattccgactctgacagcgattcggactcc	Protospacer
****** ***********.***********.

755. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgactccgactcc	Protospacer
.*****.**************.*********

756. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgactccgactcg	Protospacer
******.**************.********

757. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggattctgacagcgattccgactcc	Protospacer
.*****.**.*********************

758. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattccgactct	Protospacer
.*****.***********************.

759. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*****.***************** ******

760. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactcggacagcgattccgactct	Protospacer
******.***** *****************.

761. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*****.***************** ******

762. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*****.***************** ******

763. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.*****.***************** ******

764. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagcgattcggactct	Protospacer
******.***************** *****.

765. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattccgattcc	Protospacer
.*****.********************.***

766. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcggactctgacagtgattccgactct	Protospacer
******.***********.***********.

767. spacer 2.53|950511|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattcagactcagacagcgattcagactca	Protospacer
************ *********** *****

768. spacer 2.6|947385|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

cgactcagactccgacagcgactctgactccgacagcgactccgattcg	CRISPR spacer
tgactcggactccgacagcgactcggactccgacagcgactccgattct	Protospacer
.*****.***************** ***********************

769. spacer 2.10|947631|37|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.892

cgacagtgattcggatgctgacagcgactctgactcc	CRISPR spacer
tgacagcgattcggattctgacagcgactctgactcg	Protospacer
.*****.********* *******************

770. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggacgctgacagcgattcggattct	CRISPR spacer
tgactcggactctgacagcgattcggactcc	Protospacer
.********* ****************.**.

771. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggacgctgacagcgattcggattct	CRISPR spacer
tgattcggactctgacagcgattcggattcc	Protospacer
.**.****** *******************.

772. spacer 2.15|947997|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggacgctgacagcgattcggattct	CRISPR spacer
tgactcggattctgacagcgattcggattcc	Protospacer
.********. *******************.

773. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggatagc	Protospacer
********** *****************  .

774. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggacgctgacagcgattcggattct	CRISPR spacer
tgactcggactccgacagcgattcggattcg	Protospacer
.********* *.*****************

775. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgactcggactcc	Protospacer
.********.*****************.**.

776. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
.*****************.***** *****

777. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgactccgactcc	Protospacer
.*********************** **.**.

778. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgactccgattcc	Protospacer
.********.************** *****.

779. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
.*****************.***** *****

780. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagtgactcggattcc	Protospacer
.**.**************.***********.

781. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattctgactctgacagcgactccgattcg	Protospacer
.***** ***************** *****

782. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattcggacagcgactcggattcg	Protospacer
.********.** *****************

783. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattcg	Protospacer
.***** *****.*****************

784. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
.***** *****.*****************.

785. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
.***** *****.*****************.

786. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattcggacagcgactcggattcc	Protospacer
.********.** *****************.

787. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
.**.*****.********************

788. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
.**.*****.********************

789. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgattcggattcc	Protospacer
.***********.********.********.

790. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattccgactccgacagcgactcggattcc	Protospacer
.***** *****.*****************.

791. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.********************.*****.**.

792. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagtgactcggattcc	Protospacer
.**.**************.***********.

793. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagtgactctgattcg	Protospacer
.*****************.***** *****

794. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggattctgacagcgactcggattcg	Protospacer
.**.*****.********************

795. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattccgactctgacagcgattcggattcg	Protospacer
.***** **************.********

796. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattcggacagcgactcggattcc	Protospacer
.********.** *****************.

797. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgattcggattcg	Protospacer
.**.*****************.********

798. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagtgactccgattcg	Protospacer
.*****************.***** *****

799. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattccgactctgacagcgactcggactcc	Protospacer
.***** ********************.**.

800. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.********************.*****.**.

801. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.********************.*****.**.

802. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgattcggactcc	Protospacer
.********************.*****.**.

803. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactccgattcc	Protospacer
.**.******************** *****.

804. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactcggactcc	Protospacer
.**.***********************.**.

805. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattccgactctgacagcgactccgattcc	Protospacer
.***** ***************** *****.

806. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgattccgactctgacagcgattcggatagt	Protospacer
****** **************.******  *

807. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactctgacagcgattccgattcc	Protospacer
.********************.** *****.

808. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcagactctgacagcgactctgattca	Protospacer
.*****.***************** *****

809. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcagactctgacagcgactctgattca	Protospacer
.*****.***************** *****

810. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcagactctgacagcgactctgattca	Protospacer
.*****.***************** *****

811. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcagactctgacagcgactctgattca	Protospacer
.*****.***************** *****

812. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcagactctgacagcgactctgattca	Protospacer
.*****.***************** *****

813. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggatgctgacagcgactccgactcc	Protospacer
************************ **. *.

814. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactccgattcg	Protospacer
********** ************* *** *

815. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
*********. ****************. **

816. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgattcggatgctgacagcgactctgactct	Protospacer
***.******************** **. **

817. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggactct	Protospacer
********** *.**************. **

818. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactcggactcc	Protospacer
********** ****************. *.

819. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgattcggattctgacagcgactcggattcg	Protospacer
***.****** ***************** *

820. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggactctgacagcgactcggattcg	Protospacer
*********. ***************** *

821. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
********** * *************** *

822. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
********** * *************** *

823. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
********** *.*************** *.

824. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
********** *.*************** *.

825. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
********** *.*************** *.

826. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
********** *.*************** *.

827. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggattcc	Protospacer
********** *.*************** *.

828. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattcggacagcgactcggattcg	Protospacer
********** * *************** *

829. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
*********. ****************. **

830. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
*********. ****************. **

831. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgattcggattctgacagcgactcggactct	Protospacer
***.****** ****************. **

832. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattcggacagcgactcggactct	Protospacer
********** * **************. **

833. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
********** **********.*****. **

834. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
********** **********.*****. **

835. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggactct	Protospacer
********** *.**************. **

836. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
********** **********.*****. **

837. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
********** **********.*****. **

838. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
********** **********.*****. **

839. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
*********. ****************. **

840. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
*********. ****************. **

841. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgattcggattctgacagcgactcggactct	Protospacer
***.****** ****************. **

842. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactctgactct	Protospacer
********** ************* **. **

843. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
.*********************** **.**.

844. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgactccgattct	Protospacer
.********************.*****.**.

845. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgattca	Protospacer
.*****************.********.**

846. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattccgactctgacagcgattccgattct	Protospacer
.***** ********************.**.

847. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggattctgacagcgattcggactct	Protospacer
.********.************** *****.

848. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgactcggactctgacagtgattccgactct	Protospacer
.**.**************.***********.

849. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgactcggactctgacagtgattccgactct	Protospacer
.**.**************.***********.

850. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattccgactctgacagcgattcggactct	Protospacer
.***** ***************** *****.

851. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgactcggactct	Protospacer
.********************.** *****.

852. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgactcggactct	Protospacer
.********************.** *****.

853. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactcggacagcgattcggactct	Protospacer
.*********** *********** *****.

854. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggattct	Protospacer
.*********************** **.**.

855. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattccgattctgacagcgattccgactct	Protospacer
.***** **.********************.

856. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgactcggactccgacagcgattccgactct	Protospacer
.**.********.*****************.

857. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggattctgacagcgactccgactcg	Protospacer
.********.***********.********

858. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggattcggacagcgattccgacagc	Protospacer
*********.** ***************  *

859. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattcggacagcgactcg	Protospacer
.**.*****************.**

860. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactcggattctgacagcgattcg	Protospacer
.***** ***** ***********

861. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgactctgacagcgattcg	Protospacer
.********.** ***********

862. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattcggacagcgactcg	Protospacer
.**.*****************.**

863. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattcggacagcgactcg	Protospacer
.**.*****************.**

864. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattcggacagcgactcg	Protospacer
.**.*****************.**

865. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattcggacagcgactcg	Protospacer
.**.*****************.**

866. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgactccgacagcgattca	Protospacer
.********.** ***********

867. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactcggattcggacagtgattcg	Protospacer
.***** ***********.*****

868. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattcggacagtgactcg	Protospacer
.*****************.**.**

869. spacer 2.22|948411|25|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattccgacagcgattcg	Protospacer
.**.******** ***********

870. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactcggattctgacagcgattct	Protospacer
.***** ***** ***********.

871. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattccgacagcgattcg	Protospacer
.**.******** ***********

872. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgactccgacagcgattcg	Protospacer
.********.** ***********

873. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactcggattcggacagtgattcg	Protospacer
.***** ***********.*****

874. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattccgacagtgattcg	Protospacer
.*********** *****.*****

875. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactcggattctgacagcgattcg	Protospacer
.***** ***** ***********

876. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattcagacagcgattct	Protospacer
.**.********.***********.

877. spacer 2.22|948411|25|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgactccgattctgacagtgattcg	Protospacer
.*********** *****.*****

878. spacer 2.22|948411|25|NZ_CP054303|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.84

cgactccgattcggacagcgattcc	CRISPR spacer
tgattccgattcagacagcgattct	Protospacer
.**.********.***********.

879. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggactccgacagcgattcggactcc	Protospacer
.********************.*****.**.

880. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggactccgacagtgactcggactcc	Protospacer
.*****************.********.**.

881. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactcggactccgacagtgactcggactcc	Protospacer
.*****************.********.**.

882. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.***** **************.********.

883. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.***** **************.********.

884. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactct	Protospacer
.**.** ***********************.

885. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***** **.********************.

886. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***** **.********************.

887. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***** **.********************.

888. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggattctgacagcgattcggactcg	Protospacer
.***** **.********************

889. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***** **.********************.

890. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***** **.********************.

891. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattccgactctgacagcgattcggattcg	Protospacer
.**.***********************.**

892. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgattcggattcg	Protospacer
.***** ********************.**

893. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.***** **************.********.

894. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgactccgactctgacagcgactcggatagc	Protospacer
*********************.*****.  *

895. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.***** **************.********.

896. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactccgattccgacagcgattcggactct	Protospacer
.********.**.*****************.

897. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgacagtgactctgacagcgattcggactcc	Protospacer
.***  .************************

898. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
.***** ********************.**.

899. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.***** **************.********.

900. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactctgactcggacagcgattcggactct	Protospacer
.*****.***** *****************.

901. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgattcggattct	Protospacer
.***** ********************.**.

902. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactccgactcggacagcgactcggactct	Protospacer
.*********** ********.********.

903. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactctgactcggacagcgattcggactct	Protospacer
.*****.***** *****************.

904. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactctgactctgacagcgattcggattct	Protospacer
.*****.********************.**.

905. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactccgactctgacagcgactcggattct	Protospacer
.********************.*****.**.

906. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactccgactcggacagcgattctgactct	Protospacer
.*********** *********** *****.

907. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactccgactccgacagcgactcggactct	Protospacer
.***********.********.********.

908. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgattcggactctgacagcgactcggattctgacagcgattcggactcg	Protospacer
.*****************************.********.********

909. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgattcggactctgacagcgactcggactctgacagcgactcggactcc	Protospacer
.**************************.**.*****************.

910. spacer 2.38|949539|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.918

tgattccgactctgacagcgattcggactccgacagtgactcggatgct	CRISPR spacer
tgattccgactctgacagcgattcggactccgacagtgattcggactcc	Protospacer
***************************************.*****. *.

911. spacer 2.38|949539|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.918

tgattccgactctgacagcgattcggactccgacagtgactcggatgct	CRISPR spacer
tgattccgactctgacagcgactcggactccgacagtgattcggattcg	Protospacer
*********************.*****************.****** *

912. spacer 2.38|949539|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

tgattccgactctgacagcgattcggactccgacagtgactcggatgct	CRISPR spacer
tgattccgactctgacagcgactcggactctgacagtgactcggattcc	Protospacer
*********************.********.*************** *.

913. spacer 2.40|949689|43|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggattccgacagcgattccgactccgacagcgactcggattcg	Protospacer
 **************.******** *****************

914. spacer 2.40|949689|43|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggattctgacagcgactccgactccgacagcgactcggattct	Protospacer
 *****.***************** *****************.

915. spacer 2.40|949689|43|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggattccgacagtgactccgattcggacagcgactcggattcg	Protospacer
 ***********.********.********************

916. spacer 2.40|949689|43|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggattccgacagcgattccgactccgacagcgactcggattct	Protospacer
 **************.******** *****************.

917. spacer 2.40|949689|43|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.907

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggattcggacagcgactccgactccgacagcgactcggattct	Protospacer
 ***** ***************** *****************.

918. spacer 2.40|949689|43|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.907

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggattccgacagcgactctgactcggacagcgattcggattct	Protospacer
 *****************.**************.********.

919. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgactccgattctgacagtgactcggattcg	Protospacer
.**.*****.********************

920. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggactct	Protospacer
.*****************.********.**.

921. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgactcggactct	Protospacer
.*****************.********.**.

922. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattcggactctgacagcgactcggattct	Protospacer
.***** ***********.***********.

923. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgattcggattct	Protospacer
.*****************.**.********.

924. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactccgacagcgactcggactct	Protospacer
.***** *****.*****************.

925. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgactcggattcg	Protospacer
.***********.**************.**

926. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.** ***********************.

927. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.** ***********************.

928. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggattctgacagcgactcggactct	Protospacer
.***** **.********************.

929. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.***** ********************.**.

930. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggattcg	Protospacer
.***** ********************.**

931. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgattcggactct	Protospacer
.***** **************.********.

932. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.***** ********************.**.

933. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.***** ********************.**.

934. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.***** ********************.**.

935. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactctgacagcgactcggattct	Protospacer
.***** ********************.**.

936. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactctgacagcgattcggattcg	Protospacer
.********************.*****.**

937. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.** ***********************.

938. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgactccgactctgacagcgactcggatagc	Protospacer
***.***********************.  *

939. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgactcggattct	Protospacer
.***********.**************.**.

940. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.** ***********************.

941. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggattctgacagcgactcggactct	Protospacer
.***** **.********************.

942. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactcggactctgacagcgactcggactct	Protospacer
.**.** ***********************.

943. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattcggactccgacagcgactcggactct	Protospacer
.***** *****.*****************.

944. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactccgactcggacagcgactcggactct	Protospacer
.**.******** *****************.

945. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactccgactctgacagcgactcggattct	Protospacer
.**.***********************.**.

946. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgactccgactccgacagcgactcggactct	Protospacer
.**.********.*****************.

947. spacer 2.45|950025|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

cgattcggactccgacagcgactcggattctgacagc-gactctgactcc	CRISPR spacer
cgattcggactccgacagcgactcggactctgacagtggattctgactc-	Protospacer
***************************.********. **.********

948. spacer 2.45|950025|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.918

cgattcggactccgacagcgactcggattctgacagcgactctgactcc	CRISPR spacer
ggactcggactctgacagcgactcggattctgacagcgactctgactcg	Protospacer
 **.********.***********************************

949. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactcggactctgacagcgattcggactcc	Protospacer
.***** ********************.**.

950. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgattcggactctgacagcgattcggattcc	Protospacer
.**.** ***********************.

951. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactcggattctgacagcgattcggattcc	Protospacer
.***** **.********************.

952. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggactctgacagcgattcggatagc	Protospacer
****** *********************  .

953. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactctgactctgacagcgactcggactcc	Protospacer
.********************.*****.**.

954. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactcggactccgacagcgattcggattcg	Protospacer
.***** *****.*****************

955. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactccgattcggacagcgactcggattcc	Protospacer
.***** ***** *****************

956. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactccgattcggacagcgactcggattct	Protospacer
.***** ***** *****************

957. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggactccgacagcgactcggactcc	Protospacer
.********.*****************.**

958. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactccgattcggacagcgactcggattcc	Protospacer
.***** ***** *****************

959. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggactccgacagcgactcggactcc	Protospacer
.********.*****************.**

960. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggattccgacagcgattccgattct	Protospacer
.********************.** *****

961. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactccgattcggacagcgactcggattct	Protospacer
.***** ***** *****************

962. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
ggactcggactctgacagcgactcggattct	Protospacer
 ********.**.*****************

963. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggattctgacagcgactcggatgct	Protospacer
.***********.*************** *

964. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggactccgacagcgactcggactcc	Protospacer
.********.*****************.**

965. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactcggattctgacagcgattcggattcc	Protospacer
.***********.********.********

966. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactctgactccgacagcgactcggatgct	Protospacer
****** **.****************** *

967. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggactccgacagcgattccgactct	Protospacer
.********.**************.*****

968. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgactcggactct	Protospacer
.********************.** *****

969. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattcggactcc	Protospacer
.*********** *********** *****

970. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattcggactcc	Protospacer
.*********** *********** *****

971. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattccgactcc	Protospacer
.*********** ***********.*****

972. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgattcggattct	Protospacer
.*********************** **.**

973. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattcggactct	Protospacer
.*********** *********** *****

974. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattcggactct	Protospacer
.*********** *********** *****

975. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattccgactcc	Protospacer
.*********** ***********.*****

976. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattccgactcc	Protospacer
.*********** ***********.*****

977. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***********.*********** *****

978. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
.********************.** *****

979. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***********.*********** *****

980. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
.********************.** *****

981. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgactcggactct	Protospacer
.********************.** *****

982. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***********.*********** *****

983. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
.********************.** *****

984. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattcggacagcgattccgactct	Protospacer
.*********** ***********.*****

985. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***********.*********** *****

986. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgattcggactct	Protospacer
.***********.*********** *****

987. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactccgattccgacagcgattcggactct	Protospacer
.***** ***************** *****

988. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgactctgactct	Protospacer
.***********.********.********

989. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgattcggattctgacagtgattccgactcg	CRISPR spacer
tgattcggattctgacagcgattcggactct	Protospacer
.*****************.***** *****

990. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgattcggattctgacagtgattccgactcg	CRISPR spacer
tgactcggattctgacagcgattccgactcc	Protospacer
.**.**************.***********

991. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagcgactcggactcc	Protospacer
.*****************.**.********.

992. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagcgattcggactcc	Protospacer
.***********.*****.***********.

993. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagcgattcggactcc	Protospacer
.***********.*****.***********.

994. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggattctgacagtgactcggactcc	Protospacer
.********.***********.********.

995. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactctgacagtgattccgattca	Protospacer
.*********************** **.**

996. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggattctgacagtgactcggactcc	Protospacer
.********.***********.********.

997. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgactcggattctgacagtgattcggactcc	Protospacer
.**.*****.********************.

998. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagcgattcggactcc	Protospacer
.***********.*****.***********.

999. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagcgattcggactcc	Protospacer
.***********.*****.***********.

1000. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgactcggactccgacagtgattcggactcg	Protospacer
.**.********.*****************

1001. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagtgattcggattcg	Protospacer
.***********.**************.**

1002. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggatgctgacagtgattcggactcg	Protospacer
.********. *******************

1003. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgactcggattctgacagtgattcggactcg	Protospacer
.**.*****.********************

1004. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggattctgacagtgactcggactcg	Protospacer
.********.***********.********

1005. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggattctgacagcgattcggactcc	Protospacer
.********.********.***********.

1006. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgactcggactctgacagtgactcggactcc	Protospacer
.**.*****************.********.

1007. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagtgattcggattcg	Protospacer
.***********.**************.**

1008. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattcggactcggacagcgattcggatgct	Protospacer
************ *****.********. **

1009. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagcgattcggactct	Protospacer
.*****.***************** *****.

1010. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattccgactctgacagcgattccgattct	Protospacer
.***** ********************.**.

1011. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*****.***********.***********.

1012. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*****.***********.***********.

1013. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*****.***********.***********.

1014. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattcggactctgacagtgattccgactct	Protospacer
.*****.***********.***********.

1015. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattccgactctgacagcgattcggactct	Protospacer
.***** ***************** *****.

1016. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgattccgattctgacagcgattccgactct	Protospacer
.***** **.********************.

1017. spacer 2.6|947385|49|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.898

cgactcagactccgacagcgactctgactccgacagcgactccgattcg	CRISPR spacer
ggatgcagactccgacagcgactctgactcggacagcgactccgactcg	Protospacer
 **. ************************* **************.***

1018. spacer 2.9|947571|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.865

tgattcggactccgacagcgacagtgattcggatgct	CRISPR spacer
cgactctgactccgacagcgacagtgattcggactct	Protospacer
.**.** **************************. **

1019. spacer 2.10|947631|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.865

cgacagtgattcggatgctgacagcgactctgactcc	CRISPR spacer
cgacagcgattcggattctgacagcgactctgacagt	Protospacer
******.********* *****************  .

1020. spacer 2.10|947631|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.865

cgacagtgattcggatgctgacagcgactctgactcc	CRISPR spacer
cgacagtgattccgattctgacagcgactctgacagt	Protospacer
************ *** *****************  .

1021. spacer 2.10|947631|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.865

cgacagtgattcggatgctgacagcgactctgactcc	CRISPR spacer
cgacagtgattccgattctgacagcgactctgacagt	Protospacer
************ *** *****************  .

1022. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
*********. *****************  .

1023. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggacgctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
*********. *****************  .

1024. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.865

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattcggattcggacagcgactccgactccgactcg	Protospacer
****** *****************.*********

1025. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgactccgactctgacagcgactcggatagc	Protospacer
***.** *********************  .

1026. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgattcggattctgacagcgactcggactcc	Protospacer
***.****** ****************. *.

1027. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactctgactcg	Protospacer
********** ************* **. *

1028. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
tgactcggattccgacagcgactcggattcc	Protospacer
.********* *.*************** *.

1029. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgattcggatgctgacagcgattcggactcc	Protospacer
***.*****************.*****. *.

1030. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
tgactcggattctgacagcgattcggattcc	Protospacer
.********* **********.****** *.

1031. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
********** **********.******. .

1032. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
********** **********.******. .

1033. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgactccgactcc	Protospacer
********** ************* **. *.

1034. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
********** *.**************. *.

1035. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattcggacagcgactcggactcc	Protospacer
********** * **************. *.

1036. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
********** *.**************. *.

1037. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattccgacagcgactcggactcc	Protospacer
********** *.**************. *.

1038. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggattctgacagcgattcggactcg	Protospacer
********** **********.*****. *

1039. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
cgactcggactctgacagcgactcggactcc	Protospacer
*********. ****************. *.

1040. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
tgactcggattctgacagcgattcggactct	Protospacer
.********* **********.*****. **

1041. spacer 2.19|948243|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
tgactcggattccgacagcgactcggactct	Protospacer
.********* *.**************. **

1042. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.865

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgactcggacagcgactctgactccgattcg	Protospacer
.********************************.

1043. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattcggactcggacagcgattcggatgct	Protospacer
************ *********** **. *.

1044. spacer 2.21|948357|31|NZ_CP054303|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.839

tgattcggactctgacagcgattc--cgactcc	CRISPR spacer
cgattcggactccgacagcgattcgtcgacg--	Protospacer
.***********.***********  ****

1045. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgattcggatagc	Protospacer
************.********.******  .

1046. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactccgacagt	Protospacer
************.*********** **.  *

1047. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggactccgacagcgactcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   **************.*********

1048. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggactccgacagcgactcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   **************.*********

1049. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggactccgacagcgactcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   **************.*********

1050. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgatgcggactccgacagcgattccgattct	Protospacer
.**. ****************.** ******

1051. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgactccgactctgacagcgattcggactcc	CRISPR spacer
tgattccgactctgacagcgattcggatagt	Protospacer
***.***********************.  .

1052. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggactctgacagcgattcggatagc	Protospacer
.***** ********************.  *

1053. spacer 2.38|949539|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.898

tgattccgactctgacagcgattcggactccgacagtgactcggatgct	CRISPR spacer
cgattcggactctgacagcgattcggactccgacagtgactctgactct	Protospacer
.***** *********************************** **. **

1054. spacer 2.39|949611|55|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.909

cgattcggactctgacagtgactcggattcggacagcgactccgactccgactct	CRISPR spacer
cgattcggactctgacagcgactcggattcggacagcgattccgactccgacagc	Protospacer
******************.********************.************  .

1055. spacer 2.40|949689|43|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.884

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggattcggacagcgactctgactcggacagcgactcggatgct	Protospacer
 ***** ***********.********************* *.

1056. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgactccgactctgacagcgactcggatagc	Protospacer
.**.**************.*********  *

1057. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgactctgacagcgattcggatagt	Protospacer
*********************.*****.  .

1058. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgattctgacagcgactctgacagt	Protospacer
*********.************** ***  .

1059. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgattccgattctgacagcgactctgacagt	Protospacer
*********.************** ***  .

1060. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
****** **.******************  .

1061. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
****** **.******************  .

1062. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgattccgactctgacagcgattcggatagt	Protospacer
.**.**.*********************  *

1063. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactctgactctgacagcgattcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***  .*****.******************

1064. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactctgactctgacagcgattcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***  .*****.******************

1065. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactctgactctgacagcgattcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***  .*****.******************

1066. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
************.********.******

1067. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

cgactcggattccgacagcgactcggattcg	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
************.********.******

1068. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgactccgattcggacagcgactcggatgct	Protospacer
.***** ***** *************** *

1069. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgattccgactctgacagcgattcggatagt	Protospacer
****** ***********.********.  *

1070. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgacagtgactctgacagcgattcggactct	Protospacer
***.   ***********.************

1071. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgacagcgactctgacagtgattccgactct	Protospacer
***.   ***************** ******

1072. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

tgattcggactctgacagtgattcggactct	CRISPR spacer
tgacagcgactctgacagtgattccgactct	Protospacer
***.   ***************** ******

1073. spacer 2.52|950457|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagcgattcggatgct	Protospacer
.***********.*****.********. **

1074. spacer 2.4|947265|55|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.891

tgattcggattcggacagcgattccgactccgacagtgactccgactctgattcc	CRISPR spacer
cgactcggattcggacagcgattccgactccgacagtgactccgattctgacagc	Protospacer
.**.*****************************************.*****.  *

1075. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgactcggacgctgacagcgattcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   *** *.******************

1076. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgactcggacgctgacagcgattcggattct	CRISPR spacer
tgacagtgactctgacagcgattcggactct	Protospacer
.***   *** ****************.***

1077. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgactcggacgctgacagcgattcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   *** *.******************

1078. spacer 2.15|947997|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgactcggacgctgacagcgattcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   *** *.******************

1079. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggattctgacagcgactctgacagt	Protospacer
.********.************** **.  *

1080. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgacagcgactctgacagtgactccgattct	Protospacer
***.   ***********.***** ******

1081. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgattcggatagc	Protospacer
.**.*****************.******  .

1082. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgactcggactctgacagcgactccgacagt	Protospacer
.**.******************** **.  *

1083. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgacagtgactctgacagcgattcggactct	Protospacer
***.   **************.*****.***

1084. spacer 2.18|948189|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgactcggattct	CRISPR spacer
tgacagcgactctgacagtgactccgattct	Protospacer
***.   ***********.***** ******

1085. spacer 2.19|948243|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgactcggatgctgacagcgactcggatgct	CRISPR spacer
tgattcggatgctgacagcgactctgactcc	Protospacer
.**.******************** **. *.

1086. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.838

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
ggatgcagactccgacagcgactctgactcggacagc	Protospacer
 **. * ***** ***************** ******

1087. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgactcggactctgacagcgactccgacagt	Protospacer
.**.*****************.******  .

1088. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattcggatagt	Protospacer
****** ***************** **.  .

1089. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgactcggactctgacagcgattcggatagc	Protospacer
.**.******************** **.  *

1090. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgacagtgactctgacagcgattcggactcc	Protospacer
.**.   ***************** ******

1091. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgacagtgactctgacagcgattcggactct	Protospacer
***.   ***************** *****.

1092. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgacagcgactctgacagtgattccgactct	Protospacer
***.   ***********.***********.

1093. spacer 2.21|948357|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgattccgactcc	CRISPR spacer
tgacagcgactctgacagtgattccgactct	Protospacer
***.   ***********.***********.

1094. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgattcggactccgacagcgattcggatgct	Protospacer
.***********.*********** **. *.

1095. spacer 2.23|948459|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactccgactctgacagcgactcggatagc	Protospacer
.***** *****.***************  .

1096. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.806

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgatgcagattccgacagcgactccgattct	Protospacer
.**. *.**.************** ******

1097. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgatgcagattccgacagcgactccgattct	Protospacer
.**. *.**.************** ******

1098. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
.***** **.*****************.  *

1099. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
.***** **.*****************.  *

1100. spacer 2.40|949689|43|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.86

cgattccgacagcgactccgactcggacagcgactcggattcc	CRISPR spacer
ggatagtgacagcgattccgactccgacagcgactcggattcc	Protospacer
 ***  .********.******** ******************

1101. spacer 2.41|949755|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgattccgactctgacagcgattcggatagt	Protospacer
.*****************.**.******  .

1102. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgacagcgactctgacagtgactccgattct	Protospacer
.**.  ****************** *****.

1103. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgactccgactccgacagtgactcggacagc	Protospacer
.**.********.**************.  *

1104. spacer 2.41|949755|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.806

cgattccgactctgacagtgactcggattcc	CRISPR spacer
tgacagcgactctgacagtgactccgattct	Protospacer
.**.  ****************** *****.

1105. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgacagtgactctgacagcgattcggactcc	Protospacer
.**.  .**************.*********

1106. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattccgactctgacagcgactcggactcc	CRISPR spacer
tgacagtgactctgacagcgattcggactct	Protospacer
***.  .**************.********.

1107. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactctgattcggacagcgattcggatagc	Protospacer
.********.** ***************  .

1108. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgactccgactctgacagcgactcggatagc	Protospacer
.*****.**************.******  .

1109. spacer 2.46|950097|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgactctgactctgacagcgattcggattct	CRISPR spacer
tgatgcggactccgacagcgattccgattct	Protospacer
.**. * *****.*********** ******

1110. spacer 2.46|950097|31|NZ_CP054303|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactcagacagcgatagcgactca	Protospacer
************ *********   **.**

1111. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgatgcagattccgacagcgactccgattct	Protospacer
.**. *.***************** *****

1112. spacer 2.48|950241|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.806

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgatgcagattccgacagcgactccgattct	Protospacer
.**. *.***************** *****

1113. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

tgactcggattccgacagcgattctgactcg	CRISPR spacer
ggatgcagactccgacagcgactctgactcg	Protospacer
 **. *.**.***********.*********

1114. spacer 2.50|950349|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

cgattcggactctgatagtgactccgattcg	CRISPR spacer
ggactcggactctgacagtgactccgatctt	Protospacer
 **.***********.************..

1115. spacer 2.51|950403|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgattcggattctgacagtgattccgactcg	CRISPR spacer
tgattcggattcggacagcgattccgacagc	Protospacer
.*********** *****.*********

1116. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgattccgactctgacagcgattcggatagt	Protospacer
****** ***************** **.  .

1117. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgacagtgactctgacagcgattcggactcc	Protospacer
.**.   ***************** ******

1118. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgacagtgactctgacagcgattcggactct	Protospacer
***.   ***************** *****.

1119. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgacagcgactctgacagtgattccgactct	Protospacer
***.   ***********.***********.

1120. spacer 2.53|950511|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

tgattcagactctgacagcgattccgactcc	CRISPR spacer
tgacagcgactctgacagtgattccgactct	Protospacer
***.   ***********.***********.

1121. spacer 2.53|950511|31|NZ_CP054303|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.806

tgattcagactctgacagcgattc--cgactcc	CRISPR spacer
cgattcggactccgacagcgattcgtcgacg--	Protospacer
.*****.*****.***********  ****

1122. spacer 2.13|947847|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.857

tgattcggattcggacagcgactccgactctgacagcgattcggactct	CRISPR spacer
cgattcggattcggacagcgactcggattctgacagcgattcggatagc	Protospacer
.*********************** **.*****************.  .

1123. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.811

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
cgactccgactcggacagcgactctgactccgattcg	Protospacer
.**.*****.***********************.

1124. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.811

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattctgacagcgactctgacagtgattcc	Protospacer
************ ***************  .**.  *

1125. spacer 2.16|948051|37|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.811

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
tgattccgattctgacagcgactctgacagtgattcc	Protospacer
************ ***************  .**.  *

1126. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgattcggactctgacagcgactcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 **.   *****.********.*********

1127. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgattcggactctgacagcgactcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 **.   *****.********.*********

1128. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgattcggactctgacagcgactcggattct	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 **.   *****.********.*********

1129. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.811

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgactctgactcggacagcgactcggactccgattcg	Protospacer
.*****.***************** ********.

1130. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.811

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgacagtgactcggacagcgactccgactctgacagt	Protospacer
.***  .*****************.*****.*****.

1131. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

cgactcggactccgacagcgactcggattct	CRISPR spacer
tgactccgactccgacagtgactcggacagc	Protospacer
.***** ***********.********.  .

1132. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

cgactcggactccgacagcgactcggattct	CRISPR spacer
ggacagcgactccgactccgactcggattcg	Protospacer
 ***   *********  ************

1133. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

cgactcggactccgacagcgactcggattct	CRISPR spacer
ggatgcagactccgacagcgactctgactcg	Protospacer
 **. *.***************** **.**

1134. spacer 2.23|948459|31|NZ_CP054303|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.774

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgattcgtcgacg	Protospacer
***.*****************.***    *

1135. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattccgactccgacagcgattcggatagt	Protospacer
.**.********.**************.  .

1136. spacer 2.24|948513|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgattccgactccgacagcgattcggatagt	Protospacer
.**.********.**************.  .

1137. spacer 2.26|948639|31|NZ_CP054303|CRT matches to KP790009 (Gordonia phage Gmala1, complete genome) position: , mismatch: 7, identity: 0.774

cgactcggattctgactccgactctgattcc	CRISPR spacer
tgaagaagattctgactctgactctgattct	Protospacer
.**   .***********.***********.

1138. spacer 2.26|948639|31|NZ_CP054303|CRT matches to KP790008 (Gordonia phage GordTnk2, complete genome) position: , mismatch: 7, identity: 0.774

cgactcggattctgactccgactctgattcc	CRISPR spacer
tgaagaagattctgactctgactctgattct	Protospacer
.**   .***********.***********.

1139. spacer 2.32|949107|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.857

tgattcggactctgacagcgactcggattccgacagcgactcggactct	CRISPR spacer
cgattcggactctgacagcgactcggattctgacagcgattcggatagc	Protospacer
.*****************************.********.*****.  .

1140. spacer 2.38|949539|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.857

tgattccgactctgacagcgattcggactccgacagtgactcggatgct	CRISPR spacer
cgattcggactctgacagcgattcggactccgacagtgacagtgactct	Protospacer
.***** *********************************   **. **

1141. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgattcggatagt	Protospacer
.***********.********.*****.  .

1142. spacer 2.44|949971|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgattccgactccgacagcgattcggatagt	Protospacer
.***********.********.*****.  .

1143. spacer 2.46|950097|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 7, identity: 0.774

cgactctgactctgacagcgattcggattct	CRISPR spacer
cgactctgactccgacagcgattcg------	Protospacer
************.************

1144. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

cgactcggattccgacagcgactcggattcg	CRISPR spacer
tgatgcagattcggacagcgactcggactct	Protospacer
.**. *.***** **************.**

1145. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

cgactcggattccgacagcgactcggattcg	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   **.***********.********

1146. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

cgactcggattccgacagcgactcggattcg	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   **.***********.********

1147. spacer 2.48|950241|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

cgactcggattccgacagcgactcggattcg	CRISPR spacer
agacagcgactccgacagcgattcggattct	Protospacer
 ***   **.***********.********

1148. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
.***********.*********** **.

1149. spacer 2.49|950295|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactcggattctgacagcgattcggatagc	Protospacer
.***********.*********** **.

1150. spacer 2.50|950349|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

cgattcggactctgatagtgactccgattcg	CRISPR spacer
tgacagcgactctgacagtgactccgattct	Protospacer
.**.   ********.**************

1151. spacer 2.50|950349|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 7, identity: 0.774

cgattcggactctgatagtgactccgattcg	CRISPR spacer
tgacagcgactctgacagtgactccgattct	Protospacer
.**.   ********.**************

1152. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

cgattcggattctgacagtgattccgactcg	CRISPR spacer
tgacagcgactctgacagtgattccgactct	Protospacer
.**.   **.********************

1153. spacer 2.51|950403|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

cgattcggattctgacagtgattccgactcg	CRISPR spacer
tgacagcgactctgacagtgattccgactct	Protospacer
.**.   **.********************

1154. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgactcggactctgacagcgattcggatagc	Protospacer
.**.**************.********.  .

1155. spacer 2.52|950457|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgacagtgactctgacagcgattcggactcc	Protospacer
.**.   ***********.***********.

1156. spacer 2.8|947499|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.837

tgattccgatgctgacagcgattcggactccgacagcgactcggattct	CRISPR spacer
tgacagtgactctgacagcgattcggactctgacagcgactcggattcg	Protospacer
***.  .**. *******************.*****************

1157. spacer 2.9|947571|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.784

tgattcggactccgacagcgacagtgattcggatgct	CRISPR spacer
tgacagcgactccgactccgacagtgattcggattcc	Protospacer
***.   *********  **************** *.

1158. spacer 2.11|947691|43|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.814

cgattcggactccgacagcgactctgactccgattccgattcc	CRISPR spacer
tgactcggactccgacagcgactcggactccgacagtgactcc	Protospacer
.**.******************** ********.  .**.***

1159. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.784

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
cgacagtgattcggacagcgactccgactccgactcc	Protospacer
.**.  .*****************.*********  *

1160. spacer 2.16|948051|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.784

tgattccgattcggacagcgactctgactccgacagc	CRISPR spacer
cgattcggattctgacagcgactctgacagtgactcc	Protospacer
.***** ***** ***************  .***  *

1161. spacer 2.18|948189|31|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.742

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgacagtgactctgacagcgattcggactcc	Protospacer
.**.   **************.*****.**.

1162. spacer 2.18|948189|31|NZ_CP054303|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.742

tgattcggactctgacagcgactcggattct	CRISPR spacer
cgattcggactccgacagcgattcgtcgacg	Protospacer
.***********.********.***    *

1163. spacer 2.20|948297|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.784

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
cgacagtgattcggacagcgactccgactccgactcc	Protospacer
.***  .**.**************.*********  *

1164. spacer 2.21|948357|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

tgattcggactctgacagcgattccgactcc	CRISPR spacer
cgacagtgactcggacagcgactccgactct	Protospacer
.**.   ***** ********.********.

1165. spacer 2.23|948459|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 8, identity: 0.742

cgactcggactccgacagcgactcggattct	CRISPR spacer
cgactctgactccgacagcgattcg------	Protospacer
****** **************.***

1166. spacer 2.38|949539|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.837

tgattccgactctgacagcgattcggactccgacagtgactcggatgct	CRISPR spacer
tgacagtgactctgacagcgattcggactctgacagcgactcggattcg	Protospacer
***.  .***********************.*****.********* *

1167. spacer 2.44|949971|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

tgattccgactctgacagcgactcggactcc	CRISPR spacer
cgacagtgactcggacagcgactccgactct	Protospacer
.**.  .***** *********** *****.

1168. spacer 2.49|950295|31|NZ_CP054303|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.742

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgattcggactccgacagcgattcgtcgacg	Protospacer
.**.*****.**************     **

1169. spacer 2.52|950457|31|NZ_CP054303|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.742

tgattcggactctgacagtgattcggactct	CRISPR spacer
cgattcggactccgacagcgattcgtcgacg	Protospacer
.***********.*****.******    *

1170. spacer 2.53|950511|31|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

tgattcagactctgacagcgattccgactcc	CRISPR spacer
cgacagtgactcggacagcgactccgactct	Protospacer
.**.   ***** ********.********.

1171. spacer 2.9|947571|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.757

tgattcggactccgacagcgacagtgattcggatgct	CRISPR spacer
ggacagcgattccgacagcgacagtgactcggattcg	Protospacer
 **.   **.*****************.****** *

1172. spacer 2.9|947571|37|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.757

tgattcggactccgacagcgacagtgattcggatgct	CRISPR spacer
ggacagcgattccgacagcgacagcgattcggattcc	Protospacer
 **.   **.**************.********* *.

1173. spacer 2.11|947691|43|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.791

cgattcggactccgacagcgactctgactccgattccgattcc	CRISPR spacer
cgattctgactctgacagcgactctgactccgacagcgacagt	Protospacer
****** *****.********************.  ***.  .

1174. spacer 2.11|947691|43|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.791

cgattcggactccgacagcgactctgactccgattccgattcc	CRISPR spacer
cgattcggactccgacagcgactcggactctgacagtggattc	Protospacer
************************ *****.**.  .*. *.*

1175. spacer 2.24|948513|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.71

tgactccgactctgacagcgattcggactcc	CRISPR spacer
cgactctgactccgacagcgattcg------	Protospacer
.*****.*****.************

1176. spacer 2.38|949539|49|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.816

tgattccgactctgacagcgattcggactccgacagtgactcggatgct	CRISPR spacer
cgacagtgactctgacagcgattcggactccgacagtgactccgactcc	Protospacer
.**.  .*********************************** **. *.

1177. spacer 2.42|949809|67|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.866

cgactccgactccgacagcgattcggactctgatagtgactccgattcggacagcgactc	CRISPR spacer
cgactctgactcggacagcgattcggactctgatagtgactccgattcggacagcgactc	Protospacer
******.***** ***********************************************

1178. spacer 2.1|947007|55|NZ_CP054303|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.818

cgactcggattcggacagtgattcggactccgacagcgacagtgattcggattct-----	CRISPR spacer
cgactcggattcggacagcgattccgactccgacagc------gattcggatagtgacag	Protospacer
******************.***** ************      *********  *

1179. spacer 2.20|948297|37|NZ_CP054303|CRT matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 10, identity: 0.73

tgactccgactcggacagcgactctgactccgacagc	CRISPR spacer
ttcgggcagctcggacagcgactccgacaccgacacc	Protospacer
*     *..***************.*** ****** *

1180. spacer 2.49|950295|31|NZ_CP054303|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 10, identity: 0.677

tgactcggattccgacagcgattctgactcg	CRISPR spacer
cgactctgactccgacagcgattcg------	Protospacer
.***** **.**************

1181. spacer 2.12|947757|67|NZ_CP054303|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 16, identity: 0.761

tgactcggattctgacagcgattctgactcggacagcgactctgactccgacagcgactc	CRISPR spacer
cgactcggattctgacagcgactctgactcggacagcgactcggactccgattcggacag	Protospacer
.********************.******************** ********.   ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8104 : 80694

Pseudomonas_phage(38.46%)

protease,tail,plate,head,capsid,tRNA,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177358.1\|8104_9457_+\|protease	sigma E protease regulator RseP	NA	NA	NA	NA
WP_004145860.1\|9488_11918_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_004178645.1\|12039_12525_+	molecular chaperone Skp	NA	NA	NA	NA
WP_002889327.1\|12528_13554_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_004145858.1\|13659_14115_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_004178647.1\|14118_14907_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_016946214.1\|14906_16058_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_002889376.1\|16054_16654_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.6e-27	39.6
WP_004177353.1\|16671_20154_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	3.1e-208	36.5
WP_004145855.1\|20166_21126_+	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_002889384.1\|21239_23393_+	lysine decarboxylase LdcC	NA	NA	NA	NA
WP_020801734.1\|23439_23829_+	VOC family protein	NA	NA	NA	NA
WP_004147166.1\|23882_25196_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_002889424.1\|25209_25470_-	Rho-binding antiterminator	NA	NA	NA	NA
WP_002889429.1\|25456_25657_-	YaeP family protein	NA	NA	NA	NA
WP_002889431.1\|25853_26399_+	YaeQ family protein	NA	NA	NA	NA
WP_002889433.1\|26395_26809_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_002889435.1\|26851_27550_+	envelope stress response activation lipoprotein NlpE	NA	NA	NA	NA
WP_042939483.1\|27681_28524_-	YaeF family permuted papain-like enzyme	NA	NA	NA	NA
WP_042939481.1\|28582_30301_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002889441.1\|30413_31121_-\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_002889443.1\|31117_31525_-	Rcs stress response system protein RcsF	NA	NA	NA	NA
WP_002889445.1\|31632_32448_-	methionine ABC transporter substrate-binding lipoprotein MetQ	NA	NA	NA	NA
WP_002889448.1\|32491_33145_-	methionine ABC transporter permease MetI	NA	NA	NA	NA
WP_002889450.1\|33137_34169_-	methionine ABC transporter ATP-binding protein MetN	G9BWD6	Planktothrix_phage	9.4e-36	39.3
WP_002889452.1\|34357_34924_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
WP_002889598.1\|40773_41577_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	8.4e-40	37.0
WP_173819837.1\|42546_43641_-	hypothetical protein	A0A248XD67	Klebsiella_phage	1.8e-178	86.8
WP_173819838.1\|43645_46432_-	hypothetical protein	A0A248XD04	Klebsiella_phage	0.0e+00	88.2
WP_115655926.1\|46424_47048_-\|tail	tail fiber assembly protein	A0A0F7LDQ5	Escherichia_phage	9.1e-34	41.5
WP_104469778.1\|47047_47791_-\|tail	tail fiber protein	A0A0E3GML4	Enterobacteria_phage	1.7e-18	64.2
WP_048756452.1\|47802_48459_-	DUF2313 domain-containing protein	F6MIL7	Haemophilus_phage	4.0e-32	39.3
WP_104469776.1\|48455_49517_-\|plate	baseplate J/gp47 family protein	A0A0M3LQN4	Mannheimia_phage	2.3e-77	48.7
WP_164839906.1\|49516_49873_-	phage GP46 family protein	A0A0M3LQK5	Mannheimia_phage	8.8e-26	55.1
WP_173819839.1\|49938_50520_-\|plate	phage baseplate assembly protein	A0A0M3LPA3	Mannheimia_phage	2.9e-34	51.7
WP_173819840.1\|50503_51742_-\|tail	phage tail protein	A0A2H4J9E6	uncultured_Caudovirales_phage	1.0e-68	35.9
WP_173819841.1\|51725_53039_-	DNA circularization N-terminal domain-containing protein	A0A0M3LQ21	Mannheimia_phage	3.0e-26	22.8
WP_173819842.1\|53038_55216_-\|tail	phage tail tape measure protein	B5TAA4	Burkholderia_phage	1.4e-33	26.7
WP_173820037.1\|55329_55611_-	hypothetical protein	NA	NA	NA	NA
WP_173819843.1\|55724_56099_-\|tail	phage tail protein	A0A0M3LRV6	Mannheimia_phage	3.2e-26	53.4
WP_173819844.1\|56112_57531_-\|tail	phage tail sheath subtilisin-like domain-containing protein	B7SDP8	Haemophilus_phage	4.5e-105	50.1
WP_020804729.1\|57530_57728_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_115660523.1\|57708_58368_-	DUF1834 family protein	NA	NA	NA	NA
WP_020804749.1\|58364_58793_-	DUF1320 domain-containing protein	NA	NA	NA	NA
WP_080864114.1\|58805_59204_-	hypothetical protein	NA	NA	NA	NA
WP_064141751.1\|59204_60113_-\|head	Mu-like prophage major head subunit gpT family protein	A0A2H4J778	uncultured_Caudovirales_phage	2.5e-101	59.6
WP_064141750.1\|60124_60520_-	hypothetical protein	J9RWG0	Pseudomonas_phage	1.2e-23	50.0
WP_064143931.1\|60512_61598_-\|protease	phage protease	A0A2D1GNS3	Pseudomonas_phage	6.8e-53	42.6
WP_023158175.1\|61832_62375_-	phage virion morphogenesis protein	A0A0M3LSP9	Mannheimia_phage	1.0e-09	35.7
WP_173819845.1\|62364_63636_-\|capsid	minor capsid protein	A0A0A7DJT5	Pseudomonas_phage	5.2e-52	36.2
WP_173819846.1\|63628_65197_-	DUF935 domain-containing protein	A0A0M5MS00	Ralstonia_phage	1.8e-126	47.6
WP_173819847.1\|65196_66900_-\|terminase	phage terminase large subunit	H6V8N6	Pseudomonas_phage	3.7e-194	64.3
WP_049593303.1\|66902_67232_-	hypothetical protein	G8GWD9	Rhodobacter_phage	2.6e-32	66.7
WP_020804740.1\|67235_67445_-	hypothetical protein	NA	NA	NA	NA
WP_110226831.1\|67437_67938_-	DUF1804 family protein	A0A0A1IX73	Pseudomonas_phage	1.7e-46	53.6
WP_023158167.1\|67939_68254_-	hypothetical protein	NA	NA	NA	NA
WP_020804737.1\|68250_68496_-	hypothetical protein	NA	NA	NA	NA
WP_173819848.1\|68492_69128_-	hypothetical protein	NA	NA	NA	NA
WP_023158165.1\|69117_69366_-	DUF2644 domain-containing protein	NA	NA	NA	NA
WP_173819849.1\|69347_70001_-	glycoside hydrolase family 19 protein	A0A2D1GNI0	Pseudomonas_phage	2.0e-60	57.1
WP_173819850.1\|70081_70618_-	hypothetical protein	NA	NA	NA	NA
WP_173819851.1\|70583_71018_-	hypothetical protein	A0A2D1GNW5	Pseudomonas_phage	3.4e-27	44.5
WP_173819852.1\|70962_71439_-	regulatory protein GemA	A0A2D1GNN4	Pseudomonas_phage	2.4e-42	61.5
WP_023158160.1\|71498_71714_-	hypothetical protein	A0A2D1GNS9	Pseudomonas_phage	7.4e-20	66.2
WP_074185589.1\|71694_72024_-	DUF977 family protein	NA	NA	NA	NA
WP_032415579.1\|72181_72721_-	hypothetical protein	A0A2D1GNL9	Pseudomonas_phage	1.1e-56	66.9
WP_032415578.1\|72717_72942_-	hypothetical protein	A0A2D1GNI2	Pseudomonas_phage	2.0e-15	52.8
WP_001339197.1\|73223_74432_+\|transposase	IS4-like element ISVsa5 family transposase	Q9E8P4	Bluetongue_virus	3.0e-235	100.0
WP_173819853.1\|74410_74809_-	hypothetical protein	NA	NA	NA	NA
WP_020804721.1\|75049_75238_-	hypothetical protein	A0A2D1GNV5	Pseudomonas_phage	3.5e-05	52.5
WP_173819854.1\|75239_75878_-	DUF3164 family protein	J9SHK0	Pseudomonas_phage	4.4e-68	63.5
WP_023158152.1\|75870_76062_-	hypothetical protein	NA	NA	NA	NA
WP_032415574.1\|76063_76297_-	hypothetical protein	NA	NA	NA	NA
WP_126066056.1\|76316_76532_-	hypothetical protein	NA	NA	NA	NA
WP_173819855.1\|76540_77434_-	AAA family ATPase	A0A2D1GNS0	Pseudomonas_phage	1.2e-100	60.5
WP_173819856.1\|77443_79495_-\|transposase	transposase	A0A2D1GNK9	Pseudomonas_phage	1.3e-174	49.1
WP_173819857.1\|79518_79782_-	helix-turn-helix domain-containing protein	A0A2P9JZG5	Alteromonadaceae_phage	9.4e-25	70.0
WP_173819858.1\|79959_80694_+	helix-turn-helix transcriptional regulator	A5X9F5	Aeromonas_virus	3.6e-29	39.3

DBSCAN-SWA_2

842384 : 851847

Dickeya_phage(16.67%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086627161.1\|842384_843500_+	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
WP_004150848.1\|843496_845437_+	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	1.9e-37	40.5
WP_002896516.1\|845513_845735_-	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
WP_002896520.1\|846060_846378_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
WP_002896522.1\|846408_848688_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
WP_001040187.1\|848807_849026_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_002898014.1\|849379_850081_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_009484119.1\|850125_851847_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.5e-14	34.3

DBSCAN-SWA_3

1118877 : 1199049

Enterobacteria_phage(26.32%)

holin,protease,tail,portal,tRNA,terminase,integrase,transposase

attL 1109162:1109176|attR 1152002:1152016

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1109162:1109176	attL	NA	NA	NA	NA
WP_004150803.1\|1118877_1119984_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_004150802.1\|1120040_1120499_-	NUDIX hydrolase	NA	NA	NA	NA
WP_004150801.1\|1120515_1121166_-	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
WP_004150800.1\|1121406_1122657_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.1e-19	92.6
WP_110228966.1\|1122774_1123902_-\|integrase	phage integrase Arm DNA-binding domain-containing protein	O21925	Phage_21	4.4e-119	58.4
WP_012542206.1\|1123882_1124128_-	excisionase	NA	NA	NA	NA
WP_167875589.1\|1124180_1124471_-	3'-5' exoribonuclease	A0A2I7RDR9	Vibrio_phage	1.3e-22	57.0
WP_014228879.1\|1124685_1125030_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_016160636.1\|1125072_1125267_-	DUF1482 family protein	NA	NA	NA	NA
WP_040234937.1\|1125656_1125971_+	hypothetical protein	NA	NA	NA	NA
WP_032418059.1\|1126291_1126681_-	transcriptional regulator	H6WRX4	Salmonella_phage	1.4e-37	63.4
WP_004147982.1\|1126816_1127038_+	helix-turn-helix domain-containing protein	H6WRX5	Salmonella_phage	1.2e-28	75.3
WP_032418032.1\|1127040_1127595_+	hypothetical protein	NA	NA	NA	NA
WP_072031995.1\|1127639_1128659_+	helix-turn-helix domain-containing protein	A0A0U2RT81	Escherichia_phage	1.3e-32	35.5
WP_032418060.1\|1128651_1129116_+	replication protein	A0A0U2JGJ0	Escherichia_phage	6.9e-63	70.9
WP_032418033.1\|1129129_1129570_+	hypothetical protein	NA	NA	NA	NA
WP_032418061.1\|1130132_1132139_+	ATP-binding protein	NA	NA	NA	NA
WP_001339197.1\|1132607_1133816_-\|transposase	IS4-like element ISVsa5 family transposase	Q9E8P4	Bluetongue_virus	3.0e-235	100.0
WP_173819891.1\|1133888_1134845_+	hypothetical protein	NA	NA	NA	NA
WP_048290151.1\|1135125_1136298_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_048290152.1\|1136722_1136956_+	DinI-like family protein	K7PM44	Enterobacteria_phage	2.4e-24	69.7
WP_165476662.1\|1137018_1137258_+	hypothetical protein	H6WRY6	Salmonella_phage	1.9e-16	58.6
WP_131082165.1\|1137298_1137691_+	DNA-binding protein	K7PHB4	Enterobacterial_phage	8.0e-12	36.6
WP_173819892.1\|1137890_1138949_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	5.7e-105	52.7
WP_131082163.1\|1138969_1139668_+	antitermination protein	NA	NA	NA	NA
WP_169546928.1\|1139874_1140678_+	hypothetical protein	NA	NA	NA	NA
WP_075208973.1\|1140831_1141101_+\|holin	holin	K7P6H9	Enterobacteria_phage	4.2e-36	84.8
WP_131066624.1\|1141072_1141612_+	lysozyme	K7PM52	Enterobacteria_phage	1.2e-74	73.6
WP_131066636.1\|1141644_1142121_+	DUF2514 domain-containing protein	NA	NA	NA	NA
WP_131082162.1\|1142202_1142511_+	hypothetical protein	NA	NA	NA	NA
WP_077273936.1\|1142615_1142930_+	hypothetical protein	Q6UAS0	Klebsiella_phage	7.5e-29	62.8
WP_023342892.1\|1143161_1143650_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	1.3e-72	87.7
WP_016530357.1\|1143649_1145752_+\|terminase	phage terminase large subunit family protein	K7PH52	Enterobacterial_phage	0.0e+00	84.0
WP_023342890.1\|1145748_1145961_+	hypothetical protein	A5LH28	Enterobacteria_phage	2.9e-24	80.0
WP_016530355.1\|1145960_1147463_+\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	6.2e-246	83.0
WP_071887248.1\|1147413_1149435_+\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	0.0e+00	81.8
WP_016530353.1\|1149518_1149845_+	DUF2190 family protein	K7PJY3	Enterobacterial_phage	8.1e-34	66.7
WP_173819893.1\|1149837_1150113_+	DNA breaking-rejoining protein	K7PH43	Enterobacteria_phage	1.1e-23	57.1
WP_016530351.1\|1150116_1150695_+\|tail	phage tail protein	K7PMB7	Enterobacterial_phage	1.7e-79	81.2
WP_016530350.1\|1150691_1151093_+\|tail	minor tail family protein	K7PHM6	Enterobacterial_phage	2.7e-55	75.6
WP_016530349.1\|1151101_1151845_+\|tail	phage tail protein	K7PKX6	Enterobacterial_phage	1.7e-111	83.0
WP_077258542.1\|1151855_1152284_+\|tail	phage minor tail protein G	M9NZD7	Enterobacteria_phage	2.1e-37	60.7
1152002:1152016	attR	NA	NA	NA	NA
WP_071609142.1\|1152304_1152619_+\|tail	phage tail assembly protein T	E4WL32	Enterobacteria_phage	5.0e-41	75.0
WP_134872456.1\|1152602_1155746_+\|tail	phage tail tape measure protein	E4WL33	Enterobacteria_phage	0.0e+00	73.0
WP_023342885.1\|1155750_1156098_+\|tail	phage tail protein	K7PJT2	Enterobacteria_phage	4.7e-40	67.8
WP_131082158.1\|1156094_1156850_+\|tail	phage minor tail protein L	Q6UAW5	Klebsiella_phage	1.4e-129	83.7
WP_023342884.1\|1156851_1157562_+	C40 family peptidase	Q6UAW4	Klebsiella_phage	1.1e-136	90.7
WP_016530340.1\|1157593_1158184_+\|tail	tail assembly protein	K7PHE5	Enterobacteria_phage	2.5e-81	77.0
WP_134872457.1\|1158246_1167180_+	DUF1983 domain-containing protein	Q6UAW1	Klebsiella_phage	0.0e+00	44.7
WP_025368254.1\|1167248_1168745_+\|tail	tail fiber domain-containing protein	A0A0P0IDN1	Klebsiella_phage	6.4e-126	63.7
WP_004892953.1\|1168899_1169052_+	isocitrate dehydrogenase	Q77Z09	Phage_21	3.8e-18	92.0
WP_004213085.1\|1169324_1170038_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004150798.1\|1170034_1170427_-	amino acid-binding protein	NA	NA	NA	NA
WP_004150797.1\|1170419_1170743_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_048263900.1\|1170831_1171038_-	hypothetical protein	NA	NA	NA	NA
WP_004140530.1\|1171191_1171419_-	DUF1272 domain-containing protein	NA	NA	NA	NA
WP_004140529.1\|1171531_1172725_-	glutathione-dependent formaldehyde dehydrogenase	NA	NA	NA	NA
WP_004213087.1\|1172792_1173128_-	hypothetical protein	NA	NA	NA	NA
WP_004150795.1\|1173347_1173533_+	general stress protein	NA	NA	NA	NA
WP_004148027.1\|1173623_1174118_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_004140514.1\|1174144_1174651_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_004179357.1\|1174667_1175555_+	manganese catalase family protein	NA	NA	NA	NA
WP_004140511.1\|1175610_1177017_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_004183659.1\|1177013_1178024_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_004140506.1\|1178139_1178337_-	hypothetical protein	NA	NA	NA	NA
WP_004150791.1\|1178903_1179536_+	DNA-binding protein	NA	NA	NA	NA
WP_032409986.1\|1179575_1179755_+	hypothetical protein	NA	NA	NA	NA
WP_004150790.1\|1180152_1180839_+	EAL domain-containing protein	NA	NA	NA	NA
WP_032415973.1\|1180951_1181116_-	hypothetical protein	NA	NA	NA	NA
WP_004140497.1\|1181149_1182658_-	UbiD family decarboxylase	NA	NA	NA	NA
WP_004150788.1\|1182778_1183669_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019705575.1\|1183675_1185460_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.8e-17	36.1
WP_004140494.1\|1185533_1186742_-	HD domain-containing protein	NA	NA	NA	NA
WP_004150784.1\|1187044_1188088_+	type II asparaginase	NA	NA	NA	NA
WP_004148038.1\|1188749_1189664_+	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	1.1e-72	50.4
WP_004150783.1\|1189753_1190392_+	leucine efflux protein LeuE	NA	NA	NA	NA
WP_004140489.1\|1190522_1190786_+	DUF2534 family protein	NA	NA	NA	NA
WP_004140488.1\|1190845_1190971_-	hypothetical protein	NA	NA	NA	NA
WP_004213093.1\|1191088_1191163_-	protein YoaJ	NA	NA	NA	NA
WP_004150782.1\|1191162_1191264_-	YoaK family small membrane protein	NA	NA	NA	NA
WP_001339197.1\|1191766_1192975_-\|transposase	IS4-like element ISVsa5 family transposase	Q9E8P4	Bluetongue_virus	3.0e-235	100.0
WP_004179368.1\|1193973_1194213_+	DUF333 domain-containing protein	NA	NA	NA	NA
WP_014343000.1\|1194202_1194541_-	DUF488 family protein	NA	NA	NA	NA
WP_004190885.1\|1194545_1195055_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_004140471.1\|1195200_1195893_+	CTP synthase	NA	NA	NA	NA
WP_020324105.1\|1195924_1197100_-	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_004140469.1\|1197207_1198002_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002901080.1\|1197985_1198432_-	DUF441 domain-containing protein	NA	NA	NA	NA
WP_002901088.1\|1198548_1199049_-\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_4

1309484 : 1360113

Enterobacteria_phage(21.57%)

holin,tail,terminase,integrase,transposase

attL 1312164:1312179|attR 1366717:1366732

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004140269.1\|1309484_1310294_-	peptide ABC transporter ATP-binding protein SapF	A0A2H4PQG7	Staphylococcus_phage	2.1e-14	28.9
WP_004140266.1\|1310295_1311288_-	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	3.0e-07	27.2
WP_004151901.1\|1311287_1312178_-	peptide ABC transporter permease SapC	NA	NA	NA	NA
1312164:1312179	attL	NA	NA	NA	NA
WP_032445489.1\|1312324_1313542_+\|integrase	site-specific integrase	K7PGY1	Enterobacteria_phage	2.5e-120	51.6
WP_004892750.1\|1313762_1314002_-	DUF4060 family protein	M9P0E0	Enterobacteria_phage	8.0e-23	70.1
WP_032445491.1\|1314009_1314318_-	hypothetical protein	I6PD68	Cronobacter_phage	7.1e-24	55.9
WP_032445494.1\|1314314_1314926_-	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	4.1e-39	76.3
WP_032445496.1\|1314918_1315263_-	hypothetical protein	NA	NA	NA	NA
WP_020804298.1\|1315297_1316386_-	recombinase RecT	H6WRX0	Salmonella_phage	5.5e-103	53.3
WP_173819897.1\|1316398_1319506_-	PD-(D/E)XK nuclease-like domain-containing protein	H6WRX1	Salmonella_phage	2.4e-292	56.7
WP_016946289.1\|1319643_1319799_-	DNA breaking-rejoining protein	H6WRX3	Salmonella_phage	2.6e-14	74.5
WP_080783016.1\|1319808_1320000_-	YebW family protein	NA	NA	NA	NA
WP_048997841.1\|1320486_1320696_+	hypothetical protein	A0A192Y6Q5	Salmonella_phage	5.0e-21	73.1
WP_063422095.1\|1320782_1321151_-	hemolysin XhlA	NA	NA	NA	NA
WP_044245063.1\|1321154_1321574_-	hypothetical protein	NA	NA	NA	NA
WP_173819898.1\|1321592_1321976_-	helix-turn-helix domain-containing protein	K7PHG0	Enterobacteria_phage	4.5e-52	84.0
WP_023282398.1\|1322074_1322293_+	helix-turn-helix domain-containing protein	K7PKS2	Enterobacteria_phage	8.9e-21	64.8
WP_173819899.1\|1322295_1322832_+	hypothetical protein	M9NZI6	Enterobacteria_phage	7.7e-58	67.2
WP_173819900.1\|1322843_1323104_+	hypothetical protein	NA	NA	NA	NA
WP_032446341.1\|1323181_1324102_+	replication protein	K7PGZ0	Enterobacteria_phage	1.7e-92	61.3
WP_023301220.1\|1324098_1324842_+	hypothetical protein	A0A0M3ULE2	Salmonella_phage	4.1e-65	55.6
WP_016946299.1\|1324834_1325170_+	DUF977 family protein	H6WRX9	Salmonella_phage	4.4e-11	43.0
WP_115667100.1\|1325162_1325948_+	hypothetical protein	C7BGF1	Burkholderia_phage	2.5e-65	52.9
WP_048279473.1\|1325944_1326148_+	hypothetical protein	A0A2R2Z313	Escherichia_phage	3.8e-26	83.3
WP_020804604.1\|1326140_1326395_+	hypothetical protein	S5MQM0	Escherichia_phage	1.4e-09	50.6
WP_020804600.1\|1326391_1326613_+	hypothetical protein	A9YWV3	Burkholderia_phage	1.3e-11	49.4
WP_032417030.1\|1326616_1327045_+	hypothetical protein	NA	NA	NA	NA
WP_032413665.1\|1327140_1327440_+	hypothetical protein	NA	NA	NA	NA
WP_004184503.1\|1328191_1328425_+	DinI-like family protein	K7PM44	Enterobacteria_phage	2.9e-25	68.8
WP_071557491.1\|1328530_1328779_+	hypothetical protein	K7PHG9	Enterobacteria_phage	5.0e-28	67.9
WP_064164738.1\|1328813_1329410_+	DUF1367 family protein	K7PKS6	Enterobacteria_phage	3.8e-90	80.6
WP_173819901.1\|1329618_1329915_+	DUF1364 domain-containing protein	A0A0U2KD41	Escherichia_phage	2.1e-36	72.9
WP_023282412.1\|1329911_1330268_+	RusA family crossover junction endodeoxyribonuclease	K7P6W0	Enterobacteria_phage	1.5e-41	64.1
WP_023287514.1\|1330383_1331205_+	antitermination protein	K7PKS8	Enterobacteria_phage	1.1e-98	67.5
WP_025983157.1\|1331896_1332292_+\|holin	phage holin family protein	G8C7V8	Escherichia_phage	1.5e-45	73.1
WP_173819902.1\|1332278_1332560_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	5.9e-33	73.1
WP_004899661.1\|1332559_1333189_+	glycoside hydrolase family 19 protein	G9L6E8	Escherichia_phage	3.1e-90	77.5
WP_117086704.1\|1333191_1333467_+	hypothetical protein	G8C7W1	Escherichia_phage	1.1e-07	39.3
WP_016831932.1\|1333650_1333851_+	hypothetical protein	A0A1L6Z528	Klebsiella_phage	5.9e-19	73.3
WP_048271635.1\|1334248_1334494_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	2.7e-18	63.0
WP_025713971.1\|1334567_1334984_+	DUF2513 domain-containing protein	NA	NA	NA	NA
WP_173819903.1\|1335242_1336247_+\|terminase	terminase small subunit	Q5QF76	Pseudomonas_virus	1.3e-37	45.0
WP_071033688.1\|1336224_1337532_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.3e-148	58.7
WP_047694609.1\|1337531_1338932_+	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	4.1e-127	53.5
WP_117055504.1\|1338915_1340028_+	hypothetical protein	I6PD76	Cronobacter_phage	4.8e-110	54.9
WP_032417039.1\|1340112_1340898_+	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	6.0e-67	63.9
WP_032410237.1\|1340908_1341862_+	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	1.1e-131	74.0
WP_158414530.1\|1341870_1342143_+	Ig-like domain-containing protein	NA	NA	NA	NA
WP_008807837.1\|1342183_1342579_+	hypothetical protein	A0A0S2SYB7	Pseudomonas_phage	3.3e-13	43.3
WP_004190649.1\|1342580_1342835_+	hypothetical protein	J9Q7U0	Salmonella_phage	8.0e-21	52.4
WP_004190646.1\|1342844_1343078_+	hypothetical protein	A0A2H4J0Y9	uncultured_Caudovirales_phage	5.8e-10	47.1
WP_032417040.1\|1343064_1343448_+	hypothetical protein	A0A0S2SYG4	Pseudomonas_phage	1.6e-20	45.2
WP_032417041.1\|1343449_1344001_+	hypothetical protein	G8C7Q1	Escherichia_phage	1.2e-29	40.5
WP_004190640.1\|1343997_1344390_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_173819904.1\|1344413_1345586_+	Ig domain-containing protein	A0A0D4DBN5	Acinetobacter_phage	9.4e-24	27.0
WP_059065378.1\|1345641_1346124_+	hypothetical protein	NA	NA	NA	NA
WP_123235785.1\|1346261_1346459_+	hypothetical protein	NA	NA	NA	NA
WP_173819905.1\|1346526_1347411_+	hypothetical protein	NA	NA	NA	NA
WP_001339197.1\|1347593_1348802_+\|transposase	IS4-like element ISVsa5 family transposase	Q9E8P4	Bluetongue_virus	3.0e-235	100.0
WP_173819906.1\|1348853_1351754_+\|tail	phage tail length tape measure family protein	A0A2H4J107	uncultured_Caudovirales_phage	1.5e-102	32.3
WP_032417047.1\|1351753_1352218_+	hypothetical protein	A0A286S298	Klebsiella_phage	6.7e-58	67.8
WP_032417048.1\|1352398_1352881_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	2.9e-80	93.8
WP_016946669.1\|1352890_1353271_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	3.1e-69	95.2
WP_032417049.1\|1353267_1356336_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	96.3
WP_032417050.1\|1359018_1360113_+	hypothetical protein	A0A248XD67	Klebsiella_phage	2.0e-177	86.8
1366717:1366732	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1396597 : 1476090

Klebsiella_phage(45.83%)

transposase,holin,protease,tail,plate,head,capsid,terminase,integrase,portal

attL 1401969:1401985|attR 1446252:1446268

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001339197.1\|1396597_1397806_-\|transposase	IS4-like element ISVsa5 family transposase	Q9E8P4	Bluetongue_virus	3.0e-235	100.0
WP_042938106.1\|1398711_1399596_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_173819910.1\|1399768_1400905_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_052264171.1\|1400970_1402173_+	MFS transporter	NA	NA	NA	NA
1401969:1401985	attL	NA	NA	NA	NA
WP_004152141.1\|1402251_1403121_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	5.7e-50	42.1
WP_004176439.1\|1403667_1403856_-	hypothetical protein	NA	NA	NA	NA
WP_042938114.1\|1404156_1405071_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004176437.1\|1405179_1405941_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-21	32.5
WP_016197745.1\|1407888_1408437_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_019705445.1\|1408633_1409815_+\|integrase	site-specific integrase	A0A0M4QX09	Salmonella_phage	6.2e-201	84.0
WP_004198241.1\|1409795_1409987_-	hypothetical protein	A0A0M4RTZ2	Salmonella_phage	3.9e-20	73.8
WP_029602963.1\|1410123_1410525_-	hypothetical protein	NA	NA	NA	NA
WP_029602964.1\|1410521_1410746_-	hypothetical protein	A0A286S2B3	Klebsiella_phage	1.7e-30	94.6
WP_029602965.1\|1410735_1411446_-	Rha family transcriptional regulator	A0A286S260	Klebsiella_phage	1.2e-111	87.9
WP_032422926.1\|1411451_1411970_-	hypothetical protein	A0A286S1S7	Klebsiella_phage	5.0e-94	98.3
WP_023304718.1\|1412074_1412902_-	hypothetical protein	Q8W654	Enterobacteria_phage	9.3e-111	84.0
WP_009309071.1\|1412898_1413093_-	hypothetical protein	NA	NA	NA	NA
WP_029602967.1\|1413089_1413515_-	hypothetical protein	A0A286S1S2	Klebsiella_phage	6.6e-52	76.5
WP_004177208.1\|1413511_1413730_-	hypothetical protein	A0A286S1P6	Klebsiella_phage	6.6e-32	98.6
WP_029602968.1\|1413701_1413956_-	hypothetical protein	A0A286SGR4	Klebsiella_phage	6.1e-37	91.7
WP_023304721.1\|1413948_1414314_-	hypothetical protein	A0A286S1Q6	Klebsiella_phage	5.8e-57	97.5
WP_004177202.1\|1414314_1414539_-	hypothetical protein	NA	NA	NA	NA
WP_029602969.1\|1414721_1415135_-	hypothetical protein	NA	NA	NA	NA
WP_029602970.1\|1415298_1415958_-	LexA family transcriptional regulator	A0A1B5FPF4	Escherichia_phage	9.4e-98	79.5
WP_071646927.1\|1416113_1416347_+	helix-turn-helix domain-containing protein	A0A1B5FPK9	Escherichia_phage	2.2e-17	63.9
WP_072002489.1\|1417065_1418724_+	DEAD/DEAH box helicase	A0A286N2P9	Klebsiella_phage	0.0e+00	99.3
WP_116961294.1\|1418725_1419688_+	toprim domain-containing protein	A0A286N2Q0	Klebsiella_phage	4.8e-183	99.7
WP_040088851.1\|1419684_1420161_+	hypothetical protein	A0A286N2Q1	Klebsiella_phage	3.1e-90	99.4
WP_023304725.1\|1420157_1420973_+	antitermination protein	A0A286N2Q2	Klebsiella_phage	4.4e-113	77.9
WP_004184721.1\|1421129_1421387_+	hypothetical protein	A0A286N2Q3	Klebsiella_phage	1.3e-42	100.0
WP_031280381.1\|1421292_1421739_-	hypothetical protein	NA	NA	NA	NA
WP_024176410.1\|1422381_1422681_+\|holin	phage holin family protein	A0A286N2Q5	Klebsiella_phage	4.5e-39	83.8
WP_029602975.1\|1422677_1423217_+	glycoside hydrolase family 108 protein	A0A286N2Q6	Klebsiella_phage	1.3e-100	97.8
WP_029602976.1\|1423213_1423558_+	hypothetical protein	A0A286N2Q7	Klebsiella_phage	3.9e-39	80.7
WP_110244697.1\|1423554_1423830_+	hypothetical protein	A0A286N2Q8	Klebsiella_phage	2.2e-08	78.0
WP_004184720.1\|1424065_1424350_-	hypothetical protein	NA	NA	NA	NA
WP_116961293.1\|1424482_1424755_+	hypothetical protein	NA	NA	NA	NA
WP_029603004.1\|1425078_1425324_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	4.7e-18	64.2
WP_029603005.1\|1425379_1425721_+	HNH endonuclease	K7P7P4	Enterobacteria_phage	1.0e-47	74.8
WP_004177162.1\|1425903_1426368_+\|terminase	phage terminase small subunit P27 family	Q9B019	Phage_GMSE-1	3.7e-48	61.4
WP_004177157.1\|1426321_1428064_+\|terminase	terminase large subunit	A0A0U2C138	Paracoccus_phage	2.8e-141	46.2
WP_040088853.1\|1428063_1429371_+\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	5.4e-214	85.5
WP_023317649.1\|1429384_1430233_+\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	3.0e-136	89.6
WP_021441630.1\|1430242_1431460_+\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	3.6e-196	87.9
WP_004177149.1\|1431798_1432125_+\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	6.2e-42	69.4
WP_038435250.1\|1432136_1432475_+\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	9.2e-41	73.2
WP_040088856.1\|1432471_1432921_+	HK97 gp10 family phage protein	Q9MCS9	Enterobacteria_phage	6.1e-64	83.9
WP_042947699.1\|1432917_1433265_+	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	1.8e-31	61.9
WP_047671839.1\|1433321_1434026_+	immunoglobulin domain-containing protein	K7PHL2	Enterobacterial_phage	1.9e-80	66.5
WP_021313622.1\|1434056_1434461_+\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	8.5e-33	57.7
WP_040088907.1\|1434463_1434769_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	1.6e-28	65.7
WP_116961328.1\|1434843_1435227_+	hypothetical protein	A0A0M4QWT0	Salmonella_phage	5.2e-32	53.1
WP_173819911.1\|1435293_1438701_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	4.4e-191	42.5
WP_004177132.1\|1438722_1439196_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.4e-55	62.1
WP_004177130.1\|1439182_1439659_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	4.8e-51	65.8
WP_004177128.1\|1439671_1440052_+	nitrite transporter	A0A286S2A6	Klebsiella_phage	1.6e-57	80.2
WP_173819912.1\|1440048_1443126_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	61.7
WP_173819913.1\|1445810_1446908_+	hypothetical protein	A0A248XD67	Klebsiella_phage	4.0e-178	86.8
1446252:1446268	attR	NA	NA	NA	NA
WP_173819914.1\|1447035_1447848_-	hypothetical protein	NA	NA	NA	NA
WP_019705237.1\|1449028_1449277_-	DinI-like family protein	S5MQI1	Escherichia_phage	1.0e-25	70.4
WP_004176434.1\|1450122_1450614_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004190552.1\|1450656_1452201_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_022615502.1\|1452210_1453554_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004190548.1\|1453550_1454240_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_042938116.1\|1454236_1455943_+	OmpA family protein	NA	NA	NA	NA
WP_002902160.1\|1455947_1456439_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_042938119.1\|1456703_1459358_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	2.2e-97	33.4
WP_004224357.1\|1459359_1461729_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.4e-18	34.3
WP_004224359.1\|1461729_1462509_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_042938122.1\|1462572_1463166_+	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_042938124.1\|1463233_1463764_+	T6SS immunity phospholipase A1-binding lipoprotein Tli1-KP	NA	NA	NA	NA
WP_042938126.1\|1463832_1464363_+	T6SS immunity phospholipase A1-binding lipoprotein Tli1-KP	NA	NA	NA	NA
WP_086627217.1\|1464350_1466792_+	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_002902252.1\|1466812_1467070_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_040146284.1\|1467066_1468206_+	hypothetical protein	NA	NA	NA	NA
WP_040146281.1\|1468189_1471618_+	type VI secretion protein VasK	NA	NA	NA	NA
WP_004183804.1\|1471614_1473207_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_040146278.1\|1473286_1475041_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004176418.1\|1475004_1476090_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_6

1669336 : 1680223

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002210516.1\|1669336_1669957_-	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
WP_173819928.1\|1669949_1671215_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	4.3e-232	99.3
WP_002903955.1\|1671226_1672129_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
WP_002210513.1\|1672389_1673151_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_001620095.1\|1673171_1674032_-	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_004176262.1\|1674329_1674590_+	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
WP_004179755.1\|1674676_1675765_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	3.0e-210	99.7
WP_004176258.1\|1675795_1677061_-	MFS transporter	NA	NA	NA	NA
WP_065901146.1\|1677115_1680223_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.5

DBSCAN-SWA_7

2444064 : 2494845

Cronobacter_phage(22.58%)

terminase,holin,head,integrase

attL 2442651:2442678|attR 2491899:2491926

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2442651:2442678	attL	NA	NA	NA	NA
WP_042938019.1\|2444064_2445156_-	hypothetical protein	A0A248XD67	Klebsiella_phage	1.9e-172	83.5
WP_086627443.1\|2447882_2450360_-	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	2.6e-196	45.4
WP_042937281.1\|2450346_2450742_-	C40 family peptidase	F1C5F2	Cronobacter_phage	2.1e-36	55.6
WP_042937280.1\|2450738_2451209_-	hypothetical protein	R9TPR6	Aeromonas_phage	3.3e-28	41.0
WP_023342746.1\|2451208_2451685_-	hypothetical protein	A0A2P1MXB5	Escherichia_phage	2.5e-36	48.4
WP_173819960.1\|2451727_2454991_-	tape measure protein	R9TMK1	Aeromonas_phage	2.7e-238	60.4
WP_042937289.1\|2455062_2455533_-	hypothetical protein	NA	NA	NA	NA
WP_042937278.1\|2455803_2456145_-	hypothetical protein	NA	NA	NA	NA
WP_077255888.1\|2456395_2456755_+	hypothetical protein	A0A077K9U2	Edwardsiella_phage	1.4e-15	41.7
WP_042937275.1\|2457341_2457920_+	hypothetical protein	NA	NA	NA	NA
WP_052264160.1\|2458011_2458599_-	HNH endonuclease	G0ZNE5	Cronobacter_phage	1.9e-25	38.6
WP_042937274.1\|2458668_2459385_-	hypothetical protein	G0ZNE7	Cronobacter_phage	4.1e-62	53.2
WP_042937273.1\|2459453_2460218_-	immunoglobulin domain-containing protein	G0ZNE6	Cronobacter_phage	1.6e-40	43.4
WP_024622701.1\|2460276_2460660_-	hypothetical protein	NA	NA	NA	NA
WP_042937272.1\|2460656_2461025_-	hypothetical protein	F1C5E3	Cronobacter_phage	1.7e-48	83.6
WP_128337600.1\|2461084_2461303_-	hypothetical protein	A0A2D2W2V0	Stenotrophomonas_phage	1.2e-09	45.7
WP_042937271.1\|2461331_2461694_-	hypothetical protein	G0ZNE2	Cronobacter_phage	1.6e-27	55.0
WP_032752624.1\|2461693_2461867_-	hypothetical protein	I6R0P9	Salmonella_phage	5.4e-13	54.4
WP_042937269.1\|2461866_2462247_-	hypothetical protein	F1C5E2	Cronobacter_phage	5.3e-29	54.5
WP_042937267.1\|2462249_2462489_-	hypothetical protein	NA	NA	NA	NA
WP_042937265.1\|2462499_2463594_-	hypothetical protein	F1C5E1	Cronobacter_phage	8.2e-123	62.5
WP_004151271.1\|2463605_2464034_-	hypothetical protein	F1C5E0	Cronobacter_phage	1.6e-42	60.8
WP_042937263.1\|2464037_2465219_-	DUF2213 domain-containing protein	F1C5D9	Cronobacter_phage	3.6e-92	42.8
WP_042937261.1\|2465631_2466627_-\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	1.3e-114	69.0
WP_042937259.1\|2466559_2468023_-	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	1.2e-148	56.3
WP_042937257.1\|2468035_2469508_-\|terminase	terminase	A0A1W6JNY3	Morganella_phage	1.5e-249	82.7
WP_040245563.1\|2469507_2470110_-	hypothetical protein	G8C7P2	Escherichia_phage	6.4e-77	81.5
WP_077255887.1\|2470292_2470877_+	DUF4145 domain-containing protein	V5URE2	Shigella_phage	1.4e-39	46.5
WP_042937253.1\|2471104_2471455_-	hypothetical protein	H2EQH5	Salmonella_phage	1.0e-10	38.9
WP_042937252.1\|2471451_2471946_-	lysozyme	M9P0E5	Enterobacteria_phage	6.6e-88	94.5
WP_019704119.1\|2471923_2472148_-\|holin	class II holin family protein	M9NZI9	Enterobacteria_phage	4.0e-32	91.9
WP_042937251.1\|2472632_2473247_-	hypothetical protein	A0A1V0E5R2	Salmonella_phage	1.6e-112	98.0
WP_042937250.1\|2473243_2473426_-	hypothetical protein	NA	NA	NA	NA
WP_012967714.1\|2473413_2473611_-	protein ninH	I6RSQ6	Salmonella_phage	1.2e-16	66.7
WP_042937249.1\|2473607_2473832_-	hypothetical protein	Q5G8R9	Enterobacteria_phage	2.1e-33	85.1
WP_042937248.1\|2473828_2474194_-	RusA family crossover junction endodeoxyribonuclease	A5VW85	Enterobacteria_phage	7.9e-46	76.7
WP_042937247.1\|2474190_2474481_-	DUF1364 domain-containing protein	A0A220NQY2	Salmonella_phage	1.7e-43	84.2
WP_072039973.1\|2474464_2474650_-	NinF family protein	I6R994	Salmonella_phage	2.8e-15	71.4
WP_042937246.1\|2474642_2474822_-	NinE family protein	Q76H73	Enterobacteria_phage	1.3e-14	68.5
WP_042937245.1\|2474791_2474962_-	hypothetical protein	Q8HAF7	Salmonella_phage	5.7e-23	84.0
WP_042937244.1\|2474958_2475369_-	recombination protein NinB	A0A0P0ZCW6	Stx2-converting_phage	6.8e-62	85.9
WP_042937243.1\|2475417_2475657_-	hypothetical protein	G8C7S3	Escherichia_phage	1.1e-08	53.4
WP_042937242.1\|2475649_2475955_-	hypothetical protein	K7PJS3	Enterobacterial_phage	3.6e-28	62.0
WP_042937241.1\|2475951_2476503_-	hypothetical protein	NA	NA	NA	NA
WP_042937240.1\|2476499_2477042_-	hypothetical protein	A0A0S1S1U7	Klebsiella_phage	2.5e-19	58.1
WP_042937239.1\|2477038_2477341_-	hypothetical protein	F1C5B5	Cronobacter_phage	1.6e-07	50.9
WP_042937238.1\|2477337_2477763_-	HNH endonuclease	C6ZR29	Salmonella_phage	5.5e-59	81.5
WP_086627474.1\|2478144_2478897_-	hypothetical protein	M1FN76	Enterobacteria_phage	2.6e-128	85.6
WP_074384543.1\|2478893_2479151_-	DUF4752 family protein	T1S9K2	Salmonella_phage	3.6e-29	72.9
WP_086627476.1\|2479147_2479681_-	hypothetical protein	R9TME7	Aeromonas_phage	3.6e-07	29.1
WP_042937230.1\|2479677_2479902_-	hypothetical protein	H9C169	Pectobacterium_phage	1.1e-13	51.5
WP_042937228.1\|2480215_2480416_-	hypothetical protein	NA	NA	NA	NA
WP_042937226.1\|2480412_2481012_-	hypothetical protein	NA	NA	NA	NA
WP_042937223.1\|2481011_2482445_-	AAA family ATPase	Q716D2	Shigella_phage	6.1e-227	85.3
WP_042937221.1\|2482434_2483328_-	hypothetical protein	G5DA89	Enterobacteria_phage	2.2e-105	70.3
WP_012967698.1\|2483314_2483476_-	hypothetical protein	Q76H53	Enterobacteria_phage	3.3e-20	92.5
WP_042937218.1\|2483510_2483810_-	hypothetical protein	A2SY75	Escherichia_phage	3.6e-28	70.0
WP_077203341.1\|2483915_2484125_-	helix-turn-helix domain-containing protein	G8C7U2	Escherichia_phage	4.4e-09	54.2
WP_042937216.1\|2484231_2484828_+	hypothetical protein	NA	NA	NA	NA
WP_042937214.1\|2485225_2485513_+	hypothetical protein	A0A0K2FII1	Escherichia_phage	1.9e-07	66.7
WP_042937212.1\|2485559_2486102_+	hypothetical protein	NA	NA	NA	NA
WP_077255886.1\|2486250_2486415_+	host cell division inhibitory peptide Kil	NA	NA	NA	NA
WP_142285263.1\|2486401_2486764_+	hypothetical protein	C6ZR42	Salmonella_phage	1.7e-08	40.8
WP_042937206.1\|2486891_2487200_+	hypothetical protein	K7PJM4	Enterobacteria_phage	4.2e-24	51.0
WP_042937204.1\|2487196_2488090_+	recombinase RecT	K7P7A0	Enterobacteria_phage	2.3e-139	83.7
WP_173819961.1\|2488082_2488565_+	siphovirus Gp157 family protein	K7P6T5	Enterobacteria_phage	4.2e-63	76.2
WP_042937200.1\|2488871_2489144_+	DUF5405 family protein	Q716F1	Shigella_phage	1.4e-23	66.7
WP_072039971.1\|2489140_2489308_+	DUF2737 family protein	Q5G8U5	Enterobacteria_phage	6.6e-08	53.2
WP_042937198.1\|2489307_2489646_+	DUF2591 family protein	A5VW89	Enterobacteria_phage	1.7e-23	50.0
WP_042937284.1\|2489681_2489939_+	DNA polymerase III subunit theta	G8C7V1	Escherichia_phage	3.2e-25	72.7
WP_072039974.1\|2490027_2490375_+	hypothetical protein	NA	NA	NA	NA
WP_012967684.1\|2490496_2490769_+	excisionase	A0A2H4J5E1	uncultured_Caudovirales_phage	3.0e-26	61.1
WP_042937196.1\|2490737_2491823_+\|integrase	phage integrase Arm DNA-binding domain-containing protein	A0A2H4IYC8	uncultured_Caudovirales_phage	1.6e-147	68.4
WP_002911404.1\|2492161_2492500_-	YebY family protein	NA	NA	NA	NA
2491899:2491926	attR	NA	NA	NA	NA
WP_032420215.1\|2492516_2493386_-	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_004151448.1\|2493389_2493764_-	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_040210823.1\|2493876_2494107_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	5.9e-15	57.4
WP_002911407.1\|2494185_2494845_+	exodeoxyribonuclease X	A0A0H4IT92	Pseudoalteromonas_phage	2.2e-14	31.7

DBSCAN-SWA_8

2735341 : 2742244

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189109.1\|2735341_2736820_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	8.5e-30	28.3
WP_004175198.1\|2736816_2737539_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
WP_004144192.1\|2737855_2739217_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.8e-207	94.8
WP_004151134.1\|2739459_2740356_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.1e-15	29.8
WP_004180550.1\|2740596_2741370_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-26	36.7
WP_042937159.1\|2741380_2742244_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.7e-10	34.5

DBSCAN-SWA_9

2954157 : 3040789

Escherichia_phage(20.0%)

protease,tail,holin,head,portal,capsid,tRNA,terminase,integrase,transposase

attL 2976888:2976912|attR 3017759:3017783

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913226.1\|2954157_2954970_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_002913227.1\|2954969_2955983_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_040147248.1\|2956046_2957183_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	1.2e-20	27.8
WP_032423559.1\|2957293_2958271_+	flagella biosynthesis regulator Flk	NA	NA	NA	NA
WP_004149211.1\|2958357_2959533_-	MFS transporter	NA	NA	NA	NA
WP_002913291.1\|2959742_2960963_-	beta-ketoacyl-ACP synthase I	NA	NA	NA	NA
WP_023285399.1\|2961121_2963110_+\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
WP_002913338.1\|2963171_2963453_-	YfcL family protein	NA	NA	NA	NA
WP_002913339.1\|2963484_2964033_-	elongation factor P hydroxylase	NA	NA	NA	NA
WP_002913340.1\|2964032_2964842_-	TSUP family transporter	NA	NA	NA	NA
WP_004174960.1\|2964841_2965666_-	penicillin-insensitive murein endopeptidase	NA	NA	NA	NA
WP_040147249.1\|2965668_2966754_-	chorismate synthase	A0A291AU41	Pandoravirus	3.5e-89	46.6
WP_002913346.1\|2966795_2967728_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_002913348.1\|2967895_2968447_+	endonuclease SmrB	NA	NA	NA	NA
WP_002913355.1\|2968467_2968953_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
WP_023282886.1\|2969162_2971307_-	fatty acid oxidation complex subunit alpha FadJ	NA	NA	NA	NA
WP_002913358.1\|2971306_2972617_-	acetyl-CoA C-acyltransferase FadI	NA	NA	NA	NA
WP_002913359.1\|2972776_2973061_-	YfcZ/YiiS family protein	NA	NA	NA	NA
WP_002913360.1\|2973434_2974757_+	long-chain fatty acid transporter FadL	NA	NA	NA	NA
WP_002913362.1\|2974818_2975580_-	phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
WP_004149224.1\|2975869_2976799_+	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	6.7e-134	81.4
2976888:2976912	attL	NA	NA	NA	NA
WP_032434919.1\|2977497_2978586_+	acyltransferase	C6ZR20	Salmonella_phage	1.8e-05	27.2
WP_032434917.1\|2978620_2979715_-	hypothetical protein	A0A248XD67	Klebsiella_phage	1.4e-178	86.5
WP_001339197.1\|2982539_2983748_-\|transposase	IS4-like element ISVsa5 family transposase	Q9E8P4	Bluetongue_virus	3.0e-235	100.0
WP_032434913.1\|2986811_2987192_-	nitrite transporter	A0A286S2A6	Klebsiella_phage	2.0e-60	83.3
WP_023302606.1\|2987204_2987681_-	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	5.3e-50	64.6
WP_004884312.1\|2987667_2988141_-	hypothetical protein	A0A286S298	Klebsiella_phage	1.1e-55	62.7
WP_032434911.1\|2988162_2991549_-\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	4.0e-301	57.5
WP_016530182.1\|2991610_2991844_-	hypothetical protein	K7PH16	Enterobacteria_phage	1.9e-08	47.2
WP_016530183.1\|2991917_2992223_-	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	4.7e-28	64.6
WP_032434909.1\|2992225_2992630_-\|tail	phage tail protein	Q9MCS5	Enterobacteria_phage	1.9e-32	56.2
WP_032412035.1\|2992660_2993365_-	immunoglobulin domain-containing protein	K7PHL2	Enterobacterial_phage	9.5e-80	66.5
WP_023302599.1\|2993421_2993769_-	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	2.8e-32	63.7
WP_019705270.1\|2993765_2994215_-	HK97 gp10 family phage protein	Q9MCS9	Enterobacteria_phage	6.7e-63	82.6
WP_031592512.1\|2994211_2994550_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	3.3e-38	67.9
WP_023316722.1\|2994558_2994876_-\|head,tail	phage gp6-like head-tail connector protein	A0A1W6JNZ5	Morganella_phage	4.8e-23	52.0
WP_004104235.1\|2994953_2996192_-\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	6.8e-158	69.2
WP_032434907.1\|2996201_2996801_-\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	1.0e-90	83.0
WP_032434905.1\|2996793_2998020_-\|portal	phage portal protein	Q8SBI0	Shigella_phage	3.2e-208	85.3
WP_000246643.1\|2998167_2999919_-\|terminase	terminase large subunit	A0A1P8DTK0	Proteus_phage	6.7e-252	72.2
WP_032434902.1\|2999922_3000420_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	2.5e-63	72.0
WP_032434901.1\|3000578_3000929_-	HNH endonuclease	A0A1B5FP94	Escherichia_phage	3.4e-46	73.7
WP_032434899.1\|3001128_3001788_+	hypothetical protein	NA	NA	NA	NA
WP_032434896.1\|3001989_3002265_-	hypothetical protein	G8C7W1	Escherichia_phage	1.9e-23	66.3
WP_032434894.1\|3002272_3002902_-	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	1.2e-105	90.9
WP_019705280.1\|3002901_3003183_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	3.9e-37	80.6
WP_017145563.1\|3003169_3003565_-\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	2.6e-63	98.5
WP_032434891.1\|3004063_3004219_-	DUF3927 family protein	A0A0A0YRI9	Escherichia_phage	2.5e-09	68.8
WP_032412064.1\|3004215_3004641_-	tellurite resistance TerB family protein	Q71TK7	Escherichia_phage	1.9e-59	83.7
WP_004899672.1\|3004860_3005439_-	DUF1133 family protein	A0A0U2S606	Escherichia_phage	7.6e-51	57.2
WP_032434890.1\|3005452_3006433_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	7.6e-136	67.5
WP_000779146.1\|3006445_3006823_-	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	2.3e-48	73.6
WP_032434888.1\|3006832_3007642_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1C9II58	Salmonella_phage	2.9e-109	68.9
WP_017880208.1\|3007638_3008592_-	helix-turn-helix domain-containing protein	U5P0A0	Shigella_phage	6.1e-90	69.0
WP_001208720.1\|3008581_3008761_-	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	4.6e-15	73.1
WP_004213338.1\|3008998_3009460_-	hypothetical protein	K7PJS5	Enterobacterial_phage	1.7e-69	88.2
WP_001191665.1\|3009494_3009737_-	helix-turn-helix transcriptional regulator	A0A1C9IHV8	Salmonella_phage	1.3e-25	80.3
WP_000690183.1\|3009834_3010530_+	helix-turn-helix transcriptional regulator	Q8HAA0	Salmonella_phage	2.7e-87	71.3
WP_024623196.1\|3011158_3011458_+	hypothetical protein	K7PJS4	Enterobacterial_phage	1.1e-13	48.6
WP_032434886.1\|3011457_3012243_+	hypothetical protein	A4JX52	Burkholderia_virus	2.9e-61	50.6
WP_021314787.1\|3012370_3013447_+	DGQHR domain-containing protein	T1SBJ4	Salmonella_phage	2.8e-147	74.4
WP_004864289.1\|3013822_3014338_+	hypothetical protein	A0A0P0ZBM8	Stx2-converting_phage	2.9e-70	76.4
WP_077254126.1\|3015145_3015346_+	hypothetical protein	G3CFG7	Escherichia_phage	1.8e-12	60.0
WP_123618668.1\|3015447_3016290_-	hypothetical protein	NA	NA	NA	NA
WP_032434882.1\|3016394_3017564_-\|integrase	site-specific integrase	A0A2R2Z2Y0	Escherichia_phage	1.9e-202	86.1
WP_002913367.1\|3018083_3018566_+	WbuC family cupin fold metalloprotein	NA	NA	NA	NA
3017759:3017783	attR	NA	NA	NA	NA
WP_004149226.1\|3018933_3019815_+	hypothetical protein	A0A2H4JEC4	uncultured_Caudovirales_phage	1.5e-05	56.8
WP_004149227.1\|3019824_3020733_-	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	4.6e-10	24.2
WP_023282887.1\|3020865_3021324_+	nucleoside deaminase	A0A0B5J096	Pandoravirus	3.8e-13	33.9
WP_023282888.1\|3021320_3022517_+	cyanate transporter	NA	NA	NA	NA
WP_099119320.1\|3022855_3022927_+	membrane protein YpdK	NA	NA	NA	NA
WP_002913372.1\|3022997_3024212_-	alanine transaminase	NA	NA	NA	NA
WP_032409803.1\|3024300_3024486_+	hypothetical protein	NA	NA	NA	NA
WP_004153200.1\|3024482_3024596_-	hypothetical protein	NA	NA	NA	NA
WP_004149230.1\|3024594_3026292_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-47	28.5
WP_002913374.1\|3026303_3027041_+	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	1.5e-14	26.3
WP_002913377.1\|3027094_3028060_-	glucokinase	NA	NA	NA	NA
WP_004154521.1\|3028323_3029559_+	ion channel protein	NA	NA	NA	NA
WP_009309545.1\|3029555_3031217_-	indolepyruvate decarboxylase	NA	NA	NA	NA
WP_004174934.1\|3031397_3032390_+	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
WP_002913419.1\|3032520_3032880_+	DUF2502 domain-containing protein	NA	NA	NA	NA
WP_002913421.1\|3032937_3034179_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_002913423.1\|3034525_3035728_+	nucleoside permease NupC	NA	NA	NA	NA
WP_004151096.1\|3035776_3037948_-	EAL domain-containing protein	NA	NA	NA	NA
WP_002913434.1\|3038569_3038923_+	putative DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002913435.1\|3038926_3039319_+	putative DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004145598.1\|3039370_3040789_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_10

3205072 : 3288406

Klebsiella_phage(71.43%)

protease,tail,holin,head,capsid,tRNA,terminase,integrase,portal

attL 3200359:3200374|attR 3298370:3298385

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3200359:3200374	attL	NA	NA	NA	NA
WP_002914089.1\|3205072_3206158_-\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_002914091.1\|3206361_3206787_+	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	6.0e-13	40.2
WP_042936772.1\|3206856_3207555_+	DTW domain-containing protein	NA	NA	NA	NA
WP_042936775.1\|3207589_3210241_+	protein lysine acetyltransferase	NA	NA	NA	NA
WP_004180947.1\|3210361_3211717_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_004899914.1\|3211758_3212082_+	YfiM family lipoprotein	NA	NA	NA	NA
WP_004144368.1\|3212085_3213384_-	MFS transporter	Q6JIH2	Burkholderia_virus	4.1e-44	31.5
WP_042937525.1\|3219261_3221835_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	2.6e-127	35.3
WP_004212956.1\|3221964_3222696_-	polyphenol oxidase	NA	NA	NA	NA
WP_040172544.1\|3222692_3223673_-	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_004145664.1\|3223804_3224542_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_002914111.1\|3224812_3225148_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_100250063.1\|3225254_3225302_+	hypothetical protein	NA	NA	NA	NA
WP_004150975.1\|3225402_3226563_+	bifunctional chorismate mutase/prephenate dehydratase	NA	NA	NA	NA
WP_004174805.1\|3226559_3227432_-	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
WP_040146086.1\|3227494_3228616_-	bifunctional chorismate mutase/prephenate dehydrogenase	NA	NA	NA	NA
WP_002914114.1\|3228625_3229696_-	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	1.8e-90	51.5
WP_004174804.1\|3230038_3230548_+	YfiR family protein	NA	NA	NA	NA
WP_002914116.1\|3230540_3231764_+	diguanylate cyclase DgcN	NA	NA	NA	NA
WP_004145671.1\|3231777_3232260_+	OmpA family protein	NA	NA	NA	NA
WP_002914118.1\|3232268_3233639_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_004174802.1\|3233695_3234154_-	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_002914145.1\|3234273_3234621_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_002914147.1\|3234660_3235428_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_004150977.1\|3235459_3236008_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002914149.1\|3236026_3236275_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_002914152.1\|3236534_3237899_-	signal recognition particle protein	NA	NA	NA	NA
WP_002914153.1\|3238062_3238854_+	inner membrane protein YpjD	NA	NA	NA	NA
WP_004149392.1\|3238873_3240160_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_002914155.1\|3240279_3240870_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_002914158.1\|3240994_3241873_+	NAD(+) kinase	NA	NA	NA	NA
WP_004174799.1\|3241959_3243621_+	DNA repair protein RecN	NA	NA	NA	NA
WP_002914160.1\|3243768_3244110_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_004145682.1\|3244176_3244467_-	RnfH family protein	NA	NA	NA	NA
WP_015875096.1\|3244456_3244933_-	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_002914164.1\|3245043_3245526_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.3e-29	47.4
WP_060184360.1\|3246303_3246552_+	DinI-like family protein	S5MQI1	Escherichia_phage	3.6e-26	70.4
WP_149795616.1\|3246860_3247085_-	helix-turn-helix domain-containing protein	A0A286S1P7	Klebsiella_phage	7.3e-18	78.0
WP_133061045.1\|3247191_3248037_+	hypothetical protein	NA	NA	NA	NA
WP_135729215.1\|3248246_3249341_-	hypothetical protein	A0A248XD67	Klebsiella_phage	9.9e-177	85.7
WP_135729214.1\|3252024_3255093_-	kinase	A0A286S259	Klebsiella_phage	0.0e+00	96.8
WP_017880229.1\|3255089_3255470_-	hypothetical protein	A0A286S2A6	Klebsiella_phage	4.6e-73	100.0
WP_117264102.1\|3255479_3255962_-	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	3.7e-83	96.2
WP_094354457.1\|3255948_3256428_-	hypothetical protein	A0A286S298	Klebsiella_phage	1.1e-92	98.7
WP_040182604.1\|3256427_3258875_-\|tail	phage tail tape measure protein	A0A286S1S3	Klebsiella_phage	5.9e-278	66.5
WP_004143894.1\|3258919_3259387_-	hypothetical protein	NA	NA	NA	NA
WP_004143895.1\|3259452_3259716_-	hypothetical protein	A0A286S1P2	Klebsiella_phage	5.9e-43	98.8
WP_001177591.1\|3259748_3260102_-\|tail	phage tail assembly chaperone family protein, TAC	A0A286S1N4	Klebsiella_phage	4.9e-61	99.1
WP_000115125.1\|3260145_3260637_-	hypothetical protein	A0A286S1Q8	Klebsiella_phage	2.3e-88	100.0
WP_087637325.1\|3260693_3261059_-	DUF3168 domain-containing protein	A0A286S1R1	Klebsiella_phage	3.0e-61	92.6
WP_094354456.1\|3261055_3261595_-	HK97 gp10 family phage protein	A0A286S249	Klebsiella_phage	1.5e-93	98.9
WP_065799391.1\|3261587_3261920_-\|head	phage head closure protein	A0A286S2A2	Klebsiella_phage	6.5e-55	96.4
WP_065799390.1\|3261921_3262119_-	hypothetical protein	A0A286S2A5	Klebsiella_phage	1.6e-24	93.8
WP_040186860.1\|3262179_3262506_-\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	9.8e-56	99.1
WP_044067369.1\|3262453_3262696_-	hypothetical protein	NA	NA	NA	NA
WP_032416975.1\|3262732_3263896_-\|capsid	phage major capsid protein	A0A286S1R4	Klebsiella_phage	2.9e-211	99.5
WP_004216821.1\|3263907_3264588_-\|head,protease	HK97 family phage prohead protease	A0A286S1N1	Klebsiella_phage	1.6e-124	100.0
WP_065799389.1\|3264593_3265871_-\|portal	phage portal protein	A0A286S1N5	Klebsiella_phage	3.1e-246	99.8
WP_004143904.1\|3265873_3267406_-\|terminase	terminase	A0A286S1M9	Klebsiella_phage	3.9e-296	100.0
WP_004143905.1\|3267415_3267850_-	hypothetical protein	A0A286S1P9	Klebsiella_phage	6.2e-74	100.0
WP_040213586.1\|3267970_3268180_-	hypothetical protein	A0A286N2R4	Klebsiella_phage	1.2e-25	88.4
WP_049109190.1\|3268192_3268483_-	HNH endonuclease	A0A286N2R3	Klebsiella_phage	2.9e-51	94.8
WP_094354455.1\|3268551_3269037_-	hypothetical protein	NA	NA	NA	NA
WP_064171958.1\|3269155_3269401_-	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	2.7e-18	64.2
WP_094354454.1\|3269720_3269912_-	hypothetical protein	A0A286SGR9	Klebsiella_phage	4.4e-24	89.8
WP_040236329.1\|3269862_3270138_-	hypothetical protein	G8C7W1	Escherichia_phage	8.9e-26	73.0
WP_023316711.1\|3270145_3270775_-	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	1.5e-105	90.4
WP_023317187.1\|3270774_3271053_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	5.3e-34	75.0
WP_023317188.1\|3271042_3271435_-\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	4.6e-44	72.2
WP_023317190.1\|3271686_3272235_-	hypothetical protein	NA	NA	NA	NA
WP_023317191.1\|3272454_3273237_-	antitermination protein	A0A286N2Q2	Klebsiella_phage	9.0e-148	100.0
WP_004198239.1\|3273233_3273710_-	hypothetical protein	A0A286N2Q1	Klebsiella_phage	1.8e-90	100.0
WP_004198233.1\|3273706_3274669_-	toprim domain-containing protein	A0A286N2Q0	Klebsiella_phage	4.8e-183	99.4
WP_004198228.1\|3274670_3276329_-	DEAD/DEAH box helicase	A0A286N2P9	Klebsiella_phage	0.0e+00	96.0
WP_004152162.1\|3276905_3277127_-	helix-turn-helix transcriptional regulator	A0A286S2C1	Klebsiella_phage	3.0e-32	100.0
WP_004152161.1\|3277224_3277893_+	LexA family transcriptional regulator	A0A286S2B2	Klebsiella_phage	2.4e-125	99.5
WP_004152160.1\|3278063_3278378_+	hypothetical protein	A0A286S1T9	Klebsiella_phage	1.0e-49	100.0
WP_094354453.1\|3278370_3278559_+	hypothetical protein	A0A286S1P8	Klebsiella_phage	2.3e-25	98.4
WP_004152158.1\|3278728_3279094_+	hypothetical protein	A0A286S1Q6	Klebsiella_phage	6.9e-58	99.2
WP_004152157.1\|3279086_3279341_+	hypothetical protein	A0A286SGR4	Klebsiella_phage	3.1e-41	97.6
WP_004177208.1\|3279312_3279531_+	hypothetical protein	A0A286S1P6	Klebsiella_phage	6.6e-32	98.6
WP_004152156.1\|3279527_3279953_+	hypothetical protein	A0A286S1S2	Klebsiella_phage	3.5e-53	77.9
WP_009309071.1\|3279949_3280144_+	hypothetical protein	NA	NA	NA	NA
WP_004152154.1\|3280140_3280968_+	hypothetical protein	Q8W654	Enterobacteria_phage	5.5e-111	84.0
WP_004152153.1\|3281072_3281591_+	hypothetical protein	A0A286S1S7	Klebsiella_phage	1.7e-94	98.8
WP_032441077.1\|3281596_3282322_+	Rha family transcriptional regulator	A0A286S260	Klebsiella_phage	2.7e-130	98.3
WP_023317194.1\|3282311_3282536_+	hypothetical protein	A0A286S2B3	Klebsiella_phage	2.4e-29	90.5
WP_004152150.1\|3282532_3282745_+	hypothetical protein	A0A286S2B6	Klebsiella_phage	3.4e-33	98.6
WP_023317195.1\|3282802_3283015_+	hypothetical protein	I6PBM8	Cronobacter_phage	8.4e-24	74.2
WP_023317196.1\|3282969_3284145_+	DUF3596 domain-containing protein	I6PDJ1	Cronobacter_phage	7.3e-210	93.8
WP_023317197.1\|3284632_3285541_+	DUF4760 domain-containing protein	A0A1B5FPC5	Escherichia_phage	2.4e-168	97.0
WP_151425524.1\|3285881_3287123_+\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	5.9e-101	48.4
WP_013365117.1\|3288193_3288406_+	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	5.4e-07	45.0
3298370:3298385	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP054305

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

31690 : 37940

Escherichia_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|31690_32395_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001011939.1\|32538_33180_-	type A-2 chloramphenicol O-acetyltransferase CatII	G3CFL0	Escherichia_phage	7.3e-55	45.9
WP_001239317.1\|33329_33830_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|33909_34614_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000018326.1\|34732_35548_+	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	4.3e-161	98.5
WP_001067855.1\|35730_36435_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_002210551.1\|37104_37233_+	hypothetical protein	NA	NA	NA	NA
WP_000792636.1\|37406_37940_-	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	5.8e-21	33.9

DBSCAN-SWA_2

84207 : 107109

Escherichia_phage(37.5%)

transposase,integrase

attL 81531:81546|attR 86461:86476

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
81531:81546	attL	NA	NA	NA	NA
WP_000543934.1\|84207_85218_-\|integrase	tyrosine-type recombinase/integrase	A0A0K0N6I5	Gordonia_phage	3.1e-07	31.9
WP_000949433.1\|85220_85757_-	hypothetical protein	NA	NA	NA	NA
WP_000575657.1\|86055_86337_-	hypothetical protein	NA	NA	NA	NA
WP_000278322.1\|86598_87201_+	hypothetical protein	NA	NA	NA	NA
86461:86476	attR	NA	NA	NA	NA
WP_000791469.1\|87216_87669_-	hypothetical protein	NA	NA	NA	NA
WP_001326394.1\|87839_88280_-	hypothetical protein	NA	NA	NA	NA
WP_001257735.1\|88251_92505_-	RHS repeat protein	A0A2H4JHK7	uncultured_Caudovirales_phage	1.1e-18	47.6
WP_000988731.1\|92637_93363_-	hypothetical protein	NA	NA	NA	NA
WP_000868820.1\|93476_93851_-	hypothetical protein	NA	NA	NA	NA
WP_000338626.1\|93971_94088_-	hypothetical protein	NA	NA	NA	NA
WP_000427623.1\|94493_95498_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_000184001.1\|95725_96931_+	chromate efflux transporter	NA	NA	NA	NA
WP_000130000.1\|96941_97247_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001389365.1\|97473_98238_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_001137892.1\|98730_99315_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000004159.1\|99314_100553_-	MFS transporter	NA	NA	NA	NA
WP_001404365.1\|100549_101455_-	Mph(A) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_001067855.1\|101576_102281_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000027057.1\|102867_103728_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_001235713.1\|103910_104468_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	7.0e-94	100.0
WP_000608644.1\|105031_106294_+\|transposase	IS1380-like element ISEc9 family transposase	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0
WP_001067855.1\|106404_107109_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054304

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP054303

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP054305

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection