CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP052070	Ralstonia solanacearum strain FJAT454.F1 chromosome, complete genome	1 crisprs	RT,cas3,WYL,csa3,DEDDh,DinG	0	1	13	0
NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	0 crisprs	NA	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP052070_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP052070_1

2319602-2319712

Orphan

Consensus_repeat	Method
GCGGACGGCTCGGGACGAATATAGGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP052070_1

>merge|NZ_CP052070|1|2319602-2319712|CRISPRCasFinder
GCGGACGGCTCGGGACGAATATAGGGATGGGAAGCGCTGTTGGCGGCGCGCCCGGACGGGGCGCCCTGCTCCGGCAGCGGAGGCGCGGACGGCTCGGGACGAACATAGGGA

>NZ_CP052070|1|1|2319602-2319712|CRISPRCasFinder
GCGGACGGCTCGGGACGAATATAGGGA	TGGGAAGCGCTGTTGGCGGCGCGCCCGGACGGGGCGCCCTGCTCCGGCAGCGGAGGC
GCGGACGGCTCGGGACGAACATAGGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP052070.1\|WP_021154819.1\|2309430_2310894_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP052070.1\|WP_011001313.1\|2310990_2311461_-\|DUF1857-family-protein	unknown	unknown	gnl\|CDD\|176872
NZ_CP052070.1\|WP_021154818.1\|2308225_2308957_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NZ_CP052070.1\|WP_016722039.1\|2320146_2322009_-\|GALA-protein	unknown	unknown	gnl\|CDD\|275380
NZ_CP052070.1\|WP_016722048.1\|2331845_2332826_-\|sulfate-ABC-transporter-permease-subunit-CysW	unknown	unknown	gnl\|CDD\|226665
NZ_CP052070.1\|WP_016725893.1\|2327506_2329564_-\|type-III-effector-protein	unknown	unknown	gnl\|CDD\|339245
NZ_CP052070.1\|WP_011001309.1\|2314424_2315354_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP052070.1\|WP_011001311.1\|2313231_2313933_-\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|130495
NZ_CP052070.1\|WP_016722033.1\|2309109_2309379_+\|acyl-CoA-binding-protein	unknown	unknown	gnl\|CDD\|226731
NZ_CP052070.1\|WP_011001297.1\|2329712_2330696_-\|CysB-family-HTH-type-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237172
NZ_CP052070.1\|WP_011001296.1\|2330730_2331849_-\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
NZ_CP052070.1\|WP_021154828.1\|2325771_2327016_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225519
NZ_CP052070.1\|WP_038937772.1\|2311567_2313148_-\|malate-synthase-A	unknown	unknown	gnl\|CDD\|236432
NZ_CP052070.1\|WP_016722040.1\|2322186_2322600_-\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|225016
NZ_CP052070.1\|WP_021154825.1\|2323126_2324872_-\|thiamine-pyrophosphate-binding-protein	unknown	unknown	gnl\|CDD\|181285
NZ_CP052070.1\|WP_016722037.1\|2315996_2317301_-\|isocitrate-lyase	unknown	unknown	gnl\|CDD\|237893
NZ_CP052070.1\|WP_020371745.1\|2315430_2315865_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP052070.1\|WP_011001303.1\|2322592_2323099_-\|ribonuclease-E-activity-regulator-RraA	unknown	unknown	gnl\|CDD\|236487
NZ_CP052070.1\|WP_021154817.1\|2307695_2308229_-\|ribosomal-protein-S18-alanine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|273701
NZ_CP052070.1\|WP_016722045.1\|2327015_2327309_-\|2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|379083

Protein	Function_ID	Function_description	E-value
NZ_CP052070.1\|WP_021154819.1\|2309430_2310894_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.71889e-68
NZ_CP052070.1\|WP_011001313.1\|2310990_2311461_-\|DUF1857-family-protein	gnl\|CDD\|176872	cd08863, SRPBCC_DUF1857, DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily. Uncharacterized family of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	2.21381e-54
NZ_CP052070.1\|WP_021154818.1\|2308225_2308957_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	6.80724e-56
NZ_CP052070.1\|WP_016722039.1\|2320146_2322009_-\|GALA-protein	gnl\|CDD\|275380	sd00033, LRR_RI, leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.	2.43388e-33
NZ_CP052070.1\|WP_016722048.1\|2331845_2332826_-\|sulfate-ABC-transporter-permease-subunit-CysW	gnl\|CDD\|226665	COG4208, CysW, ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism].	4.60094e-163
NZ_CP052070.1\|WP_016725893.1\|2327506_2329564_-\|type-III-effector-protein	gnl\|CDD\|339245	pfam14496, NEL, C-terminal novel E3 ligase, LRR-interacting. This NEL or novel E3 ligase domain is found at the C-terminus of bacterial virulence factors. Its sequence is different from those of the eukaryotic HECT and RING-finger E3 ligases, and it subverts the host ubiquitination process. At the N-terminus of the family-members there is a series of LRR repeats, and the NEL domain interacts with the most N-terminal repeat. The key residue for the ligation step is the cysteine, eg found at position 386 in UniProtKB:E7K2H2. The LRR section sequesters this active site until invasion has occurred.	1.97042e-51
NZ_CP052070.1\|WP_011001309.1\|2314424_2315354_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.22847e-92
NZ_CP052070.1\|WP_011001311.1\|2313231_2313933_-\|haloacid-dehalogenase-type-II	gnl\|CDD\|130495	TIGR01428, Haloacetate_dehalogenase, 2-haloalkanoic acid dehalogenase, type II. Catalyzes the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids. Belongs to the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), class (subfamily) I. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.	1.61219e-91
NZ_CP052070.1\|WP_016722033.1\|2309109_2309379_+\|acyl-CoA-binding-protein	gnl\|CDD\|226731	COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism].	2.01415e-46
NZ_CP052070.1\|WP_011001297.1\|2329712_2330696_-\|CysB-family-HTH-type-transcriptional-regulator	gnl\|CDD\|237172	PRK12683, PRK12683, transcriptional regulator CysB-like protein; Reviewed.	0
NZ_CP052070.1\|WP_011001296.1\|2330730_2331849_-\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.25082e-167
NZ_CP052070.1\|WP_021154828.1\|2325771_2327016_-\|sensor-histidine-kinase	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	8.93532e-90
NZ_CP052070.1\|WP_038937772.1\|2311567_2313148_-\|malate-synthase-A	gnl\|CDD\|236432	PRK09255, PRK09255, malate synthase; Validated.	0
NZ_CP052070.1\|WP_016722040.1\|2322186_2322600_-\|gamma-glutamylcyclotransferase	gnl\|CDD\|225016	COG2105, COG2105, Uncharacterized conserved protein [Function unknown].	8.89773e-29
NZ_CP052070.1\|WP_021154825.1\|2323126_2324872_-\|thiamine-pyrophosphate-binding-protein	gnl\|CDD\|181285	PRK08199, PRK08199, thiamine pyrophosphate protein; Validated.	0
NZ_CP052070.1\|WP_016722037.1\|2315996_2317301_-\|isocitrate-lyase	gnl\|CDD\|237893	PRK15063, PRK15063, isocitrate lyase; Provisional.	0
NZ_CP052070.1\|WP_020371745.1\|2315430_2315865_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	5.66819e-31
NZ_CP052070.1\|WP_011001303.1\|2322592_2323099_-\|ribonuclease-E-activity-regulator-RraA	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	1.43722e-96
NZ_CP052070.1\|WP_021154817.1\|2307695_2308229_-\|ribosomal-protein-S18-alanine-N-acetyltransferase	gnl\|CDD\|273701	TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase. Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR\|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database. [Protein synthesis, Ribosomal proteins: synthesis and modification].	1.1062e-41
NZ_CP052070.1\|WP_016722045.1\|2327015_2327309_-\|2TM-domain-containing-protein	gnl\|CDD\|379083	pfam13239, 2TM, 2TM domain. This short region contains two transmembrane alpha helices that are found associated with a wide range of other domains. This domain may be involved in cell lysis or peptidoglycan turnover.	3.19434e-14

>NZ_CP052070.1|WP_016722037.1|2315996_2317301_-|isocitrate-lyase
MSRELEVKALQQEWDTNPRWKGIKRGYSAQDVVRLRGSLQIEHTLARRGAEKLWTLMNSEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANSNGEMYPDQSLYSVDSVPKVVKRINNTFQRADQIQWSEGKDDVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTREAVSKLVAARLAADVMGVPTVLIARTDAEAADLLTADVDDNDRPFCTGERTVEGFYRTKPGLQQAIARGLAYADYADLVWCETGKPDLEYAKKFAEAIHAKFPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARNQMSAFVELQEAEFAAAEKGFTAVKHQREVGTGYFDAVTQTIERDASTTALKGSTEDAQFFEEKAHAKKVA
>NZ_CP052070.1|WP_020371745.1|2315430_2315865_+|universal-stress-protein
MFQHILIPTDGSELSRKAVAGALDFAKTLGARLTAYTCLEEYPYTPFSEIVVETPQAFKERVEAQARVVLKDVEDTARAAGIDCDTDMSCFAVPYMGIIDAAERHGCDVIFMASHGRRGLAGLLLGSETQKVLTHTAIPVIVYR
>NZ_CP052070.1|WP_011001309.1|2314424_2315354_+|LysR-family-transcriptional-regulator
MAHFKQLETFVAVATRGSLSAAAAAEGVAPAIIGRRIDALEERLGVKLLVRTTRRITLTFEGSAFLEDCQRILNDLHNAEASVSAGGVKASGHLRVTAPAGFGRRHVAPMVPDFLAAHPDVSITLDLGDRIVDLVNEGFDCAIRLGDLPDSSLVSIRLWENRRVVVAAPAYLERRGRPEQLEQLAGHNCLAFGASANVQRGWVFQQGGKTVTVKVGGTMECTDGAVLREWCLQGHGLAWRSWWEVGHDIATGRLVTVLDAFEAPPIGIHAVFPQRKHLPLRVRLLIDFLKNTYGNPAYWRRADPTLLTD
>NZ_CP052070.1|WP_011001311.1|2313231_2313933_-|haloacid-dehalogenase-type-II
MTSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQARQSMR
>NZ_CP052070.1|WP_038937772.1|2311567_2313148_-|malate-synthase-A
MELTLPQGMEIKAEILPAYEDILTPEALALVARLHRAFEPRRQQLLAERAERAKRLDAGERPDFLPETRHIREGDWTIAPIPPALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYKLNDKIATLQVRPRGWHLDEKHVTVDGQRVSGGIFDFALFLFHNAREQLARGAGPFFYLPKMESHLEARLWNDVFIAAQDALGLPRGTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDQNFCLADRAKVTMTSPFMRAYALLLLKTCHKRNAPAMGGMSALIPIKNDPEKNAIAMQGIINDKKRDATDGYDGGWVAHPGLVEAAMKEFVDVLGDAPNQIGKQRPDVNVAAADLLNFQPEQPITEAGLRMNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAELVRKLIPEELAKVKADGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEL
>NZ_CP052070.1|WP_011001313.1|2310990_2311461_-|DUF1857-family-protein
MRFEHLVEVNDPLNPLMDALTLNQIWQGLVLRVLEPTEFVEGLDEGIITARGEGWVERELRFGKARIQDRVTLEPHQRVTYTTAATGEHAGGSLTMTIETNEANAAFIRFVYDTTLPSADETGDTRYAEIVKSAYREADIDTVRRIREFAAIGRLG
>NZ_CP052070.1|WP_021154819.1|2309430_2310894_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MATFTPTLETLRARHGERFKWLVLFTLTVGAVSSIISATIVNVAIPDLSRHFVLGQERAQWVSASFMVAMTLAMLLTPWLLLRFGLRRTFIGALLLLGVGGLVGGLSPTYGVMIAMRVVGGVAAGIMQPLPNILILRVFPEREQGKAFGLFGFGVVLAPALGPSLGGFLVELFGWRSIFFVVVPFTLLGWAMARRFMAINSSMAGEPKPLDWRGLLLVGAATVALLNGLVELHADATRGVALMAVSAVCLAVFLFWQRRVESPLLDLRLFSYRQFAMGAVVAFIYGAGLYGSTYLLPVYMQVALAYTPSSAGLVLLPPGLALAATIVVAGRLTSRIEPYRLVSFGLAALAVSFLLMTTNTRATGYLLLIGIAAIGRVGLGFVLPSLSLGAMRGVDFTLIPQGSSAVNFLRQLGGAIGVSATGIFLQWRLAARGIGAVGGVAVDPEARIVACDETFVFLGVLCALAVAAAWRMRRREPAAVVSAGVGP
>NZ_CP052070.1|WP_016722033.1|2309109_2309379_+|acyl-CoA-binding-protein
MSDLQTRFEQAQTDVKSLSERPSNMTLLRLYALFKQGSEGDAHGDKPGFTDIVGRYKYEAWAGLKGLSQDDARQKYIDLVEELKSGATT
>NZ_CP052070.1|WP_021154818.1|2308225_2308957_-|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MPWILAFDTSTEFCSVALGDGTRTLFRHEHTGARSSSRVLPAAGELLAEAGIALGDCAAIAFGAGPGSFTGLRTACGVAQGLAFGAGLPVVPVNSLMACAEQTRAALPVGTAVTVALDARMDECYWASFVPVAEDASGWHALSAVQVSAPQAVAPPQQPYWLAGNAAAVFGDRLAAATGAAAVLPDVAPHAREIVTLGLRLLAAGHTVRPEDAAPLYVRDKVALTIEERQAVQQAKAAAGARA
>NZ_CP052070.1|WP_021154817.1|2307695_2308229_-|ribosomal-protein-S18-alanine-N-acetyltransferase
MSQVQVDRALAGLIVRAPLPAGWRAERMSALDVAAVAAVEQAAFAFPWSRGNFEDSLKSGHLGIVLRDGGNQVAGYLILMPVVDEMHLLNVTVAPAWQRQGLGRWLLRAAQALTLAHGFASLLLEVRPSNTGAIALYRRVGFAEIGRRKRYYPAENNTREDALVMRIACEAGGVEAA
>NZ_CP052070.1|WP_016722039.1|2320146_2322009_-|GALA-protein
MVSRIPTGNRGQGNGIEQSASSHATEATPWLGVNLPYGHWLPSSARSVVSRASSLLGGLANFRWGGPSASARPAPNIRSAAIAPAQQTLPPELWQQIATLAGARPRRAMREVSLELRNASRAVVTHLTISDPAMFRQLSLYPALKSVRFKGALTLEALKALPPTLEHLEIGRCTGSAISAEGLAHLAAMPLKSLNLNGIEIGVEGARLLATSTSLASLSLMGCDIGDRAATALAASSSIQCLYLSVNRIGRDGAQALAGAPLVSLNLHNNEIGNEGARALATSRTLTSLDVSNNGVGNAGAEAFAGNTVLKQLSLAGGMISGDGAQALADNKSLTDLDLSNNRLGDAGAQALADSESFVSLKLGGNEIGADGAEALARNVVLQSLNLSYNPIGFWGVNALGRAKLRKLDLCACAIDSDGASALARNTSLASLYLGSNRIGDDGARALAKNSTLTLLNLSGNNIHAVGAQALASNDSLITLDLSRNGIGDDGTAALACHPRLTSLNLSRNQIGSTGAQQLAKSATLAELDLSENRIGPEGAEALARSTVLTTLNVSYNAIGEAGARALAESVSLTSLDARRNGIGEGGAKVLEANTRITGTPQNPNFLAEDVPRPDVRWRD
>NZ_CP052070.1|WP_016722040.1|2322186_2322600_-|gamma-glutamylcyclotransferase
MTEAIHVFAYGTLRAGEANDLRVAASRRGIAEPKLIGHATLHGRLYDFGAYPGLVPDPTGTAVRGDVYRIDPGLVPVLDTIEAVYPGGEALFLRETHTVMLGSEPLDCIVYPVSAGQVAGRHVITGGDWVAYRLARG
>NZ_CP052070.1|WP_011001303.1|2322592_2323099_-|ribonuclease-E-activity-regulator-RraA
MTTMMIPVTDLCDAHEDQLASGAVRVLAPVFRSFGARAAFAGPAATLKVFEDNGLVRAMLEQPGEGRVLVVDGGGSLRCALVGGNLAKLAEDNGWEGVLVNGCVRDTRELAACNVGVHALAAHPRKSFKKNQGERDIGVQMPGAYIHPGEWIYGDEDGVLVSRERLHD
>NZ_CP052070.1|WP_021154825.1|2323126_2324872_-|thiamine-pyrophosphate-binding-protein
METAVARPVSTGPTDSTGSGSRPVPRHGGQILVDALIAHGTDLAFGVPGESYLAVLEGFYQRRDRARFIVCRQEGGAATMADAHGKLTGRPGIVFCTRGPGATNASIGVHTAFQDSTPLILFIGQVGRDCVDREAFQEIDYRRMFGQMAKWVAQIDSVERIPEYIARAFQTATAGRPGPVVLALPEDMLTEVATVADVPPMPRAMAWPAPHDLARLKALLGRAERPLVLLGGAGWTPQAAARLQAFAERWRLPVGCVFRRQDLFDNRHPNYAGDVGIAINPKLAARVREADVVLAIGTRLGEMATSGYTLFDVPRPRQTLIHVHAGAEELGRVYQADLMIHAAMPAIAEALDSVAPDAPPRWQAWTEAAHADYLANIAPPPFAGRGIDLARAMQWLRERLPRNAILTNGAGNYATWLHRFYQYGPLAAGSRTQLAPTSGAMGYGAPAAVAAKIACPQTPVICLAGDGCFLMNGQELATAMQYDAPVIFIVVNNGMYGTIRMHQERAYPEHVSGTELRNPDFAALARAYGAEGHTVRSLEGFQAAVEAALAAPVATVIEVQTDPEIISPRATLQSLRAQARG
>NZ_CP052070.1|WP_021154828.1|2325771_2327016_-|sensor-histidine-kinase
MRDRPRFDPATPSSKIGRMLANVSLPPLAECLRIAMRWLRAFAWIVAINTGIAAVLAFGIKPDDTFWHDLVYSQAIGLSMWLLIDIPRHLLWGNGPPSRRVLPWIVVAAVLIGVPFGQWVARRILCTGDQPWRADSLRMSFIIAMLAALGAMYFYWSRGKLATLQRQAALDALEREEAEKQVVRAQLMALQAQIEPHFLFNALAHVDVLIARDPAGARRLLQHLIGFLRTSLAHARAEQCTLAQEFALLRAYLDIQALRFGARLRFSLALDDAIAGLVVPPMLIQPLVENAVVHGIEPSREGGTIALSARREGDRLRLEVRDTGIGFGRDAAPGKGSGMGLTHVRERLARLFDADARLTIAETMPHGVTVTVELPLAHDAAGADASGAAVPQWRCRFSRPAVAPALAPRAPAGT
>NZ_CP052070.1|WP_016722045.1|2327015_2327309_-|2TM-domain-containing-protein
MSATTFPASDDAALLHRARRRAGARMGLRIHLLAFLAVNLMLAAMALSRGQSWFIWPLLGWGVGLAAHGLGLAWALGSGYRRLVDRELARLRNQAGR
>NZ_CP052070.1|WP_016725893.1|2327506_2329564_-|type-III-effector-protein
MPTRVPPPTLGRSHPVTGAASTATSTATTATRSGPATAPAPGRSREGLLAELPTGRTARTPSVSAAGAHAGRPAWNVQGAIEAMAALSPEREKRLFKKSASPQYRYAKGLTAEQRGQLESALEQRFRNPAAPAEARDSALAMWLSVQQARLRTHTAGHRNHHNLEQFQLAALSVPIPLLALGYRRQRRRYYSSPLRPEYRTAFNNFMRVIGDPSLSEAVRQTVAQRLEYHRRSEETIARHERQLLGEHGVMGLAESGYQIGTNYDHVNLTALEREAVVESRGSGVPPALHIQALQTERSRVESGALRHQWLTRELRDAQARAGQGGAVAGSAGPSSVRQVDAAESSAAAARLRRDTANDIRRLRRPLAAEIKQWLKLADMKPLPNPKAFDNELYANAFARLLERRRPLSLISYFARWDPVVVDGAKVIQAIAKDANLRKEVFAAAETALGTCGDNVADGFANIVTMVDTHQLVDDVRSGKLDQPALEAWGRQRYRLDSLITEVNQWMASRRGHEGLPVTMTERRVAREPLETMLHAKVALKTVLDLPKNLPSSMRHRLASALKPDDLKRLAETVQAKEADPVELARYLLSNDAWRGAMKALHPAAFAALGKRFAPEKDALAKEIPPQPTDPEGLEFLDERMAYAERTDAFTQKCRAAEDTLLLSLAGRYALVPAVVGAGPSQGSR
>NZ_CP052070.1|WP_011001297.1|2329712_2330696_-|CysB-family-HTH-type-transcriptional-regulator
MNFQQLRSIREAVRRQFNLTEVANALYTSQPGVSRQIRELEDELGVEIFERYGKRLTGLTEPGREIVRIVERLLLEAENLRQAGEEFSGRQSGRLTVATTHTQARYALPKVVQAFRKAYPHVTLALQEASPSHIVELLLTGQADIGVATEAVASEPGLTSFEAYRWRHVLVVSPDHPLTKNPLPALEDVAQYPLITYDAGFTGRRNIDAAFAGAGLQPEIVLTAMDADVIKTYVALDVGVGIIASMAYDGRKDDNLVCIGADHLFEPNTTRVAVRRGAYLRGYAHDFIGMFAPHLSREAVAEAVASTVVAQPARPALVASPRQTLAA
>NZ_CP052070.1|WP_011001296.1|2330730_2331849_-|sulfate-ABC-transporter-ATP-binding-protein
MSIQVQHVTKRFGNFVALDDVSLAFRQGELTALLGPSGCGKTTLLRIIAGLEHADAGTILLNGEDASDRHVRERQVGFVFQHYALFKHMTVFENVAFGLRVKPRAQRPSEAQIRAKVKALLELVQLDWLAERYPPQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDDLHVTSLFVTHDQEEALEVADSVVLMNRGQVEQVGSPDAVYNTPATPFVYGFLGNVNLFHGRLEAGEGGSVLHVGETALSVPPGGVDASRADQAVAFVRPHEIDLERYAPGAEGIPVTLRRALTLGAVAQLELERTDSDDIIEVSLPIERFRAQGLREGETLVVRPRAIRVFAQGQGSEHAAAAQAAA
>NZ_CP052070.1|WP_016722048.1|2331845_2332826_-|sulfate-ABC-transporter-permease-subunit-CysW
MAATVSRQPGQAPAAARRGATAEAAWVRAALILVSFAFLALFLFVPLASVFYEALRKGLDVYWAALAEPDALSAITLTLSVAAIAVPLNVVFGVAAAWAIAKFEFRGKNLLLTLIDLPFSVSPVIAGLVYVLLFGAQGWFGSALSAHDFKVIFAVPGIVLATVFVTFPFVARELIPLMQAQGSEEEEAAIVLGASGWQTFFRVTLPKIKWGLLYGVILCNARAMGEFGAVSVVSGHIRGLTNTMPLHVEILYNEYDFAAAFAVASLLTLLALVTLALKTLVEWRSRRELADADAGVGEGPGRHAAPQPLSSHPHVRVQSPLEGSAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP052070_1	1.1\|2319629\|57\|NZ_CP052070\|CRISPRCasFinder	2319629-2319685	57	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1200220-1200276	0	1.0

1. spacer 1.1|2319629|57|NZ_CP052070|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 0, identity: 1.0

tgggaagcgctgttggcggcgcgcccggacggggcgccctgctccggcagcggaggc	CRISPR spacer
tgggaagcgctgttggcggcgcgcccggacggggcgccctgctccggcagcggaggc	Protospacer
*********************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

215325 : 248278

Acidithiobacillus_phage(56.25%)

transposase,head,terminase,capsid,portal

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064047878.1\|215325_215802_-	hypothetical protein	K4I1C7	Acidithiobacillus_phage	2.2e-40	53.2
WP_016722451.1\|215798_216173_-	hypothetical protein	K4HZX2	Acidithiobacillus_phage	3.2e-42	65.4
WP_064047877.1\|216169_217558_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	8.1e-216	81.4
WP_016722453.1\|217554_218004_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	8.8e-55	71.6
WP_016722454.1\|218306_218714_-	hypothetical protein	NA	NA	NA	NA
WP_086005097.1\|218801_219951_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.9e-95	60.7
WP_016722457.1\|219967_220720_-	hypothetical protein	NA	NA	NA	NA
WP_016722458.1\|220879_223117_-	hypothetical protein	K4I1D0	Acidithiobacillus_phage	7.0e-286	65.7
WP_016722459.1\|223166_223628_-	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	2.4e-47	64.7
WP_173877469.1\|223856_224120_+	DNA-binding protein	K4I3X3	Acidithiobacillus_phage	1.1e-20	75.4
WP_016722461.1\|224130_224613_+	hypothetical protein	K4HZ96	Acidithiobacillus_phage	1.4e-45	59.4
WP_038962121.1\|224609_225470_+	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	3.4e-108	68.6
WP_038962122.1\|225466_226108_+	hypothetical protein	K4ICM8	Acidithiobacillus_phage	3.0e-80	73.3
WP_038962123.1\|226115_226592_+	hypothetical protein	K4I3X7	Acidithiobacillus_phage	8.7e-53	65.6
WP_071893031.1\|226591_227329_+	hypothetical protein	K4HZA0	Acidithiobacillus_phage	4.9e-111	77.0
WP_016725337.1\|227325_227586_+	DNA-binding protein	K4I1D6	Acidithiobacillus_phage	1.4e-17	76.8
WP_021154677.1\|227582_229871_+	bacteriophage-related protein	K4HZY1	Acidithiobacillus_phage	8.4e-287	63.2
WP_016725339.1\|230001_230466_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	1.0e-53	67.6
WP_011003115.1\|230467_230677_+	hypothetical protein	NA	NA	NA	NA
WP_016725340.1\|230669_231053_+	hypothetical protein	NA	NA	NA	NA
WP_016725341.1\|231107_231374_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_011003112.1\|231373_231673_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_071893036.1\|232223_233624_+	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	1.3e-165	62.8
WP_071893040.1\|233620_234841_+	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	2.7e-191	80.7
WP_016723619.1\|235020_235986_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_071893043.1\|236061_236427_-	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	2.9e-32	58.8
WP_016725347.1\|236594_236789_+	hypothetical protein	NA	NA	NA	NA
WP_016725348.1\|236950_237319_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	3.8e-16	45.0
WP_016726852.1\|237473_237662_-	hypothetical protein	K4HZY7	Acidithiobacillus_phage	1.2e-13	66.0
WP_016725351.1\|237783_238278_-	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	2.4e-21	56.3
WP_011000804.1\|238367_238640_-	hypothetical protein	NA	NA	NA	NA
WP_038962858.1\|238733_239270_+	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	4.2e-72	79.8
WP_071893046.1\|239269_241237_+\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	85.6
WP_071893050.1\|241280_241790_+	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	1.3e-25	47.1
WP_064047640.1\|241800_242193_+	hypothetical protein	NA	NA	NA	NA
WP_020833008.1\|242193_242415_+	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	1.3e-11	57.5
WP_069079297.1\|242414_243962_+\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	7.3e-149	57.1
WP_023470378.1\|243971_245222_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	2.4e-62	45.0
WP_021154688.1\|245231_245609_+\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	6.1e-25	49.6
WP_021154689.1\|245617_246622_+\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	2.5e-110	67.2
WP_021154690.1\|246624_246927_+	hypothetical protein	NA	NA	NA	NA
WP_016727774.1\|246932_247379_+	hypothetical protein	NA	NA	NA	NA
WP_058908386.1\|247504_248278_+	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	3.1e-47	43.6

DBSCAN-SWA_2

253306 : 335481

Ralstonia_phage(33.33%)

tail,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071893060.1\|253306_257410_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.7e-27	29.1
WP_071893063.1\|257415_257811_+	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	2.9e-30	52.3
WP_071893067.1\|257797_258370_-	rloe protein	NA	NA	NA	NA
WP_071893071.1\|258399_261990_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.6
WP_071893075.1\|262012_263179_+	hypothetical protein	NA	NA	NA	NA
WP_071893078.1\|263182_263665_+	hypothetical protein	A0A0M4TU90	Ralstonia_phage	1.5e-12	42.7
WP_071893082.1\|263661_264060_+	hypothetical protein	NA	NA	NA	NA
WP_071893085.1\|264064_265909_+	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	4.5e-105	45.9
WP_016724634.1\|265918_266143_+	hypothetical protein	NA	NA	NA	NA
WP_016724633.1\|266210_266501_+	membrane protein	K4I011	Acidithiobacillus_phage	2.4e-13	48.8
WP_058908401.1\|266497_266974_+	hypothetical protein	K4ICR8	Acidithiobacillus_phage	6.4e-72	84.8
WP_071893089.1\|266970_267432_+	lysozyme	K4I410	Acidithiobacillus_phage	1.7e-66	81.0
WP_016723628.1\|267499_267799_+	hypothetical protein	NA	NA	NA	NA
WP_028852787.1\|267861_268200_-	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_016723616.1\|277486_277846_+	hypothetical protein	NA	NA	NA	NA
WP_155773148.1\|277970_278705_+	hypothetical protein	NA	NA	NA	NA
WP_071893092.1\|279465_282006_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.7e-17	30.8
WP_071893096.1\|282017_283769_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_071893100.1\|283781_284627_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_071893102.1\|284824_285916_+	DUF746 domain-containing protein	NA	NA	NA	NA
WP_071893105.1\|286637_287459_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_016724611.1\|287608_289126_-	ATP-binding protein	NA	NA	NA	NA
WP_071654022.1\|289351_290176_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_016725373.1\|290201_290537_-	DUF861 domain-containing protein	NA	NA	NA	NA
WP_016725374.1\|290567_291185_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_016725375.1\|291221_291665_-	cyanase	NA	NA	NA	NA
WP_016725376.1\|291806_293141_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	6.7e-10	21.8
WP_019718995.1\|293461_294826_+	amidohydrolase family protein	NA	NA	NA	NA
WP_020371902.1\|295194_295695_+	hypothetical protein	NA	NA	NA	NA
WP_021156161.1\|296205_298011_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011003055.1\|298189_298768_-	adenylyl-sulfate kinase	A0A2P1ELS9	Moumouvirus	4.5e-19	38.7
WP_016724441.1\|298764_299667_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_016724440.1\|299679_300843_-	glycosyl transferase family 8	NA	NA	NA	NA
WP_016724439.1\|300839_302942_-	sulfotransferase family protein	NA	NA	NA	NA
WP_016727280.1\|303104_306137_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_016724436.1\|306301_306997_+	response regulator transcription factor	NA	NA	NA	NA
WP_016724435.1\|307062_308994_+	sensor histidine kinase	NA	NA	NA	NA
WP_016724434.1\|309320_310451_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_016724433.1\|310491_311769_-	TIGR03862 family flavoprotein	NA	NA	NA	NA
WP_011003046.1\|312054_312891_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_016725726.1\|313383_314712_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011003045.1\|314764_314968_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.1e-16	63.6
WP_016724432.1\|315295_315502_+	hypothetical protein	NA	NA	NA	NA
WP_016724430.1\|316089_317268_+	antibiotic hydrolase	NA	NA	NA	NA
WP_016724429.1\|317704_318541_+	cytochrome c	NA	NA	NA	NA
WP_016721735.1\|319251_320217_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|320213_320363_+	hypothetical protein	NA	NA	NA	NA
WP_016724428.1\|320600_322091_+	hypothetical protein	NA	NA	NA	NA
WP_038938383.1\|322087_322930_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_021154949.1\|323113_325237_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011003039.1\|325977_326409_-	hypothetical protein	NA	NA	NA	NA
WP_016724425.1\|327453_327795_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_173651675.1\|327941_328385_+	hypothetical protein	NA	NA	NA	NA
WP_071893108.1\|328384_329533_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011003035.1\|329660_330053_+	hypothetical protein	NA	NA	NA	NA
WP_021154951.1\|330383_331289_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_011003033.1\|331342_332722_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.8e-13	32.4
WP_016727287.1\|333037_333637_+	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_016724421.1\|333895_334450_+	hypothetical protein	NA	NA	NA	NA
WP_038938388.1\|334521_335481_+\|protease	serine protease	A0A0F6R5W6	Sinorhizobium_phage	1.3e-07	30.0

DBSCAN-SWA_3

868972 : 922446

Lactobacillus_phage(16.67%)

coat,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016725726.1\|868972_870301_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011002610.1\|870813_871140_+	hypothetical protein	NA	NA	NA	NA
WP_011002609.1\|871233_871518_+	hypothetical protein	NA	NA	NA	NA
WP_020832642.1\|872601_872739_+	hypothetical protein	NA	NA	NA	NA
WP_011002608.1\|872856_873174_+	hypothetical protein	NA	NA	NA	NA
WP_011002607.1\|873326_873623_+	hypothetical protein	NA	NA	NA	NA
WP_016723697.1\|873719_874580_+	transglutaminase family protein	NA	NA	NA	NA
WP_016723696.1\|874596_874857_-	hypothetical protein	NA	NA	NA	NA
WP_011002605.1\|876202_876706_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_011002604.1\|876755_877259_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_016723694.1\|877377_878097_+	molecular chaperone	NA	NA	NA	NA
WP_016723693.1\|878146_880411_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_016723692.1\|880428_880917_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_016723691.1\|880986_881529_+	hypothetical protein	NA	NA	NA	NA
WP_016723690.1\|882134_883079_+	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	4.0e-09	23.9
WP_016723689.1\|883297_883546_+	hypothetical protein	NA	NA	NA	NA
WP_011002597.1\|883604_883847_+	hypothetical protein	NA	NA	NA	NA
WP_003271865.1\|884006_884507_+	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	2.1e-20	36.2
WP_069079120.1\|884580_885456_+	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_011002595.1\|885452_885731_-	hypothetical protein	NA	NA	NA	NA
WP_011002594.1\|885752_886577_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_011002593.1\|886611_887334_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_011002592.1\|887458_888502_+	type IV pilus twitching motility protein PilT	NA	NA	NA	NA
WP_011002591.1\|888554_889694_+	PilT/PilU family type 4a pilus ATPase	NA	NA	NA	NA
WP_016723685.1\|889888_890329_+	type IV pilin protein	NA	NA	NA	NA
WP_016723684.1\|890332_890821_+	GspH/FimT family pseudopilin	NA	NA	NA	NA
WP_011002588.1\|890817_891408_+	type IV pilus modification protein PilV	NA	NA	NA	NA
WP_016723683.1\|891404_892433_+	PilW family protein	NA	NA	NA	NA
WP_011002586.1\|892436_892973_+	pilus assembly PilX N-terminal domain-containing protein	NA	NA	NA	NA
WP_016723682.1\|893004_896217_+	pilus assembly protein	NA	NA	NA	NA
WP_016723681.1\|896312_896810_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	3.3e-26	40.0
WP_016723680.1\|896826_897525_-	YafY family transcriptional regulator	NA	NA	NA	NA
WP_016723679.1\|897567_898047_-	cupin domain-containing protein	NA	NA	NA	NA
WP_016723678.1\|898097_898493_-	VOC family protein	NA	NA	NA	NA
WP_020832616.1\|898651_899374_-	LrgB family protein	NA	NA	NA	NA
WP_016723676.1\|899370_899748_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_069079119.1\|899799_901047_-	glycolate oxidase subunit GlcF	NA	NA	NA	NA
WP_069079118.1\|901056_902175_-	glycolate oxidase subunit GlcE	NA	NA	NA	NA
WP_028853584.1\|902185_903679_-	FAD-binding protein	NA	NA	NA	NA
WP_016723672.1\|903849_904740_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011002574.1\|904750_906169_-	FAD-binding protein	NA	NA	NA	NA
WP_020832612.1\|906289_906847_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_016723670.1\|906919_907816_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_016723669.1\|908100_908436_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011002570.1\|908559_909639_-	3-deoxy-7-phosphoheptulonate synthase AroG	A0A2I6UFP9	Klebsiella_phage	1.1e-76	45.0
WP_020832609.1\|910031_911492_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_028860942.1\|911519_912389_-	carbon-nitrogen hydrolase family protein	M1H5W0	Paramecium_bursaria_Chlorella_virus	6.3e-09	25.3
WP_071895426.1\|912394_916675_-	TIGR02099 family protein	NA	NA	NA	NA
WP_071895427.1\|916854_919722_+	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
WP_011002565.1\|919718_920339_+	rhombosortase	NA	NA	NA	NA
WP_020832604.1\|920394_922446_-\|protease	MprA protease, GlyGly-CTERM protein-sorting domain-containing form	A0A1B0T6A2	Bacillus_phage	6.1e-10	34.7

DBSCAN-SWA_4

939452 : 949591

Hokovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021155204.1\|939452_941414_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-149	50.8
WP_011002544.1\|941548_942691_+	molecular chaperone DnaJ	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	2.9e-22	32.7
WP_019718314.1\|942726_944607_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	A0A0B5J984	Pandoravirus	6.1e-57	37.3
WP_011002542.1\|944562_945249_-	energy-coupling factor ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.5e-13	27.2
WP_016724068.1\|945256_945964_-	ABC transporter permease	NA	NA	NA	NA
WP_016724069.1\|945975_946800_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.4e-34	31.3
WP_016724070.1\|946856_947501_-	deoxynucleoside kinase	M1IA15	Paramecium_bursaria_Chlorella_virus	8.3e-06	27.3
WP_003271964.1\|947534_948044_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_021155205.1\|948043_949591_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.6e-23	33.6

DBSCAN-SWA_5

1560152 : 1637957

Ralstonia_phage(44.23%)

tRNA,transposase,integrase,head,terminase,tail,plate,portal,capsid,holin

attL 1565895:1565914|attR 1650115:1650134

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016727020.1\|1560152_1560977_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_019718613.1\|1560973_1561678_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_016722990.1\|1561773_1562967_+	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_016727018.1\|1562971_1563784_+	site-specific DNA-methyltransferase	R4THJ7	Phaeocystis_globosa_virus	6.5e-32	37.0
WP_011001917.1\|1563798_1564596_+	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_011001916.1\|1564633_1565506_+	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_011001915.1\|1565587_1566886_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
1565895:1565914	attL	NA	NA	NA	NA
WP_021155237.1\|1566972_1567794_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_011001913.1\|1567866_1568364_+	CvpA family protein	NA	NA	NA	NA
WP_011001912.1\|1568458_1569994_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.0e-86	42.4
WP_020832236.1\|1570120_1570942_-	ABC transporter permease	NA	NA	NA	NA
WP_011001910.1\|1570965_1571931_-	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	1.6e-24	25.6
WP_003264057.1\|1572086_1572287_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_011001909.1\|1572709_1573201_+	phasin family protein	NA	NA	NA	NA
WP_011001907.1\|1573477_1573717_+	hypothetical protein	NA	NA	NA	NA
WP_011001906.1\|1573860_1574181_+	membrane protein	NA	NA	NA	NA
WP_021155235.1\|1574390_1575188_+	YdcF family protein	NA	NA	NA	NA
WP_011001904.1\|1575215_1575629_+	heme-binding protein	NA	NA	NA	NA
WP_011001903.1\|1575822_1576101_-	hemin uptake protein HemP	NA	NA	NA	NA
WP_011001902.1\|1576296_1576710_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_011001901.1\|1576719_1577451_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_019718620.1\|1577487_1578147_-	energy transducer TonB	NA	NA	NA	NA
WP_016725286.1\|1578657_1580973_+	ATP-binding protein	A0A0K1Y7P8	Apis_mellifera_filamentous_virus	5.2e-10	30.7
WP_011001897.1\|1581100_1581457_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016725285.1\|1581440_1582400_+	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_016725284.1\|1582445_1582787_-	DHCW motif cupin fold protein	NA	NA	NA	NA
WP_011001894.1\|1583249_1584536_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_011001893.1\|1584656_1585490_-	glutamate racemase	NA	NA	NA	NA
WP_016725283.1\|1585510_1587034_-	fumarate hydratase	NA	NA	NA	NA
WP_011001891.1\|1587213_1587753_-	TIGR00645 family protein	NA	NA	NA	NA
WP_021155233.1\|1587836_1588847_-	DMT family transporter	NA	NA	NA	NA
WP_016725281.1\|1589011_1590994_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.3e-78	37.4
WP_021155232.1\|1591015_1593082_+	cation acetate symporter	NA	NA	NA	NA
WP_016721870.1\|1594610_1595597_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_058907201.1\|1597513_1600174_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	0.0e+00	100.0
WP_016721870.1\|1600816_1601803_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_081049899.1\|1602340_1603102_+	hypothetical protein	A0A077KEQ4	Ralstonia_phage	1.9e-142	100.0
WP_058907204.1\|1603107_1605348_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	0.0e+00	100.0
WP_071895446.1\|1605414_1606500_-\|portal	phage portal protein	A0A077K9Q8	Ralstonia_phage	1.4e-210	99.4
WP_071895447.1\|1606496_1608278_-\|terminase	terminase ATPase subunit family protein	A0A077K8Q7	Ralstonia_phage	0.0e+00	98.5
WP_016721963.1\|1608421_1609261_+\|capsid	GPO family capsid scaffolding protein	A0A077K9W8	Ralstonia_phage	5.9e-145	95.0
WP_011001874.1\|1609314_1610331_+\|capsid	phage major capsid protein, P2 family	A0A077KEQ8	Ralstonia_phage	4.7e-189	100.0
WP_058907207.1\|1610327_1611050_+\|terminase	terminase endonuclease subunit	A0A077K804	Ralstonia_phage	4.4e-125	98.8
WP_058907235.1\|1611147_1611627_+\|head	head completion/stabilization protein	A0A077K9R2	Ralstonia_phage	1.0e-85	100.0
WP_011001871.1\|1611626_1611833_+\|tail	tail protein X	A0A077K8R0	Ralstonia_phage	1.8e-31	100.0
WP_015985092.1\|1611848_1612253_+\|holin	phage holin family protein	A0A077K9X1	Ralstonia_phage	2.8e-28	100.0
WP_071895448.1\|1612249_1612561_+\|holin	phage holin family protein	A0A077KER0	Ralstonia_phage	1.7e-49	100.0
WP_016727332.1\|1612557_1613364_+	DUF3380 domain-containing protein	A4PE36	Ralstonia_virus	4.2e-148	99.6
WP_058907209.1\|1613360_1613861_+	hypothetical protein	A4PE37	Ralstonia_virus	6.1e-81	98.2
WP_071895449.1\|1613857_1614304_+\|tail	phage tail protein	A0A077K8R3	Ralstonia_phage	3.6e-77	98.6
WP_058907236.1\|1614297_1614705_+	phage virion morphogenesis protein	A0A077K9X5	Ralstonia_phage	1.2e-55	85.8
WP_080606388.1\|1614876_1616112_+	DUF262 domain-containing protein	A0A0R6PKN1	Moraxella_phage	2.5e-11	27.5
WP_016721978.1\|1616104_1616881_+	hypothetical protein	NA	NA	NA	NA
WP_071895450.1\|1616997_1617615_+\|plate	phage baseplate assembly protein V	A4PE41	Ralstonia_virus	2.4e-111	96.1
WP_058907212.1\|1617611_1617959_+	GPW/gp25 family protein	A4PE42	Ralstonia_virus	3.0e-55	93.9
WP_069079171.1\|1617961_1618870_+\|plate	baseplate assembly protein	A0A077K9X9	Ralstonia_phage	5.0e-158	97.4
WP_071895451.1\|1618862_1619480_+\|tail	phage tail protein I	A0A077KER5	Ralstonia_phage	3.1e-103	98.9
WP_071895452.1\|1619484_1621149_+\|tail	phage tail protein	A4PE45	Ralstonia_virus	6.3e-308	95.8
WP_058907215.1\|1621161_1621914_+	hypothetical protein	A4PE47	Ralstonia_virus	6.7e-124	94.4
WP_058907216.1\|1621910_1622375_+	hypothetical protein	A0A077K8R9	Ralstonia_phage	1.5e-86	99.4
WP_058907217.1\|1622473_1623649_+\|tail	phage tail sheath protein	A0A077K9Y4	Ralstonia_phage	1.4e-224	98.7
WP_011001854.1\|1623680_1624190_+\|tail	phage major tail tube protein	A0A077KER7	Ralstonia_phage	8.3e-94	100.0
WP_058907237.1\|1624265_1624592_+\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	2.3e-49	98.1
WP_003267618.1\|1624588_1624690_+\|tail	GpE family phage tail protein	A0A077K821	Ralstonia_phage	2.7e-09	93.9
WP_071895453.1\|1624686_1627350_+\|tail	phage tail protein	A4PE52	Ralstonia_virus	0.0e+00	96.4
WP_058907219.1\|1627352_1627775_+\|tail	phage tail protein	A4PE53	Ralstonia_virus	8.8e-73	97.9
WP_058907220.1\|1627771_1628896_+	phage late control D family protein	A4PE54	Ralstonia_virus	7.5e-204	97.1
WP_071895454.1\|1629208_1629418_+	Com family DNA-binding transcriptional regulator	A0A1S5NPS9	Burkholderia_phage	2.4e-15	70.4
WP_016722215.1\|1629368_1630118_+	site-specific DNA-methyltransferase	A0A1S5NPU0	Burkholderia_phage	7.9e-93	67.2
WP_071895455.1\|1630830_1631181_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_051048313.1\|1631243_1631702_-	helix-turn-helix transcriptional regulator	K4NXA8	Burkholderia_phage	5.8e-22	52.3
WP_157798370.1\|1631760_1631958_+	hypothetical protein	NA	NA	NA	NA
WP_016722219.1\|1631984_1632176_+	hypothetical protein	E5E3U0	Burkholderia_phage	2.6e-08	50.9
WP_016722220.1\|1632204_1632399_+	hypothetical protein	A4PE59	Ralstonia_virus	1.3e-23	95.3
WP_028853260.1\|1632395_1632644_+	ogr/Delta-like zinc finger family protein	A4PE60	Ralstonia_virus	3.0e-41	98.8
WP_038961828.1\|1632758_1632992_+	hypothetical protein	A4PE62	Ralstonia_virus	9.5e-13	54.8
WP_016721654.1\|1632988_1633153_+	hypothetical protein	A4PE63	Ralstonia_virus	1.1e-15	81.5
WP_058907222.1\|1633149_1633356_+	hypothetical protein	A4PE64	Ralstonia_virus	4.3e-25	92.6
WP_016721678.1\|1633355_1633592_+	hypothetical protein	A4PE65	Ralstonia_virus	3.5e-39	98.7
WP_015985122.1\|1633584_1633797_+	hypothetical protein	A4PE66	Ralstonia_virus	6.4e-32	100.0
WP_058907223.1\|1633829_1636535_+	toprim domain-containing protein	A0A077K8T2	Ralstonia_phage	0.0e+00	99.8
WP_016721680.1\|1636531_1636747_+	AlpA family phage regulatory protein	A0A077K9Z8	Ralstonia_phage	2.4e-34	100.0
WP_038961838.1\|1636721_1637957_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A077KET4	Ralstonia_phage	8.1e-236	99.3
1650115:1650134	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1830246 : 1969806

150

Pseudomonas_phage(12.96%)

transposase,tRNA,integrase,head,terminase,protease,tail,plate,portal,capsid

attL 1840087:1840103|attR 1901705:1902920

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011001577.1\|1830246_1831227_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_011001578.1\|1831293_1832655_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_011001579.1\|1832750_1833935_+	acetyl-CoA C-acyltransferase family protein	NA	NA	NA	NA
WP_021154999.1\|1833939_1834647_+	hypothetical protein	NA	NA	NA	NA
WP_016721794.1\|1834689_1835904_+	cystathionine beta-lyase	NA	NA	NA	NA
WP_016721795.1\|1835931_1836789_-	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_016721796.1\|1836900_1838094_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_023470185.1\|1838128_1841560_-	transcription-repair coupling factor	NA	NA	NA	NA
1840087:1840103	attL	NA	NA	NA	NA
WP_043885765.1\|1841731_1842493_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
1840087:1840103	attL	NA	NA	NA	NA
WP_011001586.1\|1842489_1842996_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_011001587.1\|1843075_1843603_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_016721800.1\|1843661_1844210_-	peroxiredoxin	NA	NA	NA	NA
WP_016721801.1\|1844386_1845748_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_003267785.1\|1845785_1846508_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	1.4e-33	35.8
WP_021154996.1\|1846787_1847138_+	hypothetical protein	NA	NA	NA	NA
WP_071895468.1\|1847209_1848826_+	DUF1800 family protein	NA	NA	NA	NA
WP_016721804.1\|1848853_1850038_+	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_011001593.1\|1850038_1850911_-	presqualene diphosphate synthase HpnD	NA	NA	NA	NA
WP_016721806.1\|1851047_1852256_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_016721807.1\|1852322_1855442_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_071895469.1\|1855681_1856908_-\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	5.1e-113	55.0
WP_016721809.1\|1857065_1857260_-	hypothetical protein	W6MWX6	Pseudomonas_phage	8.0e-05	74.1
WP_016721810.1\|1857252_1857615_-	hypothetical protein	NA	NA	NA	NA
WP_071895470.1\|1857611_1859420_-	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	1.2e-163	47.4
WP_016721813.1\|1859416_1859656_-	hypothetical protein	NA	NA	NA	NA
WP_016721814.1\|1859652_1860177_-	hypothetical protein	A0A2D1GNL9	Pseudomonas_phage	4.8e-44	55.5
WP_071895471.1\|1860173_1860650_-	hypothetical protein	NA	NA	NA	NA
WP_016721816.1\|1860646_1861201_-	deoxynucleotide monophosphate kinase	A0A2H4J8A1	uncultured_Caudovirales_phage	2.8e-34	48.3
1860763:1860779	attR	NA	NA	NA	NA
WP_071895472.1\|1861253_1862105_-	DUF2303 family protein	I6WAZ8	Burkholderia_virus	1.6e-28	36.3
1860763:1860779	attR	NA	NA	NA	NA
WP_071091286.1\|1862137_1862482_-	hypothetical protein	C5IHK2	Burkholderia_virus	8.6e-10	36.5
WP_016721820.1\|1862532_1862739_-	hypothetical protein	NA	NA	NA	NA
WP_155773164.1\|1862735_1863362_-	hypothetical protein	NA	NA	NA	NA
WP_016721822.1\|1863358_1863739_-	hypothetical protein	NA	NA	NA	NA
WP_155773165.1\|1863747_1863903_-	hypothetical protein	NA	NA	NA	NA
WP_081369067.1\|1864065_1864554_-	DUF2335 domain-containing protein	NA	NA	NA	NA
WP_016721824.1\|1864522_1864765_-	hypothetical protein	NA	NA	NA	NA
WP_016721825.1\|1864866_1865739_-	LexA family transcriptional regulator	A0A0D4DBI5	Acinetobacter_phage	2.6e-18	35.6
WP_016721826.1\|1865821_1866046_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016721827.1\|1866272_1866782_+	hypothetical protein	NA	NA	NA	NA
WP_016721828.1\|1866774_1866999_+	hypothetical protein	NA	NA	NA	NA
WP_043945175.1\|1866995_1867280_+	hypothetical protein	NA	NA	NA	NA
WP_071895474.1\|1867276_1869703_+	hypothetical protein	A0A2D1GN57	Marinobacter_phage	1.3e-75	39.9
WP_155773166.1\|1870293_1870701_+	hypothetical protein	NA	NA	NA	NA
WP_155773167.1\|1870747_1871392_+	hypothetical protein	A0A0K1Y721	Rhodobacter_phage	2.0e-31	38.7
WP_016721870.1\|1871667_1872654_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_069079018.1\|1872768_1873275_+\|terminase	terminase small subunit	NA	NA	NA	NA
WP_071895476.1\|1873297_1875256_+\|terminase	phage terminase large subunit family protein	R9TMM4	Vibrio_phage	3.4e-127	42.6
WP_064048049.1\|1875268_1875490_+	hypothetical protein	NA	NA	NA	NA
WP_069079016.1\|1875491_1876937_+\|portal	phage portal protein	Q75QM9	Wolbachia_phage	3.9e-80	41.2
WP_069079015.1\|1877011_1879084_+\|head	Mu-like prophage major head subunit gpT family protein	B7SYD7	Stenotrophomonas_phage	2.2e-68	32.3
WP_071895477.1\|1879167_1879500_+	DUF2190 family protein	A0A2I7QRW1	Vibrio_phage	1.5e-06	38.7
WP_016721840.1\|1879499_1879808_+	hypothetical protein	NA	NA	NA	NA
WP_069079013.1\|1879804_1880383_+	hypothetical protein	NA	NA	NA	NA
WP_016721841.1\|1880403_1880634_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_069079012.1\|1880633_1882115_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0C4UQS0	Shigella_phage	2.0e-103	45.3
WP_020371381.1\|1882163_1882526_+\|tail	phage tail tube protein	NA	NA	NA	NA
WP_016721844.1\|1882525_1882855_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_069079011.1\|1882934_1884662_+	hypothetical protein	NA	NA	NA	NA
WP_071895631.1\|1884770_1885010_-	hypothetical protein	NA	NA	NA	NA
WP_071895478.1\|1885267_1886224_+	DNA circularization N-terminal domain-containing protein	Q8SBG8	Shigella_phage	2.4e-25	37.3
WP_016721735.1\|1886228_1887194_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155773168.1\|1887405_1887624_+	hypothetical protein	NA	NA	NA	NA
WP_071895480.1\|1887620_1888805_+	hypothetical protein	B5TK72	Pseudomonas_phage	1.1e-43	32.6
WP_081365199.1\|1888858_1889377_+\|plate	phage baseplate assembly protein	Q8HAB9	Salmonella_phage	5.8e-34	48.8
WP_069079008.1\|1889376_1889835_+	phage GP46 family protein	A0A2P9JZK5	Alteromonadaceae_phage	6.0e-27	47.4
WP_071895481.1\|1889836_1890889_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	1.5e-65	45.7
WP_071895482.1\|1890879_1891476_+	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_071895483.1\|1891472_1892672_+	hypothetical protein	O22004	Shigella_phage	8.4e-12	49.3
WP_016721856.1\|1892675_1893161_+	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_016721857.1\|1893284_1893776_+	glycoside hydrolase family protein	D5LH07	Escherichia_phage	3.0e-56	66.0
WP_071895484.1\|1893776_1894085_+	hypothetical protein	NA	NA	NA	NA
WP_069079003.1\|1894087_1894354_+	hypothetical protein	NA	NA	NA	NA
WP_069079002.1\|1894350_1894710_+	hypothetical protein	NA	NA	NA	NA
WP_016721915.1\|1894833_1895160_-	hypothetical protein	NA	NA	NA	NA
WP_071895485.1\|1896329_1897367_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_071895486.1\|1897803_1898808_+\|integrase	site-specific integrase	A0A0A0YR56	Pseudomonas_phage	1.7e-66	50.5
WP_016721863.1\|1898808_1899117_-	hypothetical protein	NA	NA	NA	NA
WP_016721865.1\|1899628_1900183_-	hypothetical protein	A0A2H4J8A1	uncultured_Caudovirales_phage	1.1e-33	46.4
WP_016721866.1\|1900202_1900418_-	hypothetical protein	NA	NA	NA	NA
WP_016721867.1\|1900423_1900576_-	hypothetical protein	NA	NA	NA	NA
WP_016721868.1\|1900572_1901013_-	hypothetical protein	NA	NA	NA	NA
WP_016721869.1\|1901009_1901384_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|1901842_1902829_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_080606383.1\|1903496_1904357_-	trypsin-like peptidase domain-containing protein	S5FV10	Shigella_phage	3.1e-16	30.4
WP_016721872.1\|1904636_1905332_-	hypothetical protein	A0A2H4J0J9	uncultured_Caudovirales_phage	6.8e-22	39.5
WP_071895489.1\|1905406_1905682_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016721873.1\|1905951_1906188_-	hypothetical protein	NA	NA	NA	NA
WP_016721874.1\|1906399_1906915_+	hypothetical protein	NA	NA	NA	NA
WP_016721875.1\|1906911_1907322_+	hypothetical protein	NA	NA	NA	NA
WP_016721876.1\|1907330_1907528_+	hypothetical protein	NA	NA	NA	NA
WP_071895490.1\|1907524_1908559_+	hypothetical protein	NA	NA	NA	NA
WP_071895491.1\|1908555_1908852_+	hypothetical protein	NA	NA	NA	NA
WP_071895492.1\|1908875_1909475_+	hypothetical protein	NA	NA	NA	NA
WP_016721879.1\|1909658_1910033_+	HNH endonuclease	Q38456	Bacillus_phage	3.1e-29	52.9
WP_049832880.1\|1910424_1910766_+	hypothetical protein	NA	NA	NA	NA
WP_016721881.1\|1910810_1912481_+\|terminase	terminase large subunit	C7BGG7	Burkholderia_phage	6.5e-204	61.3
WP_020371382.1\|1912482_1912641_+	hypothetical protein	NA	NA	NA	NA
WP_016721883.1\|1912637_1913861_+\|portal	phage portal protein	A0A1J0GUY8	Halomonas_phage	3.6e-159	68.8
WP_016721884.1\|1913868_1914480_+\|head,protease	HK97 family phage prohead protease	A0A1J0GUZ0	Halomonas_phage	2.1e-59	63.5
WP_071895493.1\|1914490_1915738_+\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	2.4e-126	56.6
WP_016721886.1\|1915771_1916095_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_016721887.1\|1916102_1916429_+\|head	phage head closure protein	NA	NA	NA	NA
WP_038961918.1\|1916431_1916935_+	hypothetical protein	I7GSL4	Xanthomonas_virus	2.4e-08	32.7
WP_016721889.1\|1916924_1917278_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_016721890.1\|1917341_1917995_+\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	1.4e-53	50.7
WP_016721891.1\|1918001_1918322_+	hypothetical protein	I6PDG2	Cronobacter_phage	1.9e-11	41.9
WP_016721892.1\|1918369_1918630_+	DUF1799 domain-containing protein	NA	NA	NA	NA
WP_071895495.1\|1918631_1921493_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	8.6e-87	35.7
WP_016721894.1\|1921495_1921834_+\|tail	phage tail protein	Q8W6T5	Burkholderia_virus	2.1e-21	47.7
WP_016721895.1\|1921830_1922508_+\|tail	tail fiber protein	D5LGZ0	Escherichia_phage	1.0e-30	50.6
WP_016721896.1\|1922513_1923110_+\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_071895496.1\|1923106_1923808_+\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	1.0e-78	62.4
WP_071895497.1\|1923809_1924520_+	C40 family peptidase	D6PG99	uncultured_phage	2.1e-71	55.8
WP_016721899.1\|1924523_1925117_+\|tail	tail assembly protein	Q8W6T1	Burkholderia_virus	2.3e-55	60.4
WP_038961924.1\|1925113_1925452_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_016721901.1\|1925444_1925708_-	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_016721902.1\|1925760_1928916_+	host specificity protein J	A4JX16	Burkholderia_virus	0.0e+00	55.9
WP_038961925.1\|1929252_1929909_+	hypothetical protein	Q7Y5J3	Xanthomonas_virus	3.1e-08	28.0
WP_038961926.1\|1929977_1930469_+	glycoside hydrolase family protein	D5LH07	Escherichia_phage	5.1e-56	67.1
WP_016721906.1\|1930469_1930778_+	hypothetical protein	NA	NA	NA	NA
WP_071895498.1\|1930780_1931050_+	hypothetical protein	NA	NA	NA	NA
WP_071895499.1\|1931046_1931406_+	hypothetical protein	NA	NA	NA	NA
WP_071895500.1\|1931533_1931860_-	type V toxin-antitoxin system endoribonuclease antitoxin GhoS	NA	NA	NA	NA
WP_071895501.1\|1932663_1932933_-	hypothetical protein	NA	NA	NA	NA
WP_071895502.1\|1932997_1934035_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_155773169.1\|1934235_1934469_+	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|1935194_1936181_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_071895503.1\|1937422_1939156_-	AAA family ATPase	NA	NA	NA	NA
WP_011001649.1\|1939697_1939892_+	hypothetical protein	NA	NA	NA	NA
WP_020832095.1\|1939963_1941937_+\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
WP_016721979.1\|1942191_1943541_+	trigger factor	NA	NA	NA	NA
WP_003267806.1\|1943570_1944224_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.8e-53	54.9
WP_011001652.1\|1944389_1945664_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.9e-135	58.9
WP_011001653.1\|1945834_1948255_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	4.8e-224	53.1
WP_003267811.1\|1948428_1948701_+	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	1.6e-19	57.3
WP_011001654.1\|1949123_1951070_+	SurA N-terminal domain-containing protein	NA	NA	NA	NA
WP_011001655.1\|1952573_1953266_-	signal peptidase I	NA	NA	NA	NA
WP_020832084.1\|1953342_1953963_-	arylesterase	NA	NA	NA	NA
WP_011001657.1\|1954036_1954747_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.4e-40	42.8
WP_021156048.1\|1954759_1956379_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_069078999.1\|1956437_1958033_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_011001660.1\|1958108_1958675_+	winged helix DNA-binding protein	NA	NA	NA	NA
WP_016724550.1\|1958812_1962922_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	4.4e-177	72.9
WP_139233351.1\|1963191_1963635_-	hypothetical protein	NA	NA	NA	NA
WP_011001663.1\|1963804_1963996_+	DUF1843 domain-containing protein	NA	NA	NA	NA
WP_016724551.1\|1964062_1964689_+	DUF1842 domain-containing protein	NA	NA	NA	NA
WP_011001665.1\|1964740_1965322_+	DUF1842 domain-containing protein	NA	NA	NA	NA
WP_016724552.1\|1965418_1966894_+	GDL motif peptide-associated radical SAM/SPASM maturase	NA	NA	NA	NA
WP_069079317.1\|1967447_1968581_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_071895632.1\|1968981_1969806_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

2153003 : 2160310

Ralstonia_phage(100.0%)

coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021155768.1\|2153003_2153435_-	DUF29 domain-containing protein	A0A0K2QQ08	Ralstonia_phage	1.2e-77	100.0
WP_074960868.1\|2153478_2154192_-	hypothetical protein	A0A097ZIG8	Ralstonia_phage	2.4e-62	61.8
WP_016723073.1\|2154325_2155471_-	zonular occludens toxin	E5F074	Ralstonia_phage	2.9e-219	99.7
WP_038962261.1\|2155481_2155802_-	DUF2523 domain-containing protein	E5F073	Ralstonia_phage	2.2e-44	99.0
WP_016038713.1\|2155798_2157196_-	hypothetical protein	E5F072	Ralstonia_phage	2.3e-210	100.0
WP_016038712.1\|2157340_2157550_-\|coat	major coat protein	E5F071	Ralstonia_phage	1.9e-20	100.0
WP_016038711.1\|2157546_2157786_-	hypothetical protein	E5F070	Ralstonia_phage	2.0e-37	100.0
WP_016038710.1\|2157785_2158058_-	hypothetical protein	E5F069	Ralstonia_phage	7.7e-46	100.0
WP_016038709.1\|2158057_2158375_-	hypothetical protein	E5F068	Ralstonia_phage	7.5e-53	100.0
WP_038938340.1\|2158378_2159512_-	replication initiation factor domain-containing protein	E5F076	Ralstonia_phage	2.8e-214	97.4
WP_043885700.1\|2159609_2159816_-	hypothetical protein	S6B968	Ralstonia_phage	5.6e-33	97.1
WP_071895513.1\|2159929_2160310_+	Cro/Cl family transcriptional regulator	S6B268	Ralstonia_phage	4.1e-37	66.9

DBSCAN-SWA_8

2536587 : 2622396

Ralstonia_phage(36.96%)

tRNA,integrase,head,terminase,protease,tail,plate,capsid,portal,holin

attL 2568249:2568273|attR 2610740:2610764

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016722163.1\|2536587_2537985_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_016722164.1\|2538158_2539118_+	patatin-like phospholipase family protein	H8ZJB8	Ostreococcus_tauri_virus	5.0e-07	28.3
WP_011001127.1\|2539191_2539860_-	C40 family peptidase	NA	NA	NA	NA
WP_021154880.1\|2540149_2541814_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-17	32.9
WP_016722166.1\|2541810_2542935_-	ABC transporter permease	NA	NA	NA	NA
WP_011001124.1\|2542941_2543997_-	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_016722167.1\|2544015_2545893_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011001122.1\|2546158_2546953_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_011001121.1\|2547354_2548605_-	aspartate kinase	NA	NA	NA	NA
WP_021154885.1\|2548733_2550122_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_011001119.1\|2550129_2551098_-	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_043885999.1\|2551184_2552060_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_020831689.1\|2552044_2553442_-\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	8.0e-38	31.3
WP_016722170.1\|2553684_2554344_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_016722171.1\|2554397_2554970_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_019718005.1\|2555008_2555515_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_016722173.1\|2555511_2556318_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_016725822.1\|2556339_2557086_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_021154887.1\|2557222_2558086_-	RNA methyltransferase	NA	NA	NA	NA
WP_011001110.1\|2558199_2559012_+	inositol monophosphatase	NA	NA	NA	NA
WP_011001109.1\|2559057_2559606_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071508223.1\|2559698_2560427_+	glutamine amidotransferase	NA	NA	NA	NA
WP_028860446.1\|2560423_2561149_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_011001106.1\|2561157_2562960_-	Tar ligand binding domain-containing protein	NA	NA	NA	NA
WP_021154889.1\|2563035_2564907_-	cache domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.1e-09	62.3
WP_016722180.1\|2565040_2565856_-	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	2.7e-30	31.7
WP_011001103.1\|2565888_2567091_-	MFS transporter	NA	NA	NA	NA
WP_016725817.1\|2567203_2568097_+	LysR family transcriptional regulator	NA	NA	NA	NA
2568249:2568273	attL	NA	NA	NA	NA
WP_071895526.1\|2570160_2573022_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.7e-40	23.2
WP_071895527.1\|2573032_2575039_+	phospholipase	NA	NA	NA	NA
WP_016723932.1\|2575042_2576350_+	hypothetical protein	NA	NA	NA	NA
WP_058907760.1\|2576371_2576662_+	PAAR domain-containing protein	R4JMI1	Burkholderia_phage	4.1e-05	35.6
WP_071653990.1\|2576698_2577346_+	hypothetical protein	NA	NA	NA	NA
WP_016722186.1\|2577791_2578130_+	DUF1484 family protein	NA	NA	NA	NA
WP_071895528.1\|2578151_2579231_-\|portal	phage portal protein	A0A077K9Q8	Ralstonia_phage	1.8e-194	92.0
WP_071895529.1\|2579227_2581009_-\|terminase	terminase ATPase subunit family protein	A0A077K8Q7	Ralstonia_phage	0.0e+00	91.2
WP_071895530.1\|2581145_2581988_+\|capsid	GPO family capsid scaffolding protein	A4PE29	Ralstonia_virus	7.0e-122	77.9
WP_016722191.1\|2582026_2583079_+\|capsid	phage major capsid protein, P2 family	A4PE30	Ralstonia_virus	4.0e-143	74.0
WP_016722192.1\|2583075_2583798_+\|terminase	terminase endonuclease subunit	A4PE31	Ralstonia_virus	8.7e-97	77.5
WP_038962045.1\|2583895_2584375_+\|head	head completion/stabilization protein	A4PE32	Ralstonia_virus	9.6e-68	84.3
WP_058907767.1\|2584374_2584578_+\|tail	tail protein X	A0A077K8R0	Ralstonia_phage	7.2e-25	86.8
WP_071895531.1\|2584593_2585001_+	hypothetical protein	A0A077K9X1	Ralstonia_phage	3.4e-21	91.1
WP_071895532.1\|2584997_2585315_+\|holin	phage holin family protein	A4PE35	Ralstonia_virus	5.2e-46	94.1
WP_071895533.1\|2585311_2586115_+	DUF3380 domain-containing protein	A4PE36	Ralstonia_virus	3.2e-124	84.2
WP_038961971.1\|2586111_2586546_+\|tail	phage tail protein	A0A077K8R3	Ralstonia_phage	1.2e-69	86.8
WP_071895534.1\|2586542_2587013_+	phage virion morphogenesis protein	A0A077K9X5	Ralstonia_phage	6.1e-59	81.6
WP_135005999.1\|2586992_2587406_-	hypothetical protein	NA	NA	NA	NA
WP_155773170.1\|2587739_2588387_-	hypothetical protein	NA	NA	NA	NA
WP_127591872.1\|2588485_2589508_-	hypothetical protein	NA	NA	NA	NA
WP_071895535.1\|2589808_2590426_+\|plate	phage baseplate assembly protein V	A0A077K9S0	Ralstonia_phage	1.4e-108	94.6
WP_071895536.1\|2590422_2590770_+	GPW/gp25 family protein	A4PE42	Ralstonia_virus	1.9e-57	98.3
WP_071895537.1\|2590772_2591681_+\|plate	baseplate assembly protein	A0A077K9X9	Ralstonia_phage	4.1e-160	98.7
WP_071895538.1\|2591673_2592291_+\|tail	phage tail protein I	A0A077KER5	Ralstonia_phage	7.2e-100	95.7
WP_071895539.1\|2592295_2593960_+\|tail	phage tail protein	A0A077K818	Ralstonia_phage	8.0e-311	97.1
WP_021155104.1\|2593972_2594725_+	hypothetical protein	A4PE47	Ralstonia_virus	4.1e-121	90.8
WP_043885739.1\|2594721_2595186_+	hypothetical protein	A4PE48	Ralstonia_virus	1.1e-84	98.1
WP_021155106.1\|2595279_2596455_+\|tail	phage tail sheath protein	A4PE49	Ralstonia_virus	5.8e-223	98.2
WP_016722208.1\|2596486_2596996_+\|tail	phage major tail tube protein	A0A077KER7	Ralstonia_phage	9.2e-77	79.3
WP_021155107.1\|2597071_2597398_+\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	8.0e-50	99.1
WP_003267618.1\|2597394_2597496_+\|tail	GpE family phage tail protein	A0A077K821	Ralstonia_phage	2.7e-09	93.9
WP_173877476.1\|2597492_2600156_+\|tail	phage tail protein	A4PE52	Ralstonia_virus	0.0e+00	96.1
WP_071895541.1\|2600158_2600581_+\|tail	phage tail protein	A4PE53	Ralstonia_virus	3.0e-73	98.6
WP_071895542.1\|2600577_2601705_+	phage late control D family protein	A4PE54	Ralstonia_virus	4.6e-201	96.0
WP_071654013.1\|2601815_2602010_+	Com family DNA-binding transcriptional regulator	A0A1S5NPS9	Burkholderia_phage	1.6e-13	69.2
WP_071895543.1\|2601972_2602839_+	DNA cytosine methyltransferase	A0A1P8DJM9	Virus_Rctr41k	5.6e-50	59.2
WP_127591879.1\|2602987_2603356_-	hypothetical protein	A0A077K8S5	Ralstonia_phage	2.7e-54	85.1
WP_080606373.1\|2603479_2603950_-	helix-turn-helix transcriptional regulator	A0A077K9Z1	Ralstonia_phage	9.8e-41	60.4
WP_127591882.1\|2604023_2604233_+	hypothetical protein	NA	NA	NA	NA
WP_016721650.1\|2604294_2604543_+	ogr/Delta-like zinc finger family protein	A0A077K829	Ralstonia_phage	4.7e-34	82.9
WP_071895544.1\|2604660_2605215_+	Bro-N domain-containing protein	A0A077K9T3	Ralstonia_phage	8.5e-84	85.2
WP_155773171.1\|2605225_2605402_+	hypothetical protein	NA	NA	NA	NA
WP_058907787.1\|2605401_2605638_+	hypothetical protein	A4PE65	Ralstonia_virus	5.1e-30	80.8
WP_071895545.1\|2605630_2605840_+	hypothetical protein	A4PE66	Ralstonia_virus	5.5e-20	72.9
WP_071895546.1\|2606254_2608939_+	toprim domain-containing protein	A0A077K8T2	Ralstonia_phage	0.0e+00	92.8
WP_016721659.1\|2608998_2609226_+	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	7.6e-23	73.1
WP_071895636.1\|2609226_2610510_-\|integrase	tyrosine-type recombinase/integrase	C7BGE7	Burkholderia_phage	4.0e-137	55.9
WP_152532532.1\|2611265_2611511_-	hypothetical protein	NA	NA	NA	NA
2610740:2610764	attR	NA	NA	NA	NA
WP_155772886.1\|2611964_2613323_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	9.8e-25	30.1
WP_021154891.1\|2613322_2614387_+	hypothetical protein	NA	NA	NA	NA
WP_011001099.1\|2614442_2614967_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_011001098.1\|2614978_2616208_+	cupin domain-containing protein	NA	NA	NA	NA
WP_127591883.1\|2616382_2616766_-	hypothetical protein	NA	NA	NA	NA
WP_016721663.1\|2616850_2617636_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	6.1e-27	33.5
WP_016721664.1\|2617670_2618867_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_011001095.1\|2618907_2619792_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_016721665.1\|2619910_2620483_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_020831674.1\|2620502_2621705_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_016721667.1\|2621718_2622396_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_9

2686896 : 2759359

Ralstonia_phage(30.3%)

transposase,protease,head,terminase,integrase,tail,capsid,portal

attL 2695310:2695358|attR 2744122:2744170

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071895547.1\|2686896_2688225_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011001027.1\|2688373_2688622_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_016725123.1\|2688652_2689378_-	response regulator transcription factor	NA	NA	NA	NA
WP_071012560.1\|2689795_2692150_-	CHASE2 domain-containing protein	NA	NA	NA	NA
WP_021154980.1\|2692118_2693825_-	FecR domain-containing protein	NA	NA	NA	NA
WP_011001023.1\|2693808_2694522_-	response regulator transcription factor	NA	NA	NA	NA
2695310:2695358	attL	NA	NA	NA	NA
WP_086005111.1\|2696172_2696637_+	lysozyme	A0A1S5R1I9	Pseudomonas_phage	2.5e-20	39.6
WP_016724969.1\|2697105_2697303_-	hypothetical protein	NA	NA	NA	NA
WP_016724968.1\|2697395_2697734_-	hypothetical protein	NA	NA	NA	NA
WP_038962738.1\|2697789_2700168_-	DNA-dependent RNA polymerase	A0A2R2ZGE5	Ralstonia_phage	3.3e-84	31.1
WP_016724966.1\|2700177_2700363_-	hypothetical protein	NA	NA	NA	NA
WP_016724965.1\|2700385_2700730_-	hypothetical protein	A0A127KNZ2	Pseudomonas_phage	1.4e-20	51.3
WP_016724964.1\|2700722_2700947_-	hypothetical protein	NA	NA	NA	NA
WP_016724963.1\|2700950_2701778_-	ribonuclease H-like domain-containing protein	A0A2P0VPF6	Ralstonia_phage	3.9e-93	61.2
WP_016724962.1\|2701774_2702176_-	DNA endonuclease VII	A0A1L7DQG2	Ralstonia_phage	7.4e-21	52.7
WP_051048331.1\|2702147_2702864_-	phosphodiesterase	A0A077KVP0	Ralstonia_phage	7.9e-66	51.5
WP_016724960.1\|2703348_2704188_-	hypothetical protein	A0A068Q6Y4	Ralstonia_phage	1.6e-62	51.0
WP_080606461.1\|2704210_2706586_-	DNA polymerase A family protein	A0A068Q7T8	Ralstonia_phage	5.0e-290	62.8
WP_038962739.1\|2706638_2707184_-	metal-dependent phosphohydrolase	A0A1W6JP41	Morganella_phage	1.1e-32	50.3
WP_016724957.1\|2707183_2707369_-	hypothetical protein	NA	NA	NA	NA
WP_080606460.1\|2707715_2708696_-	ATP-dependent DNA ligase	A0A2H4GY71	Pseudomonas_phage	3.0e-68	50.2
WP_016724955.1\|2709733_2711029_-	AAA family ATPase	A0A068Q6G7	Ralstonia_phage	5.3e-153	63.1
WP_081369073.1\|2711018_2711570_-	toprim domain-containing protein	A0A077KVN4	Ralstonia_phage	2.9e-52	58.1
WP_016724953.1\|2711837_2712119_-	hypothetical protein	Q9ZX17	Mycobacterium_phage	2.6e-12	46.9
WP_016724952.1\|2712115_2712424_-	hypothetical protein	NA	NA	NA	NA
WP_020371639.1\|2712432_2712609_-	hypothetical protein	NA	NA	NA	NA
WP_016724951.1\|2712615_2712981_-	hypothetical protein	NA	NA	NA	NA
WP_038962733.1\|2713183_2713417_-	hypothetical protein	B5BTU9	Ralstonia_phage	1.6e-23	67.9
WP_016724949.1\|2713424_2713823_-	hypothetical protein	NA	NA	NA	NA
WP_016724948.1\|2713822_2714008_-	hypothetical protein	NA	NA	NA	NA
WP_155738951.1\|2714220_2714370_-	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|2714366_2715332_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_016724947.1\|2716302_2716995_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_155773172.1\|2717098_2718391_+	hypothetical protein	NA	NA	NA	NA
WP_155773173.1\|2718357_2718813_+	hypothetical protein	NA	NA	NA	NA
WP_080606458.1\|2719059_2719329_+	HNH endonuclease	A0A0U2C119	Paracoccus_phage	4.6e-11	48.1
WP_016721870.1\|2719755_2720742_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_016724943.1\|2721480_2723070_+\|terminase	terminase large subunit	Q9MCV7	Escherichia_phage	1.4e-179	64.3
WP_080606456.1\|2723078_2723711_+\|head,protease	HK97 family phage prohead protease	A0A0R6PHN0	Moraxella_phage	6.4e-35	42.7
WP_016724941.1\|2723720_2725040_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	1.4e-76	41.8
WP_038962726.1\|2725287_2726625_+\|portal	phage portal protein	S4TTG7	Salmonella_phage	2.5e-81	42.0
WP_016724939.1\|2726621_2726921_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_071895552.1\|2727151_2727520_+\|head	phage head closure protein	NA	NA	NA	NA
WP_016724937.1\|2727519_2727870_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_016724936.1\|2727882_2728314_+	hypothetical protein	NA	NA	NA	NA
WP_016724934.1\|2728453_2728789_+	hypothetical protein	NA	NA	NA	NA
WP_071895553.1\|2728809_2729196_+	DUF4035 domain-containing protein	A0A1W6JP68	Morganella_phage	2.5e-05	34.1
WP_016724932.1\|2729116_2729551_+	HK97 gp10 family phage protein	S4TR46	Salmonella_phage	3.2e-09	33.8
WP_071895554.1\|2729540_2732351_+	hypothetical protein	C7BGC8	Burkholderia_phage	1.0e-12	39.1
WP_016724929.1\|2732355_2732700_+\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	1.4e-20	41.8
WP_016724984.1\|2733925_2734606_+\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	1.8e-72	58.5
WP_016724983.1\|2734602_2735376_+	C40 family peptidase	Q3HQU3	Burkholderia_phage	2.4e-68	54.9
WP_071895555.1\|2735336_2735948_+\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	5.9e-46	50.5
WP_071895556.1\|2735970_2739675_+	host specificity protein J	A4JX16	Burkholderia_virus	8.9e-254	49.7
WP_038962744.1\|2739671_2740031_+	hypothetical protein	NA	NA	NA	NA
WP_155773174.1\|2740400_2740676_+	hypothetical protein	NA	NA	NA	NA
WP_071895557.1\|2741257_2741533_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016721870.1\|2741957_2742944_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_081369070.1\|2743067_2743967_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_016724974.1\|2744629_2745205_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
2744122:2744170	attR	NA	NA	NA	NA
WP_016725737.1\|2745273_2747283_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_023470298.1\|2747365_2748556_+	elongation factor P maturation arginine rhamnosyltransferase EarP	NA	NA	NA	NA
WP_028852870.1\|2748678_2749239_+	elongation factor P	NA	NA	NA	NA
WP_016723241.1\|2749353_2750406_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_016723242.1\|2750402_2750846_-	holo-ACP synthase	NA	NA	NA	NA
WP_011001016.1\|2750842_2751634_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_011001015.1\|2751630_2752449_-	DNA repair protein RecO	NA	NA	NA	NA
WP_023470297.1\|2752469_2753417_-	GTPase Era	NA	NA	NA	NA
WP_011001013.1\|2753413_2754184_-	ribonuclease III	M1H375	Paramecium_bursaria_Chlorella_virus	1.8e-15	32.8
WP_016723244.1\|2754186_2754558_-	DUF4845 domain-containing protein	NA	NA	NA	NA
WP_011001011.1\|2754623_2755541_-	signal peptidase I	NA	NA	NA	NA
WP_016723245.1\|2755574_2757371_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	7.1e-23	24.7
WP_016723246.1\|2757569_2757845_-	glutaredoxin family protein	NA	NA	NA	NA
WP_016723247.1\|2757841_2759359_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	4.8e-20	27.7

DBSCAN-SWA_10

2882822 : 2891058

Planktothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011000872.1\|2882822_2883875_-	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-33	39.4
WP_011000871.1\|2884031_2884955_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	9.3e-43	35.9
WP_028852812.1\|2885072_2886185_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_011000869.1\|2886265_2887168_-	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	8.2e-52	40.8
WP_016723340.1\|2887271_2887589_-	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_016723341.1\|2887718_2888714_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	4.1e-28	32.3
WP_016723342.1\|2888710_2889658_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	9.0e-17	27.6
WP_016723343.1\|2889684_2891058_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-76	38.9

DBSCAN-SWA_11

2933938 : 2948044

Ralstonia_phage(55.56%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058907694.1\|2933938_2934400_-	lysozyme	K4I410	Acidithiobacillus_phage	4.8e-64	80.3
WP_028860336.1\|2934396_2934873_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	84.2
WP_016724633.1\|2934869_2935160_-	membrane protein	K4I011	Acidithiobacillus_phage	2.4e-13	48.8
WP_058907695.1\|2935227_2935452_-	hypothetical protein	NA	NA	NA	NA
WP_071508023.1\|2935461_2937297_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.1e-103	45.1
WP_071508022.1\|2937301_2937700_-	hypothetical protein	NA	NA	NA	NA
WP_016727799.1\|2937696_2938179_-	hypothetical protein	A0A0M4TU90	Ralstonia_phage	1.1e-13	44.0
WP_071653957.1\|2938182_2939349_-	hypothetical protein	A0A0M5TJJ3	Ralstonia_phage	7.9e-47	33.3
WP_071895561.1\|2939360_2942951_-	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.5
WP_016727790.1\|2942980_2943553_+	hypothetical protein	NA	NA	NA	NA
WP_016727789.1\|2943539_2943935_-	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	1.6e-31	53.0
WP_071653956.1\|2943940_2948044_-\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.4e-26	28.8

DBSCAN-SWA_12

2955861 : 3007569

Acidithiobacillus_phage(45.45%)

transposase,head,terminase,portal,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071653954.1\|2955861_2956635_-	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	3.1e-47	43.6
WP_071508048.1\|2956757_2957204_-	hypothetical protein	NA	NA	NA	NA
WP_020833003.1\|2957209_2957512_-	hypothetical protein	NA	NA	NA	NA
WP_071653953.1\|2957514_2958519_-\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	1.9e-110	67.5
WP_071653952.1\|2958525_2958903_-\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	6.7e-24	48.0
WP_071653951.1\|2958912_2960172_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	4.6e-61	43.4
WP_016725355.1\|2960181_2961708_-\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	3.4e-151	57.7
WP_016725356.1\|2961707_2961929_-	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	1.3e-11	57.5
WP_016727772.1\|2961929_2962322_-	hypothetical protein	NA	NA	NA	NA
WP_071653949.1\|2962332_2962842_-	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	4.8e-25	44.4
WP_172833506.1\|2962885_2964868_-\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	86.0
WP_038962858.1\|2964867_2965404_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	4.2e-72	79.8
WP_038938655.1\|2965423_2965762_+	hypothetical protein	NA	NA	NA	NA
WP_071624100.1\|2965868_2966375_+	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	4.0e-24	72.3
WP_016727890.1\|2966504_2967011_+	DUF3489 domain-containing protein	K4HZZ2	Acidithiobacillus_phage	2.9e-14	32.9
WP_038938808.1\|2967138_2967489_+	hypothetical protein	NA	NA	NA	NA
WP_162904291.1\|2967586_2967751_+	hypothetical protein	K4HZY7	Acidithiobacillus_phage	1.1e-07	56.1
WP_143102330.1\|2967799_2968129_+	hypothetical protein	NA	NA	NA	NA
WP_016725010.1\|2968125_2968506_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_071653948.1\|2968488_2969763_-	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	6.3e-199	81.1
WP_071508043.1\|2969759_2971163_-	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	8.3e-160	60.5
WP_058908853.1\|2971560_2971968_-	hypothetical protein	NA	NA	NA	NA
WP_016725004.1\|2971957_2972167_-	hypothetical protein	NA	NA	NA	NA
WP_071895562.1\|2972401_2974699_-	hypothetical protein	K4HZY1	Acidithiobacillus_phage	0.0e+00	72.1
WP_021156153.1\|2974682_2975072_-	hypothetical protein	NA	NA	NA	NA
WP_038938742.1\|2975077_2975545_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	5.9e-38	53.5
WP_016727900.1\|2975554_2976187_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	3.8e-64	61.0
WP_016727901.1\|2976205_2977078_-	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	2.9e-102	66.4
WP_071653946.1\|2977074_2977572_-	hypothetical protein	NA	NA	NA	NA
WP_071653945.1\|2977568_2977859_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071615617.1\|2978606_2980271_+	hypothetical protein	NA	NA	NA	NA
WP_139274347.1\|2980288_2981104_+	hypothetical protein	NA	NA	NA	NA
WP_071653944.1\|2981272_2982247_-	hypothetical protein	NA	NA	NA	NA
WP_071654078.1\|2982243_2983467_-	glycine hydroxymethyltransferase	NA	NA	NA	NA
WP_016722471.1\|2984212_2984506_-	hypothetical protein	NA	NA	NA	NA
WP_016722470.1\|2984517_2984859_-	hypothetical protein	NA	NA	NA	NA
WP_016722469.1\|2984868_2985120_-	hypothetical protein	NA	NA	NA	NA
WP_143102314.1\|2985726_2986206_-	hypothetical protein	NA	NA	NA	NA
WP_016722467.1\|2986260_2986839_-	hypothetical protein	NA	NA	NA	NA
WP_155772881.1\|2986862_2987078_-	hypothetical protein	NA	NA	NA	NA
WP_143102316.1\|2987197_2987518_-	hypothetical protein	NA	NA	NA	NA
WP_071653943.1\|2987601_2988132_-	hypothetical protein	NA	NA	NA	NA
WP_071507981.1\|2988177_2989002_-	hypothetical protein	NA	NA	NA	NA
WP_143102317.1\|2989442_2989763_-	hypothetical protein	NA	NA	NA	NA
WP_143102318.1\|2989759_2990389_-	hypothetical protein	NA	NA	NA	NA
WP_071615194.1\|2992244_2992559_+	hypothetical protein	NA	NA	NA	NA
WP_081369074.1\|2993024_2993465_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_021154705.1\|2993497_2994880_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	4.5e-134	59.9
WP_038938302.1\|2994876_2995374_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	9.2e-21	38.8
WP_173877478.1\|2996387_2997479_-	DUF746 domain-containing protein	NA	NA	NA	NA
WP_071895565.1\|2997676_2998513_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_071895566.1\|2998530_3000282_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_071895567.1\|3000293_3002834_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.8e-16	30.8
WP_071895641.1\|3002886_3003255_-	hypothetical protein	NA	NA	NA	NA
WP_016723621.1\|3003317_3003605_-	hypothetical protein	NA	NA	NA	NA
WP_071508020.1\|3003898_3005224_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_074960860.1\|3005564_3006056_-	hypothetical protein	NA	NA	NA	NA
WP_016723619.1\|3006603_3007569_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0

DBSCAN-SWA_13

3794086 : 3857573

Klosneuvirus(22.22%)

protease,tail,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071895614.1\|3794086_3795106_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_016722562.1\|3795278_3795614_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_043885957.1\|3796072_3797797_+	GMC family oxidoreductase N-terminal domain-containing protein	A0A1V0SI18	Klosneuvirus	1.8e-60	31.9
WP_016722564.1\|3797814_3798714_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016722565.1\|3799089_3800763_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_016722566.1\|3800849_3801344_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016722567.1\|3801364_3801667_-	hypothetical protein	NA	NA	NA	NA
WP_011000085.1\|3801741_3802263_-\|tail	phage tail protein	A0A2R4A082	Microbacterium_phage	1.6e-15	36.0
WP_016722568.1\|3802277_3802811_-\|tail	phage tail protein	A0A2R3ZZT3	Microbacterium_phage	2.6e-13	32.7
WP_016722569.1\|3802820_3803369_-\|tail	phage tail protein	NA	NA	NA	NA
WP_071895615.1\|3803872_3808891_+	autotransporter domain-containing protein	A0A1W6JQC9	Corynebacterium_phage	3.9e-10	52.9
WP_016722571.1\|3808930_3810127_-	nitronate monooxygenase	NA	NA	NA	NA
WP_173877489.1\|3810586_3812440_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_071895616.1\|3812453_3813593_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_013213874.1\|3813589_3813817_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_011000076.1\|3813826_3814654_+	thiazole synthase	NA	NA	NA	NA
WP_028852448.1\|3814650_3815802_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_016722575.1\|3815928_3816408_+	VOC family protein	A0A2K9L4N3	Tupanvirus	5.7e-28	47.8
WP_038962152.1\|3816579_3818016_-	hypothetical protein	NA	NA	NA	NA
WP_016722578.1\|3818909_3819734_+	hypothetical protein	NA	NA	NA	NA
WP_155773177.1\|3819995_3827684_+	hypothetical protein	NA	NA	NA	NA
WP_016722585.1\|3827885_3828248_-	hypothetical protein	NA	NA	NA	NA
WP_011000067.1\|3828282_3829188_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_016722587.1\|3829258_3829957_-	hypothetical protein	NA	NA	NA	NA
WP_016722588.1\|3830038_3831442_-	alkaline phosphatase	NA	NA	NA	NA
WP_069079282.1\|3831461_3832913_-	alkaline phosphatase	NA	NA	NA	NA
WP_038938143.1\|3833279_3833711_+	L,D-transpeptidase	NA	NA	NA	NA
WP_011000061.1\|3833707_3834259_+	hypothetical protein	NA	NA	NA	NA
WP_011000060.1\|3834507_3835932_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	3.2e-42	30.0
WP_011000059.1\|3835998_3836340_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_011000058.1\|3836353_3837184_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_016722592.1\|3837192_3837651_+	TfoX/Sxy family protein	NA	NA	NA	NA
WP_011000056.1\|3837742_3838348_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_028852442.1\|3838386_3840339_+	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	6.2e-12	32.9
WP_016722594.1\|3840500_3841505_+	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
WP_011000053.1\|3841696_3842386_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_020830861.1\|3842382_3843672_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.6e-80	47.0
WP_011000051.1\|3843675_3844581_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_021155371.1\|3844656_3845502_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_020830859.1\|3845498_3846851_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.6e-17	23.0
WP_016722598.1\|3846881_3847784_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011000047.1\|3847987_3848293_-	hypothetical protein	NA	NA	NA	NA
WP_023469999.1\|3848530_3850918_-	hypothetical protein	NA	NA	NA	NA
WP_011000045.1\|3851294_3852014_-	response regulator	NA	NA	NA	NA
WP_019717341.1\|3852050_3854486_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_071895617.1\|3854482_3855283_-	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_011000042.1\|3855296_3856622_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_011000041.1\|3856712_3857573_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP052071

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

29663 : 41755

Ralstonia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071895885.1\|29663_32321_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	0.0e+00	85.3
WP_038962083.1\|32323_33139_+	hypothetical protein	A0A077KEQ4	Ralstonia_phage	7.8e-94	68.7
WP_071895835.1\|33135_35367_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	0.0e+00	84.6
WP_016722308.1\|35363_35684_+	hypothetical protein	NA	NA	NA	NA
WP_020829481.1\|35692_35959_+	PAAR domain-containing protein	R9U4D0	Rhizobium_phage	3.1e-07	56.5
WP_020829482.1\|36582_36849_+	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	1.7e-13	51.9
WP_016722315.1\|36866_37586_+	hypothetical protein	NA	NA	NA	NA
WP_020829484.1\|37609_37828_+	hypothetical protein	NA	NA	NA	NA
WP_016722316.1\|37875_38103_+	ogr/Delta-like zinc finger family protein	E5E3P1	Burkholderia_phage	6.7e-11	51.7
WP_016722318.1\|38619_38943_+	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_020829487.1\|38953_41755_+	toprim domain-containing protein	A0A1S5NPU9	Burkholderia_phage	7.0e-251	50.6

DBSCAN-SWA_2

699678 : 731202

Ralstonia_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016721735.1\|699678_700644_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|700640_700790_+	hypothetical protein	NA	NA	NA	NA
WP_081326716.1\|702713_703085_+	hypothetical protein	NA	NA	NA	NA
WP_011003870.1\|703432_704005_-	hypothetical protein	NA	NA	NA	NA
WP_071895711.1\|704395_705058_+	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	4.3e-66	60.5
WP_155773180.1\|705190_705439_+	hypothetical protein	A0A2H4JGF1	uncultured_Caudovirales_phage	8.5e-36	86.1
WP_016725469.1\|705435_705711_+	site-specific DNA-methyltransferase	K4HZA5	Acidithiobacillus_phage	1.2e-27	78.5
WP_071895715.1\|705717_706269_-	type III effector HopH1	NA	NA	NA	NA
WP_016721735.1\|706344_707310_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|707306_707456_+	hypothetical protein	NA	NA	NA	NA
WP_016723834.1\|708298_708508_+	hypothetical protein	NA	NA	NA	NA
WP_016723835.1\|708809_710255_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_118888231.1\|710671_712297_-	caspase family protein	NA	NA	NA	NA
WP_071895717.1\|712306_712621_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|713468_714455_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_016721735.1\|714612_715578_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|715574_715724_+	hypothetical protein	NA	NA	NA	NA
WP_071895718.1\|716680_716869_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_016723839.1\|716984_717674_-	glutathione S-transferase	NA	NA	NA	NA
WP_014631877.1\|717712_718075_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_011004587.1\|718204_718921_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_021156145.1\|718959_720582_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_016723841.1\|720595_722173_-	polyamine aminopropyltransferase	A0A1C9C533	Heterosigma_akashiwo_virus	5.5e-11	27.0
WP_020830396.1\|722303_723014_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.0e-12	24.4
WP_019719996.1\|723010_723760_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.6e-16	28.2
WP_019719997.1\|723756_724725_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_014631870.1\|724721_725591_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_016726288.1\|725639_726899_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_074960931.1\|727851_729150_-	hypothetical protein	NA	NA	NA	NA
WP_139180419.1\|729313_729700_-	hypothetical protein	NA	NA	NA	NA
WP_086005097.1\|730052_731202_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.9e-95	60.7

DBSCAN-SWA_3

1095213 : 1106108

Ralstonia_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023470149.1\|1095213_1096689_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_016723619.1\|1096895_1097861_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_019719026.1\|1098009_1098225_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_043885730.1\|1098121_1098901_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.9e-29	33.5
WP_074960884.1\|1099248_1100139_+	VacJ family lipoprotein	NA	NA	NA	NA
WP_155773181.1\|1100384_1101476_+	type III effector protein	NA	NA	NA	NA
WP_016721870.1\|1101552_1102539_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_155773182.1\|1103986_1104604_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-48	49.2
WP_071895761.1\|1104854_1105868_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_071508531.1\|1105898_1106108_-\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1272263 : 1322966

uncultured_Caudovirales_phage(28.57%)

tRNA,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723213.1\|1272263_1274216_-\|tRNA	class I tRNA ligase family protein	A0A1V0SK04	Klosneuvirus	5.2e-43	24.7
WP_016723214.1\|1274202_1275744_-	PLP-dependent transferase	NA	NA	NA	NA
WP_016723215.1\|1275968_1277978_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_020371709.1\|1278119_1278674_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016723217.1\|1278885_1279602_-	autoinducer binding domain-containing protein	NA	NA	NA	NA
WP_139233336.1\|1280947_1281232_-	hypothetical protein	NA	NA	NA	NA
WP_016723220.1\|1281368_1281650_-	hypothetical protein	NA	NA	NA	NA
WP_052331358.1\|1281767_1282724_-	hypothetical protein	NA	NA	NA	NA
WP_161632306.1\|1282922_1283891_-	hypothetical protein	NA	NA	NA	NA
WP_071508464.1\|1285062_1286727_-	hypothetical protein	NA	NA	NA	NA
WP_173877498.1\|1286742_1289763_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	8.3e-16	23.0
WP_011004065.1\|1289900_1290647_-	hypothetical protein	NA	NA	NA	NA
WP_021155949.1\|1290933_1291782_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_011004063.1\|1291821_1292091_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.8e-10	49.4
WP_071508536.1\|1292101_1293589_+	hypothetical protein	NA	NA	NA	NA
WP_071895778.1\|1293626_1297568_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_016723230.1\|1297564_1298551_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_011004059.1\|1298553_1299387_+	OmpA family protein	NA	NA	NA	NA
WP_038962315.1\|1299485_1300454_+	hypothetical protein	NA	NA	NA	NA
WP_038962316.1\|1300526_1301606_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_016723233.1\|1301739_1303083_-	glycoside hydrolase family 10 protein	NA	NA	NA	NA
WP_016723234.1\|1303079_1303838_-	hypothetical protein	NA	NA	NA	NA
WP_038962317.1\|1303842_1304226_-	hypothetical protein	NA	NA	NA	NA
WP_155773183.1\|1304463_1304790_-	hypothetical protein	NA	NA	NA	NA
WP_016723619.1\|1305543_1306509_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_071895632.1\|1306731_1307556_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_144061949.1\|1307618_1308068_+	hypothetical protein	NA	NA	NA	NA
WP_038962318.1\|1308077_1309196_+	hypothetical protein	NA	NA	NA	NA
WP_086005103.1\|1309214_1310017_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_016723619.1\|1310142_1311108_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_043885652.1\|1313382_1314516_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_020830185.1\|1314533_1317290_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.1e-37	25.6
WP_020830186.1\|1317310_1320028_-	type VI secretion system ATPase TssH	A0A2I7SAX5	Vibrio_phage	4.5e-85	32.0
WP_020371627.1\|1320060_1321152_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_016724833.1\|1321115_1322966_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP052070

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP052071

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection