CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP054446	Staphylococcus saprophyticus strain UTI-056 plasmid pUTI-056-2, complete sequence	0 crisprs	NA	0
NZ_CP054447	Staphylococcus saprophyticus strain UTI-056 plasmid pUTI-056-3, complete sequence	0 crisprs	NA	0
NZ_CP054444	Staphylococcus saprophyticus strain UTI-056 chromosome, complete genome	2 crisprs	csa3,WYL,DEDDh,cas3,DinG	10
NZ_CP054448	Staphylococcus saprophyticus strain UTI-056 plasmid pUTI-056-4, complete sequence	0 crisprs	NA	0
NZ_CP054445	Staphylococcus saprophyticus strain UTI-056 plasmid pUTI-056-1, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054444_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054444_1

5818-5926

Orphan

Consensus_repeat	Method
ATATCAGTGTTTATAGGTGTGACCGAAATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054444_1

>merge|NZ_CP054444|1|5818-5926|CRISPRCasFinder
ATATCAGTGTTTATAGGTGTGACCGAAATAATTTGGTTCAGTCACAGTAAATATGGAGAATTTTGTTTTAAGCTTGTCATATCAGTGTTTATAGGTGTGACCGAAATAA

>NZ_CP054444|1|1|5818-5926|CRISPRCasFinder
ATATCAGTGTTTATAGGTGTGACCGAAATAA	TTTGGTTCAGTCACAGTAAATATGGAGAATTTTGTTTTAAGCTTGTC
ATATCAGTGTTTATAGGTGTGACCGAAATAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054444.1\|WP_011303579.1\|12120_12585_-\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NZ_CP054444.1\|WP_145461623.1\|1551_2088_-\|pathogenicity-island-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_069805103.1\|9118_9298_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_174544289.1\|10439_11546_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP054444.1\|WP_174544285.1\|5151_5565_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_174544288.1\|9845_10175_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|376540
NZ_CP054444.1\|WP_145461621.1\|4228_4846_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_002455580.1\|528_720_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_145461620.1\|4859_5066_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_145461657.1\|1228_1507_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_174544287.1\|8409_8703_-\|DUF1474-family-protein	unknown	unknown	gnl\|CDD\|369323
NZ_CP054444.1\|WP_145461622.1\|3743_4217_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_103211173.1\|8715_9117_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_011303580.1\|12607_14998_-\|ribonuclease-R	unknown	unknown	gnl\|CDD\|273947
NZ_CP054444.1\|WP_002455596.1\|9310_9529_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224393
NZ_CP054444.1\|WP_064783228.1\|896_1232_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_037554465.1\|9528_9750_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP054444.1\|WP_064783232.1\|2128_2602_-\|phage-terminase-small-subunit-P27-family	unknown	unknown	gnl\|CDD\|226270
NZ_CP054444.1\|WP_174544286.1\|5958_8304_-\|DNA-primase	unknown	unknown	gnl\|CDD\|273716

Protein	Function_ID	Function_description	E-value
NZ_CP054444.1\|WP_011303579.1\|12120_12585_-\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	2.65104e-86
NZ_CP054444.1\|WP_174544289.1\|10439_11546_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	6.66325e-38
NZ_CP054444.1\|WP_002455596.1\|9310_9529_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	1.47172e-06
NZ_CP054444.1\|WP_011303580.1\|12607_14998_-\|ribonuclease-R	gnl\|CDD\|273947	TIGR02063, Ribonuclease_R, ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans. [Transcription, Degradation of RNA].	0
NZ_CP054444.1\|WP_174544288.1\|9845_10175_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	1.99371e-05
NZ_CP054444.1\|WP_064783232.1\|2128_2602_-\|phage-terminase-small-subunit-P27-family	gnl\|CDD\|226270	COG3747, COG3747, Phage terminase, small subunit [DNA replication, recombination, and repair].	6.76191e-20
NZ_CP054444.1\|WP_037554465.1\|9528_9750_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.019e-09
NZ_CP054444.1\|WP_174544286.1\|5958_8304_-\|DNA-primase	gnl\|CDD\|273716	TIGR01613, putative_primase, phage/plasmid primase, P4 family, C-terminal domain. This model represents a clade within a larger family of proteins from viruses of bacteria and animals. Members of this family are found in phage and plasmids of bacteria and archaea only. The model describes a domain of about 300 residues, found generally toward the protein C-terminus. [DNA metabolism, DNA replication, recombination, and repair, Mobile and extrachromosomal element functions, Prophage functions].	8.14622e-108
NZ_CP054444.1\|WP_174544287.1\|8409_8703_-\|DUF1474-family-protein	gnl\|CDD\|369323	pfam07342, DUF1474, Protein of unknown function (DUF1474). This family consists of several bacterial proteins of around 100 residues in length. Members of this family seem to be found exclusively in Staphylococcus aureus. The function of this family is unknown.	1.18703e-40

>NZ_CP054444.1|WP_174544285.1|5151_5565_-|hypothetical-protein
MRYLYNSGNRYGTVVTKNNVNRVIMDYPREVFNFTDEELQQYMADNNLGFNAIDFNDMTMEQLETVLMWCKQLEPMKSVNENCSSYNLKHMFERESYGFYISNGNMKEVMALAGFKPKSADDLNWFYTISERSIKQL
>NZ_CP054444.1|WP_145461620.1|4859_5066_-|hypothetical-protein
MHMWYRDVVNQIVARLPTDISNVSESYLDCVIKRYVTRREDIEEVKQCINELKINKQIKTYKDFITKK
>NZ_CP054444.1|WP_145461621.1|4228_4846_-|hypothetical-protein
MAKVNEKSIEVFNKVIEPKVENKKHVALEKIKVTDKLKEFDYKMSHYRAENDYTMIASLKKEQGKLEDEIVALHEQSEDENHKLLDEDIKSFNDAYDKEVNELRNTNDKLIQEFNEKLNGAYEVYEKIAANKVEAIRRASRRNYMNTAISNPDQWRLSLQRNTNLVDDPFRTNTNPRIIANKFEQKLFNINGHADSEFNNGNKKW
>NZ_CP054444.1|WP_145461622.1|3743_4217_-|hypothetical-protein
MSYTVLSPLEQDYALGFDEKKNTIILKPLYSNTKVGIATSDGVASSDINYKKGSLTRRVFKNFKDTDGINIVINNNENSFVANSKDKGVLTVINEEYIGFGIQVDKVEDKGEGLQELVDIAKNKKSVSVQSYASKIGMDNTTIGNIDKIELISINTK
>NZ_CP054444.1|WP_064783232.1|2128_2602_-|phage-terminase-small-subunit-P27-family
MAQRKLLSQQKSRLTTEAQETKQATEEALKQLTKLQPEPPEWLDDTATKEWHRIFPLLEELPIASLDLALVSAYCTAYSDYINATIRMKNESAIIETERGTKLNQNHAIKRDSLSQLNSIAPKLGLTVESRLKILDPSKEKVTGKSVFDIFGMDDDD
>NZ_CP054444.1|WP_145461623.1|1551_2088_-|pathogenicity-island-protein
MILKRCKSVLWYKEEMKITEYELLTNYNPQFINSKIRAIQEQINAMYHLNTSHTVCDEIAGVITVSYPLDKLVIWITDQKDELNRFKINSTKKLNLLKKLISNYTPKEQKEVMRYFKSNGSNKPYKTIDKLQEDLYKIHHNKRIERNEQREKENEVIYQNFVVEVKESLNKVREELVV
>NZ_CP054444.1|WP_145461657.1|1228_1507_-|hypothetical-protein
MRNYHSMVDTYKNKPSDVNELKYMNLESIVKGITEVYNDSEVKVQQIIKLTWWKDKKYTDEVIADVIGVGELTLRHAEEVILKRVAKAVEYV
>NZ_CP054444.1|WP_064783228.1|896_1232_-|hypothetical-protein
MRYDKATVKEFILNYHKIQDNSYTCDEDVGIDDFFNVNNQVETHEIDNSNIEDVIFYNELEAVIERVATEKEHNLFLLICNGVSFEKAGNIFGVKEARAKQMLNRLLDKLE
>NZ_CP054444.1|WP_002455580.1|528_720_-|hypothetical-protein
MIPNLDWNKNFQEFQEILNSGINPEWLYNAKANMILNPAYTGEGKQFFFTKDIIKASKTIPFF
>NZ_CP054444.1|WP_174544286.1|5958_8304_-|DNA-primase
MAIKEKDKIIEVNALEIPEELKELPQWVLWRAEWDSKQQQYKKVPYSFSGYHASSTNKDTWTIFNVINRLNEDNENYNGIGFMLSDDDNYIVLDIDNAIDEHGQNISDLALDMTEITYCEKSPSGTGLHCFFKGQLPSERKKKRSDLDIELYDSARFMTVTGESIGQSEICDDQDILNNIVDRYFKQDKPPEKNTAQVSNVSETLSDDEVIDLMFKSKQKDKISDLLKGNYEPYFDSPSEAVQSLLHYLAFYTGKNKAQMERIFLNYNNLTDKWDSKRGNTSWGELELDRAIANQNEVYKKSTTKSVKELLNELRKEELQHMREVWEKEKEKGEAFGRPPQTIKPIRCAYLLNEHLNFILFDMEEDTKLAFYMENEGIYTQNYTYIRRVISWLEPKHNKRKADDVIYHLVHNFAPVTPRTNDPDLIPVNNGVYNRQTKTLESFTPKYVFTTKISTNYVENAPSPVIDGWTFDNWLDEIACADREVYTLLWQVINDSLNGNYTRKKAIFLVGDGNNGKGTFQVMLSNLIGFDNVASLKVNEFDHEFKPSVLEGKTLVIGDDVPVGVNIEDSSNFNSVVTGDSILVNVKKKQPYRAVFRCTVIQSTNGMPRFKNKTGGTNRRLLIVPFNADFNGTKENPDIKEKYLNNKEVLEYVLYKAINLDFGKFIVPKVSADMLEEYKQDNDPAYDFKVTEFDTWKIDKVPKSVVYYRYKVFCENSGYHALSERKFYKTFNQYLSKNWEEERARFYSVADMQKKVGYFEPTLVPNGELKRSYINNKLKVV
>NZ_CP054444.1|WP_174544287.1|8409_8703_-|DUF1474-family-protein
MNWETKNLIEQIDIIKRKINDAVTTFCWFDDEYFTYDSGHWLTKDEILKHGASYHEHRCYITQHIDLLNIYLKELDTVLEDIEKASSVMSANGTDNA
>NZ_CP054444.1|WP_103211173.1|8715_9117_-|hypothetical-protein
MKIKEFKSKYGREITLMLISERINNRNLSKDDREVHEMELIQEYMKHQGVNDKYIGELDILDMIQDFEMMIQMSVYATNILKKMQVKNYDMANEISYFSREDDLNNLYLAKLEIEKLIKVIERNRPNYINFYK
>NZ_CP054444.1|WP_069805103.1|9118_9298_-|hypothetical-protein
MKLFAILIAASSLTSFTVGYVTEDIFNSFALYSPLAVTSWAITEWFNDRKIKKQLLEEN
>NZ_CP054444.1|WP_002455596.1|9310_9529_-|helix-turn-helix-domain-containing-protein
MKKLAYPHLYISRKEHGHNQEYVAKKLGISKERYSLKELNKANFTLPEAKILSELYEMPIDDLFSNSITVGQ
>NZ_CP054444.1|WP_037554465.1|9528_9750_-|helix-turn-helix-transcriptional-regulator
MVNRIKEIRLEKSITITELSNITGVSRTTIYKLEEQKSNPSLETISRISSGLKERPEKIFNFSVIQELQKEEA
>NZ_CP054444.1|WP_174544288.1|9845_10175_+|helix-turn-helix-domain-containing-protein
MNEFGNKLKELRGNTSIRESAKNIGISHTYLDSLEKGYDPRTGKERKPTIEVINKISKYYNYDFFKLVNLAGLFMSISEAPEKVKKDEIQKMKKRFEDFALTKENRVKS
>NZ_CP054444.1|WP_174544289.1|10439_11546_+|site-specific-integrase
MQHDLKLSHNIYKDAKRGTYYFRIKYYEKTGERKEIKRAGYKQRKEAVKACNAYMDEIEGIGKINQLPFDELVQEYVEWYSARRKASSLKSLKTHTNNHLVPFFQSMDVFNMTTQDIMKFQNKKMKEAHSGEYLKKMHVFLVSILNHAMKYHDLKQNVASLVGNFEIETQKRLNYWTLEQFKQFHDMLPNLQQKVFFKLLFMSGARKGEIRALTWDDVNFEDDYIHINKTDYHGIVTAPKTKASIRDIYLPAHMMDDLQEYLNWYKDNNIYKSNYVLFGTFFKAFSESAIDRWFTGTLKQLDETLPDGETFPRIVIHELRHSHASMLVNHGASPMIIAQRLGHSSTEEVTSRYGHLYPSTQKEIIKYL
>NZ_CP054444.1|WP_011303579.1|12120_12585_-|SsrA-binding-protein-SmpB
MPKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVNRGEMFLNNMHIAPYEEGNRFNHDPRRSRKLLLHKREIAKLGERTREVGYSIVPLKLYLKHGHCKVLLGVARGKKKYDKRQALKEKAVQRDVAREMKARY
>NZ_CP054444.1|WP_011303580.1|12607_14998_-|ribonuclease-R
MNLKQSIEEIIKQPDYEPMSVSDFQDALGLNSADSFRDLIKVLVELEQTGLIQRTKTDRYQRKASNNAKQSKLIKGKLSQNKKGFAFLRPEEEDMDDIFIPPTKINRAMDGDTVLVEVHQSKGEHKGKLEGEVKTIETHSVTQVVGTYSEARHFGFVLPDDKRIMQDIFIPKGQNLGAVDGHKVLVQITKYADGTDNPEGIVSAILGHKNDPGVDILSIIYQHGIEIEFPDNVLAEAEAVPDHIEPSQIEGRRDLRDELTITIDGADAKDLDDAISVKKLSNGHTQLTVSIADVSYYVTEDSALDKEAYSRATSVYLVDRVIPMIPHRLSNGICSLNPQVDRLTLSCQMEIDERGDVVDHEIFDSVIHSNYRMTYDEVNEIITDQDTETRNQYSEVTPMLDLAQDLSQRLIHMRRRRGEIDFDINEAKVLVNEEGIPTDVEMRQRGEGERLIESFMLAANETIAEHFDRLEVPFIYRVHEQPKSERLRQFFDFVTNFGLMIKGTGEDIHPSTLQKIQQEVEGQPEQMVISTMMLRSMQQARYDDVNLGHFGLSAEYYTHFTSPIRRYPDLIVHRLIRKYIIEQSMDRKEKNKWEALLPEIAEHTSQRERRAIEAERDTDELKKAEYMVQHIGEEFEGIISSVANFGMFIELPNTIEGMVHVSNMTDDYYHFDERQMAMIGERQAKVFRIGDPVQIKVINVDVDERMIDFQIVGMPIPNRDRGQRPSRGKTIQAKPRGNSSDKSKDDKNGKGGRGRTKQKQRKGKNKRQSDQSKGNTKHKPFYKDKNVKNKARKKKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054444_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054444_2

846311-846408

Orphan

Consensus_repeat	Method
TTGCATAAGAATCACTAAGGAAATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054444_2

>merge|NZ_CP054444|2|846311-846408|CRISPRCasFinder
TTGCATAAGAATCACTAAGGAAATTCGTAACATTAATTTCCAAGTGAAATTAATGAATACAAAAGAAAATCTTTTGCATAAGAATCACTAAGGAAATT

>NZ_CP054444|2|2|846311-846408|CRISPRCasFinder
TTGCATAAGAATCACTAAGGAAATT	CGTAACATTAATTTCCAAGTGAAATTAATGAATACAAAAGAAAATCTT
TTGCATAAGAATCACTAAGGAAATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054444.1\|WP_011302235.1\|840751_841669_-\|2-dehydropantoate-2-reductase	unknown	unknown	gnl\|CDD\|183829
NZ_CP054444.1\|WP_077461027.1\|844939_846010_+\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP054444.1\|WP_011302245.1\|852181_852652_-\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP054444.1\|WP_002482217.1\|855275_855728_-\|urease-accessory-protein-UreE	unknown	unknown	gnl\|CDD\|237322
NZ_CP054444.1\|WP_011302236.1\|841882_842638_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP054444.1\|WP_061050467.1\|836682_837003_+\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP054444.1\|WP_011302237.1\|842979_843798_+\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP054444.1\|WP_047504698.1\|847922_848828_+\|cysteine-synthase-family-protein	unknown	unknown	gnl\|CDD\|107204
NZ_CP054444.1\|WP_011302240.1\|846415_847705_-\|homocysteine-synthase	unknown	unknown	gnl\|CDD\|225428
NZ_CP054444.1\|WP_011302242.1\|848824_849970_+\|bifunctional-cystathionine-gamma-lyase/homocysteine-desulfhydrase	unknown	unknown	gnl\|CDD\|181076
NZ_CP054444.1\|WP_011302233.1\|838351_839071_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP054444.1\|WP_011302246.1\|852829_853036_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054444.1\|WP_011302232.1\|837573_838368_+\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270429
NZ_CP054444.1\|WP_011302248.1\|854593_855283_-\|urease-accessory-protein-UreF	unknown	unknown	gnl\|CDD\|223900
NZ_CP054444.1\|WP_002482211.1\|851453_852008_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP054444.1\|WP_011302247.1\|853965_854580_-\|urease-accessory-protein-UreG	unknown	unknown	gnl\|CDD\|349776
NZ_CP054444.1\|WP_011302238.1\|843841_844774_+\|lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|133426
NZ_CP054444.1\|WP_002482190.1\|839067_839799_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP054444.1\|WP_002482214.1\|853122_853965_-\|urease-accessory-protein-UreD	unknown	unknown	gnl\|CDD\|223899
NZ_CP054444.1\|WP_061050468.1\|837046_837340_+\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376749

Protein	Function_ID	Function_description	E-value
NZ_CP054444.1\|WP_011302235.1\|840751_841669_-\|2-dehydropantoate-2-reductase	gnl\|CDD\|183829	PRK12921, PRK12921, oxidoreductase.	1.47135e-125
NZ_CP054444.1\|WP_077461027.1\|844939_846010_+\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	8.29114e-23
NZ_CP054444.1\|WP_011302245.1\|852181_852652_-\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	5.61813e-26
NZ_CP054444.1\|WP_002482217.1\|855275_855728_-\|urease-accessory-protein-UreE	gnl\|CDD\|237322	PRK13261, ureE, urease accessory protein UreE; Provisional.	1.37227e-59
NZ_CP054444.1\|WP_011302236.1\|841882_842638_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	3.72315e-10
NZ_CP054444.1\|WP_061050467.1\|836682_837003_+\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	6.47715e-45
NZ_CP054444.1\|WP_011302237.1\|842979_843798_+\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	6.23317e-97
NZ_CP054444.1\|WP_047504698.1\|847922_848828_+\|cysteine-synthase-family-protein	gnl\|CDD\|107204	cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.	3.06093e-108
NZ_CP054444.1\|WP_011302240.1\|846415_847705_-\|homocysteine-synthase	gnl\|CDD\|225428	COG2873, MET17, O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism].	0
NZ_CP054444.1\|WP_011302242.1\|848824_849970_+\|bifunctional-cystathionine-gamma-lyase/homocysteine-desulfhydrase	gnl\|CDD\|181076	PRK07671, PRK07671, bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase.	0
NZ_CP054444.1\|WP_011302233.1\|838351_839071_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	6.40669e-78
NZ_CP054444.1\|WP_011302248.1\|854593_855283_-\|urease-accessory-protein-UreF	gnl\|CDD\|223900	COG0830, UreF, Urease accessory protein UreF [Posttranslational modification, protein turnover, chaperones].	1.45042e-91
NZ_CP054444.1\|WP_011302232.1\|837573_838368_+\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270429	cd13711, PBP2_Ngo0372_TcyA, Substrate binding domain of ABC transporters involved in cystine import; the type 2 periplasmic binding protein fold. This subgroup includes cystine-binding domain of periplasmic receptor-dependent ATP-binding cassette transporters from Neisseria gonorrhoeae and Bacillus subtilis and their related proteins. Cystine is an oxidized dimeric form of cysteine that is required for optimal bacterial growth. In Bacillus subtilis, three ABC transporters, TcyJKLMN (YtmJKLMN), TcyABC (YckKJI), and YxeMNO are involved in uptake of cystine. Likewise, three uptake systems were identified in Salmonella enterica serovar Typhimurium, while in Escherichia coli, two transport systems seem to be involved in cystine uptake. Moreover, L-cystine limitation was shown to prevent virulence of Neisseria gonorrhoeae; thus, its L-cystine solute receptor (Ngo0372) may be suited as target for an antimicrobial vaccine. The cystine receptor belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.32092e-109
NZ_CP054444.1\|WP_002482211.1\|851453_852008_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.36006e-12
NZ_CP054444.1\|WP_011302247.1\|853965_854580_-\|urease-accessory-protein-UreG	gnl\|CDD\|349776	cd05540, UreG, urease accessory protein UreG. UreG is one of the four accessory proteins of urease. Urease is an enzyme which catalyzes the decomposition of urea to form ammonia and carbon dioxide. Bacterial urease is a trimer of three subunits which are encoded by genes ureA, ureB, and ureC. Up to four accessory proteins (ureD, ureE, ureF, and ureG) are required for urease catalytical function. UreG may play an important role in nickel incorporation of the urease metallocenter. UreG is a member of the Fer4_NifH superfamily which contains an ATP-binding domain. Proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.	1.54103e-117
NZ_CP054444.1\|WP_011302238.1\|843841_844774_+\|lactate-dehydrogenase	gnl\|CDD\|133426	cd05290, LDH_3, A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of some bacterial LDHs from firmicutes, gammaproteobacteria, and actinobacteria. Vertebrate LDHs are non-allosteric, but some bacterial LDHs are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenase, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	8.30515e-159
NZ_CP054444.1\|WP_002482190.1\|839067_839799_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	8.94086e-142
NZ_CP054444.1\|WP_002482214.1\|853122_853965_-\|urease-accessory-protein-UreD	gnl\|CDD\|223899	COG0829, UreH, Urease accessory protein UreH [Posttranslational modification, protein turnover, chaperones].	1.83725e-86
NZ_CP054444.1\|WP_061050468.1\|837046_837340_+\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|376749	pfam02255, PTS_IIA, PTS system, Lactose/Cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIA PTS system enzymes. This family of proteins normally function as a homotrimer, stabilized by a centrally located metal ion. Separation into subunits is thought to occur after phosphorylation.	7.38632e-37

>NZ_CP054444.1|WP_077461027.1|844939_846010_+|ROK-family-protein
MLERHVKLIRLMLINRNQFLNADEIARYLNVSNRTARNDIQYINSEILDDLIVSVKGRGYKLNQSLYSMQQIETIVTDFTNKESELLIKLGYQLLMYQQPLTSEAIGKTFHLTKAEVTDYINKIKAWCISFDVNIQITKKKGITVNGSEMNIRNAILHLNQLSENVKTVDAFILAEHQYMKHQTEDFIYLTISTGVGMAYIRKGELVSGVNGNFGEIGHTIIKGDSDYQCPVCKQYVCVENEISGLAISRKASHILNKHVSTREAIEMYLHQAHSEITEMIDEVLILTQQLCTNLFSIFNINNIVLGGGVTQSKLPYKSSIENYAQKHYLIQNSTLNVTISNLEANVLTGLYHVNK
>NZ_CP054444.1|WP_011302238.1|843841_844774_+|lactate-dehydrogenase
MSKLGIIGLGKVGTQVLTDVQQLNLFSEIILIDDRADVASGEALDHIHSQGLINTAHIKIRSGVYQDLTDADFIVIAASEATDKNNGDRTLLAQGNHDIIKGIMSQIAEVTQEAVVILISNPVDSMVYFANQIDYPAHKIIGTGTALETSRFKTIIADHYQIDPNNVEAFVIGEHGQHAIPVWSKVHIHGMELSEFEALSDRPAIDKSHISSIINEVSMDVFYQKGWTNAAISKVTSFLIQSIALDQRTITPLTSLSSEYGLEDGAFSLPTLIDKKGIVQRFAITLDKEEERELKEAYEYIRQTIHTAQQ
>NZ_CP054444.1|WP_011302237.1|842979_843798_+|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MRKWFILGSLFVLTIILAACGKSNGEKEDKEITIAASPAPHGVVLEHAKEEMKKKGYDLKIKTVNDYKVPNKLLDKGDVDANAFQHTPYLKAEKKDHNYKIEEAGKVFTTPMGVYSKKYKDIKDIPKGSTIYVSNNPAEEGRFLSFFVDKGLIKIKKGVSIEDAKFDDIVENKKDLKFNNKQGAEFLPKTYNSKEGAAVIMNSNYAIDNGLTPHKDAIAIEGKSSPFANIVAVQEGHKNDKKFKELMKVLQSKEMKKFITDKYGQDVIPYEK
>NZ_CP054444.1|WP_011302236.1|841882_842638_+|CPBP-family-intramembrane-metalloprotease
MSFKNDHKYQWKDMQGKDFLLPFIYLIGNFCLSIVILTIMIGINETQGKNNANFNANFSGTPGILMEMIAFIIIFALWILFHRHSFRQSWKQGLQNIKQHWKLIVITFIVIIVFKEIYPYLVNAFAPEHWKFEETQNDKMVEEMFATPVSTILAFFSIVIIAPMTEEFLFRHLIIGELGKKLNFYVMSVISIIVFASLHVTEAKSPLEIVMYLAIAVGIVYVYMKSQRSLAVAIALHALNNLLAYIFMIIM
>NZ_CP054444.1|WP_011302235.1|840751_841669_-|2-dehydropantoate-2-reductase
MRILVLGAGGIGGYFGGRLAESGQNVTFLVRPKRKSFLERNGLAIHSEQGDYHFNPQLITKDDRVAPFDVILLSSKSYHLEQAMTDLKPFVDGHTAIIPLLNGVAHIPQLQSIFGKDKVMGGYCVIETTLDSMGEIIQTSPFDKLFFGELDGSKSERAQKIAQAFSETKAEFKLSTSIEQGMWHKYLMITVLSSITTLMHAPIGPIRDSDGGINFVRSLYNEVASIMRAHRAPLADDIVSQYMTSFNQLSYHFKTSMQRDMEKGLNIETGHLQGYLLNLADTYQIDAPLLKCVYQNHKVYKEMLK
>NZ_CP054444.1|WP_002482190.1|839067_839799_+|amino-acid-ABC-transporter-ATP-binding-protein
MIELKNIKKSFDDKEVIKGIDLNVNQGEVVTFIGRSGSGKTTLLRMINALELPTEGAVYVNGETYSNADKKSQIKVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKTKKDEAKQQALALLEKVDLTAVKDQRPNALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLRVIKDLANEGMTMIIVTHEMRFAKEVSNKIVFIHDGVIGESGPPEQIFNHPQSAELQRFLNMIREV
>NZ_CP054444.1|WP_011302233.1|838351_839071_+|amino-acid-ABC-transporter-permease
MFLNLNTEQQHALDAAGQAFAPMLEGLVKFSIPITLVTFLLGLVIALLTALMRISTSRILRGIARFYISIIRGTPMIVQLFIIFYGIPELGRLLTNNSENQWTLAPVIAAIIGLSLNVGAYASEIIRGGIMSIPKGQTEAAYSIGMNYRQTIQRIILPQAIRVSVPALGNTFLSLIKDTSLLGFILVAEMFRKAQEVASTTYEYLTIYLLVALMYWVVCFIISIAQNFYESYLERGYRS
>NZ_CP054444.1|WP_011302232.1|837573_838368_+|amino-acid-ABC-transporter-substrate-binding-protein
MKKILLGILTLLLVVGLAACGTSDKKDNDNKNKTASENKTFVVGTEGTYAPFSYHDKQDKLTGYDIDVMKAVAKEMGYKVKFKETQWDSMFAGLDSGRFNVIANQVGINDERKEKYKFSEPYTYSEAVLVVNKNNKDIKSFDDVKGKKLAQTFTSNYGKLAKSKGAELTKVDGFNQAMDLLQSNRVEGTFNDNISYLDYKKQKPNADVKIIEGNAEKSQSALTFSKKEDDATIEKVNKAMKKLKDNGELAKISKKWFGEDVSKS
>NZ_CP054444.1|WP_061050468.1|837046_837340_+|PTS-lactose/cellobiose-transporter-subunit-IIA
MSLIAYSGDAKSHAMEAIYAAKKNAFEEAEKKLKLAEVSLLEAHHIQTNMLTKEAQGDEIKMSLLTIHSQDHLMTAITFKDMAAEMIDLYKKMDSKA
>NZ_CP054444.1|WP_061050467.1|836682_837003_+|PTS-sugar-transporter-subunit-IIB
MAEKTIMLVCAAGMSTSMLVQKMQKEAEKQKLDRDIFAVSTSEADQKIESDNIDVLLLGPQVRFKKDEYTKKCSEKDIPVAVIEMRDYGTMNGENVLNTAEQLMKK
>NZ_CP054444.1|WP_011302240.1|846415_847705_-|homocysteine-synthase
MTQNPWHLDTLSIHGGQVVDDFSKARAVPIYQTSSYVFDNTEHARKLFALEEDGNIYTRIMNPTQNVFEERIAALEGGVGALATSSGQAAIHLALLNIVESGDEIVASSNLYGGTYNLLNITFKKLGIKVHFVDPSHPDNFKNAITDKTKAVYAETIGNPRIDVLDIEAVADIAHNHNIPLIVDNTFPTPYLLRPFEFGADIIVHSATKFIGGHGTSIGGVIVDSGKFNWDNGKFPGLVEPDESYHGISYAKDVGEAAYITKARVQLLRDLGSAVSPFNVHEFLIGLETLHLRLERHSENALRVAQYLEQHPKVTWVNYPGLKNNAYHQLAQKYLPDGQGAILTFGIDGTVDDIAKFVDGLNLFSHLANVGDSKSLIIHPASTTHLQLSPEDQKASGVVPELVRLSVGTENINDIIADLDNGFKESLGN
>NZ_CP054444.1|WP_047504698.1|847922_848828_+|cysteine-synthase-family-protein
MIAFDLIGNTPLVLLESFSNKDVQIYAKLEQYNLGGSVKDRLGKHLIETAIRENIIQKGDVVVEASAGNTGIGVAIAANHYGVSAVIFAPEGFSEEKISIIKALGAEVIRTDQTLGMAGAQKAARDYELQTGAYYLNQFESYRNPETYKSTIGKEITDKLKDIDYFVGGVGSGGTFTGVAEHLAATYHTESVIVEPEGSILSGGNAHSHDIEGIGSEKWPSFLPKALVSDIIKVSDDAAFQNVKLLARQEGLLVGSSSGAALQGALEIKKHINKGVIVTIFPDGSDRYMSKQILNYKETIK
>NZ_CP054444.1|WP_011302242.1|848824_849970_+|bifunctional-cystathionine-gamma-lyase/homocysteine-desulfhydrase
MNKKTQLIHGGQTTDPYTGAVTTPIYQTSTYMQDGIGDMRQGYEYSRSANPTRSALEGLIADLEQGESGFAFGSGMAAISAVIMLLDKGDHLLINSDVYGGTYRALTKVFNRFGIDAEFIDTTNIEAVEQYIKPETKMLYIETPSNPLLRVTDIKKSAEIAKKHHLISVVDNTFMTPYFQNPLTLGIDIVLHSATKYIGGHSDVVAGLVATSDAELAERLGFIQNSTGGVLGPQDSYLLIRGIKTLGLRMEQVQRNTLAIIDMLQQHSAVKQVFHPSISDHLNHDIHEAQSEGHTGVVAFEVADIESAKKVISESHYFTLAESLGAVESLISVPALMTHASIPKDIREKEGIADGLVRLSVGIEDTKDLVEDLEQSLNALG
>NZ_CP054444.1|WP_002482211.1|851453_852008_-|TetR/AcrR-family-transcriptional-regulator
MSQKKQDILSVAERLFYEYGFKGVGLKQIIQEANVATMTLYNHFESKDNLVAQVLKQRETRYWHYLDSHVEQHPEKPFISAVTAHCQWLNDYSYKGDMFMRAIEDYADTDNEIESTARGHKERLLHYLEKLADDAGIENGYDLAVQYTLLLEGTTSMTALLGSKDATSHAITMAKLLLNEAHNQ
>NZ_CP054444.1|WP_011302245.1|852181_852652_-|acyl-CoA-thioesterase
MTDEYIYKNTVQPSWIDNNNHMHDAQYYSIFSDAVVGFFESIDFSTDYRHSQDVTMFSVEAHISFLKELLLDESFYIKVHIYDYDAKRVHLFLTMYNSNDERNATYEAIMMGVGNETRRSMDFPKPIQEKIKHYFDQQNTFDVPKQLGHVIGIPKK
>NZ_CP054444.1|WP_011302246.1|852829_853036_+|hypothetical-protein
MVLVALILFIISIVFLIYSITLLMGKDGTMFSLFTKEEKALTKGQKLTIYLITIVLFVASLVWLLNLI
>NZ_CP054444.1|WP_002482214.1|853122_853965_-|urease-accessory-protein-UreD
MSNNKQAWTGQLDLSVFNNGKKSVARDVFFEKALKVMRPVYLNQSDIPTFYIVNVGGGYLDGDRYTMNFNIDSDAKVILTSQGATKIYKTLNDHVEQYQTFNIKNNGYAEYVGDPIIAFENAKFYQHNVFNLESTASLFYTDILTPGYSKSDKRFSYTYMHLLNEIYVDDALVTFDNMLLDPQKQNVDGLGYMEDYTHLGSCYFIHPSVNQKFIEQVYEEIKHFQHKYDCRFGITHLPTHGFSLRILSNKTQVIESIITAVQCYVVKQIFDRDVDFLRKY
>NZ_CP054444.1|WP_011302247.1|853965_854580_-|urease-accessory-protein-UreG
MTDTIKIGVGGPVGAGKTQLIEKIVKRLAKDMSIGVITNDIYTKEDEKILVNSGVLPEDRIIGVETGGCPHTAIREDASMNFAAIDELKERNDDIELIFIESGGDNLAATFSPELVDFSIYIIDVAQGEKIPRKGGQGMIKSDFFVINKTDLAPYVGASLDRMAEDTKVFRGNRPFTFTNLKTDEGLDEVIQWIEQDVFLKGLA
>NZ_CP054444.1|WP_011302248.1|854593_855283_-|urease-accessory-protein-UreF
MIDHAHLRLFQFCDSQFPTGAFSHSFGLETYIQRDTVHDEESFQQWLVLFLNEQLTYADGLTMRLVYDALNENDTKAILKLDRILFVQNLPKETRQGSKQMGNRMVKLASELYDSDWINWYHAQMKDKKASLHPAICFTMLGHHLGVDIETIIDYYLYQNVSSLTQNAVRAIPLGQTAGQRIVHKMIPIMKETRDHIMTIPASQLGITAPGLEINQMEHENVNVRIFIS
>NZ_CP054444.1|WP_002482217.1|855275_855728_-|urease-accessory-protein-UreE
MIIEEIVGNIANLSDSEKGKHMEKVYLENSDLVKRIQRVTTDHGNEIGIRLKQPIDLQYGDILYKDDKNMIVVDVNSEDLLVIKPRTLQEMGDIAHQLGNRHLPAQFTETEMLVQYDYLVESLLKDLGIPYEHEDRKVNKAFRHIGHSHD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

528 : 14998

Staphylococcus_phage(41.67%)

integrase,terminase

attL 5968:5982|attR 22235:22249

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002455580.1\|528_720_-	hypothetical protein	U3PCX8	Staphylococcus_phage	2.9e-31	100.0
WP_064783228.1\|896_1232_-	hypothetical protein	NA	NA	NA	NA
WP_145461657.1\|1228_1507_-	hypothetical protein	A0A2H4JEA5	uncultured_Caudovirales_phage	5.3e-18	47.8
WP_145461623.1\|1551_2088_-	pathogenicity island protein	A0A2H4JB26	uncultured_Caudovirales_phage	1.7e-41	49.7
WP_064783232.1\|2128_2602_-\|terminase	phage terminase small subunit P27 family	A0A2H4JB21	uncultured_Caudovirales_phage	1.3e-53	72.0
WP_145461622.1\|3743_4217_-	hypothetical protein	A0A1W6JPF7	Staphylococcus_phage	4.6e-30	43.9
WP_145461621.1\|4228_4846_-	hypothetical protein	A0A1W6JPC6	Staphylococcus_phage	5.1e-53	53.5
WP_145461620.1\|4859_5066_-	hypothetical protein	NA	NA	NA	NA
WP_174544285.1\|5151_5565_-	hypothetical protein	NA	NA	NA	NA
WP_174544286.1\|5958_8304_-	DNA primase	A0A2H4JCU9	uncultured_Caudovirales_phage	2.4e-188	52.5
5968:5982	attL	NA	NA	NA	NA
WP_174544287.1\|8409_8703_-	DUF1474 family protein	A0A1W6JPG5	Staphylococcus_phage	1.4e-40	83.5
WP_103211173.1\|8715_9117_-	hypothetical protein	NA	NA	NA	NA
WP_069805103.1\|9118_9298_-	hypothetical protein	NA	NA	NA	NA
WP_002455596.1\|9310_9529_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_037554465.1\|9528_9750_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_174544288.1\|9845_10175_+	helix-turn-helix domain-containing protein	A0A0A8WFJ2	Clostridium_phage	5.5e-06	34.0
WP_174544289.1\|10439_11546_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	1.9e-74	42.7
WP_011303579.1\|12120_12585_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.2e-75	92.9
WP_011303580.1\|12607_14998_-	ribonuclease R	Q0GXV6	Lactococcus_phage	2.4e-90	38.4
22235:22249	attR	NA	NA	NA	NA

DBSCAN-SWA_2

69588 : 88318

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011303647.1\|69588_70557_-	ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.6e-136	78.3
WP_002483928.1\|70970_71939_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A2H4J4P3	uncultured_Caudovirales_phage	2.2e-175	94.4
WP_048787330.1\|72062_74168_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A2H4J2N6	uncultured_Caudovirales_phage	0.0e+00	90.0
WP_002483930.1\|74130_74529_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J545	uncultured_Caudovirales_phage	8.6e-54	76.5
WP_011303649.1\|75255_76143_+	DMT family transporter	NA	NA	NA	NA
WP_002483932.1\|76156_76657_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	2.0e-52	72.3
WP_061050308.1\|76838_78353_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	5.6e-69	35.8
WP_061050309.1\|78720_80226_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.4e-64	32.0
WP_104013913.1\|80695_81643_+	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	3.9e-12	23.6
WP_002483937.1\|81813_82362_-	5'-3'-deoxyribonucleotidase	A0A0A0PKY7	Bacillus_phage	2.0e-29	39.0
WP_061050311.1\|82539_83595_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	2.3e-21	27.2
WP_002483939.1\|83753_85271_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_048787328.1\|85267_86230_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.8e-26	32.5
WP_047502733.1\|86539_88318_-	DNA helicase RecQ	K7YHB4	Megavirus	2.2e-77	36.4

DBSCAN-SWA_3

96621 : 104171

Pandoravirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011303663.1\|96621_97764_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	5.4e-24	36.7
WP_011303664.1\|97747_98341_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.9e-36	41.5
WP_002483950.1\|98596_99268_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.2e-63	54.9
WP_011303665.1\|99269_99695_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_002483952.1\|99687_100404_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	2.5e-51	43.4
WP_011303666.1\|100644_101238_+	hypothetical protein	NA	NA	NA	NA
WP_002483954.1\|101306_101558_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_011303667.1\|101775_102837_-	glycosyltransferase family 2 protein	A0A192Y8W7	Salmonella_phage	8.7e-61	42.3
WP_002483956.1\|103331_104171_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.2e-52	40.2

DBSCAN-SWA_4

427773 : 439693

Staphylococcus_phage(50.0%)

integrase,terminase

attL 424016:424030|attR 443853:443867

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
424016:424030	attL	NA	NA	NA	NA
WP_061050388.1\|427773_428259_-\|terminase	terminase small subunit	A0A1S5S7Z2	Streptococcus_phage	1.3e-19	45.8
WP_061050389.1\|428276_428840_-	hypothetical protein	NA	NA	NA	NA
WP_061050390.1\|428853_429090_-	hypothetical protein	NA	NA	NA	NA
WP_061050391.1\|429086_429509_-	hypothetical protein	NA	NA	NA	NA
WP_061050392.1\|429676_430156_-	HNH endonuclease	NA	NA	NA	NA
WP_061050393.1\|430218_430422_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_061050394.1\|430566_430806_-	hypothetical protein	NA	NA	NA	NA
WP_174543135.1\|431158_432253_-	virulence-associated protein E	A0A1W6JQD6	Staphylococcus_phage	4.1e-90	44.4
WP_061050396.1\|432542_433382_-	primase C-terminal domain-containing protein	Q4ZE74	Staphylococcus_phage	1.5e-44	36.2
WP_061050397.1\|433689_433962_-	hypothetical protein	Q4ZE77	Staphylococcus_phage	2.3e-10	41.8
WP_069844463.1\|434302_434848_+	helix-turn-helix transcriptional regulator	A0A0E3U244	Fusobacterium_phage	2.2e-07	51.7
WP_061050399.1\|434850_436053_+\|integrase	site-specific integrase	Q4ZE80	Staphylococcus_phage	1.5e-93	45.8
WP_061050400.1\|436053_436569_+	hypothetical protein	NA	NA	NA	NA
WP_002484263.1\|436662_438204_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.8e-22	31.6
WP_002484264.1\|438226_439693_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	7.2e-98	40.9
443853:443867	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1578059 : 1592286

Staphylococcus_phage(92.31%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041784790.1\|1578059_1579442_+	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	5.3e-167	61.3
WP_061050592.1\|1579461_1580466_+	o-succinylbenzoate synthase	A0A2H4PQM0	Staphylococcus_phage	2.9e-90	49.4
WP_011302826.1\|1580455_1580707_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	4.2e-30	81.1
WP_011302827.1\|1580766_1581243_+	nucleoside triphosphatase YtkD	A0A2H4PQM4	Staphylococcus_phage	4.8e-43	53.5
WP_172439364.1\|1581226_1582018_+	prolyl oligopeptidase family serine peptidase	A0A2H4PQM6	Staphylococcus_phage	4.2e-100	71.4
WP_011302829.1\|1582113_1583703_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	8.5e-262	81.8
WP_011302830.1\|1584091_1585288_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.8e-195	86.6
WP_011302831.1\|1585386_1586295_+	NERD domain-containing protein	A0A2H4PQQ8	Staphylococcus_phage	1.1e-101	75.8
WP_061050593.1\|1586464_1587301_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	7.2e-111	68.2
WP_047504130.1\|1587571_1587928_-	CrcB family protein	NA	NA	NA	NA
WP_011302834.1\|1587924_1588290_-	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	3.3e-36	62.8
WP_011302835.1\|1588500_1588806_-	hypothetical protein	NA	NA	NA	NA
WP_011302836.1\|1589090_1589804_+	transaldolase	E3SKN5	Synechococcus_phage	2.9e-20	36.3
WP_011302838.1\|1590919_1591369_+	hypothetical protein	A0A2H4PQT8	Staphylococcus_phage	1.3e-21	47.5
WP_011302839.1\|1591376_1591802_-	competence protein ComK	NA	NA	NA	NA
WP_048787400.1\|1591815_1592286_-	sigma-70 family RNA polymerase sigma factor	A0A2H4PQT5	Staphylococcus_phage	2.2e-24	44.4

DBSCAN-SWA_6

1596726 : 1613814

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048787170.1\|1596726_1598193_+	FAD/NAD(P)-binding protein	A0A2H4PQX2	Staphylococcus_phage	5.5e-13	58.6
WP_011302848.1\|1598734_1599778_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.0e-130	64.4
WP_011302849.1\|1599784_1600417_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.0e-72	64.8
WP_011302850.1\|1600428_1601610_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	4.2e-165	71.2
WP_002482978.1\|1601623_1602082_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	6.6e-58	76.3
WP_047504116.1\|1602346_1603348_-	proline dehydrogenase family protein	A0A2H4PQT6	Staphylococcus_phage	7.3e-126	68.5
WP_011302852.1\|1603614_1604439_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011302853.1\|1604674_1605631_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_002482982.1\|1605782_1606184_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011302854.1\|1606302_1606863_-	class I SAM-dependent methyltransferase	A0A2H4PQV0	Staphylococcus_phage	9.5e-67	63.8
WP_011302855.1\|1606859_1607813_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	7.3e-67	83.3
WP_011302856.1\|1607922_1609092_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	2.0e-167	77.4
WP_011302857.1\|1609620_1612035_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	85.6
WP_002482987.1\|1612053_1612365_+	rhodanese-like domain-containing protein	A0A2H4PQR9	Staphylococcus_phage	4.5e-34	68.9
WP_011302858.1\|1612545_1613814_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	1.5e-38	77.2

DBSCAN-SWA_7

1735584 : 1744709

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047503974.1\|1735584_1736589_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.7e-05	29.9
WP_047503971.1\|1736591_1737617_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_011302950.1\|1737637_1738783_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-85	45.0
WP_011302951.1\|1738798_1739059_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	7.4e-06	44.1
WP_047503968.1\|1739440_1741717_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-29	34.6
WP_048787235.1\|1741898_1744178_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.9e-69	29.4
WP_002483102.1\|1744190_1744709_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	6.6e-30	46.2

DBSCAN-SWA_8

1871010 : 1880977

uncultured_Mediterranean_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002483230.1\|1871010_1871898_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	5.1e-38	31.4
WP_011303058.1\|1871965_1872472_-	DUF309 domain-containing protein	NA	NA	NA	NA
WP_011303059.1\|1872563_1873298_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.4e-09	23.5
WP_047503875.1\|1873281_1873830_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.6e-10	31.4
WP_002483234.1\|1873822_1874560_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_011303060.1\|1874686_1875412_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-46	42.6
WP_174538820.1\|1875392_1877159_+	HAMP domain-containing protein	A0A1V0SGX0	Hokovirus	1.7e-21	23.8
WP_037538408.1\|1877586_1878132_+	ECF transporter S component	NA	NA	NA	NA
WP_002483238.1\|1878287_1878536_-	ferredoxin	A0A127AYY7	Bacillus_phage	4.9e-15	48.0
WP_047503872.1\|1878645_1879605_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_047503869.1\|1879597_1880977_+	ATP-dependent DNA helicase RecQ	M1PGQ0	Moumouvirus	5.4e-55	32.4

DBSCAN-SWA_9

2210477 : 2279066

Staphylococcus_phage(46.15%)

portal,tail,holin,tRNA,head,transposase,terminase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011303319.1\|2210477_2213228_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	2.0e-88	27.8
WP_011303320.1\|2213470_2214073_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_104010417.1\|2214212_2214992_-	RNA-binding protein	NA	NA	NA	NA
WP_002483537.1\|2215099_2215390_-	YggT family protein	NA	NA	NA	NA
WP_002483538.1\|2215403_2216009_-	cell division protein SepF	NA	NA	NA	NA
WP_011303322.1\|2216014_2216689_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_047503513.1\|2216706_2217495_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_002483541.1\|2217941_2219114_-	cell division protein FtsZ	NA	NA	NA	NA
WP_047503508.1\|2219143_2220574_-	cell division protein FtsA	NA	NA	NA	NA
WP_052190972.1\|2220679_2221567_-	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_002483544.1\|2221582_2222932_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_011303326.1\|2222933_2223899_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_047503505.1\|2224092_2226327_-	penicillin-binding protein	NA	NA	NA	NA
WP_011303328.1\|2226307_2226700_-	cell division protein FtsL	NA	NA	NA	NA
WP_011303329.1\|2226714_2227650_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_011303330.1\|2227664_2228096_-	division/cell wall cluster transcriptional repressor MraZ	NA	NA	NA	NA
WP_048787295.1\|2228245_2229859_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_047503500.1\|2230121_2230562_+	N-acetyltransferase	NA	NA	NA	NA
WP_011303333.1\|2230676_2231360_-	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
WP_011303334.1\|2231499_2231634_-	beta-class phenol-soluble modulin	NA	NA	NA	NA
WP_048787296.1\|2231672_2231807_-	beta-class phenol-soluble modulin	NA	NA	NA	NA
WP_048787297.1\|2232423_2234307_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_103314661.1\|2236649_2239007_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.2e-160	44.9
WP_011303341.1\|2239199_2239514_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011303342.1\|2239654_2240563_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	8.0e-47	43.5
WP_011303343.1\|2240523_2241207_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_115340783.1\|2241290_2241368_-	hypothetical protein	NA	NA	NA	NA
WP_011303346.1\|2242442_2242853_-	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	2.4e-67	89.7
WP_011303347.1\|2242862_2243054_-	hypothetical protein	A0A2H4JGI3	uncultured_Caudovirales_phage	7.0e-30	95.2
WP_061050614.1\|2243149_2243398_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_061050616.1\|2243990_2244500_-	DUF4065 domain-containing protein	A8ATC0	Listeria_phage	6.0e-44	53.7
WP_061050681.1\|2244880_2245828_-	N-acetylmuramoyl-L-alanine amidase	A0A1P8CMK9	Staphylococcus_phage	1.0e-84	52.4
WP_041080397.1\|2246255_2246513_-\|holin	phage holin	A0A2I6PF56	Staphylococcus_phage	1.7e-10	51.9
WP_104013924.1\|2246566_2246665_+	hypothetical protein	NA	NA	NA	NA
WP_041080395.1\|2246913_2247201_-	hypothetical protein	NA	NA	NA	NA
WP_061050617.1\|2247235_2249119_-	glucosaminidase domain-containing protein	B7T0E8	Staphylococcus_virus	9.0e-194	53.0
WP_061050618.1\|2249172_2249505_-	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_061050619.1\|2249504_2251370_-\|plate	phage baseplate upper protein	A0EWU3	Staphylococcus_virus	7.2e-127	40.5
WP_081095023.1\|2251369_2253277_-	hypothetical protein	A0A059T5B2	Staphylococcus_phage	1.7e-208	58.1
WP_061050620.1\|2253291_2255148_-\|tail	phage tail protein	Q4ZC57	Staphylococcus_virus	2.3e-181	53.2
WP_061050621.1\|2255158_2256085_-\|tail	phage tail family protein	Q4ZC58	Staphylococcus_virus	3.6e-79	51.3
WP_061050622.1\|2256096_2259186_-	hypothetical protein	Q4ZCD8	Staphylococcus_virus	6.5e-157	56.3
WP_061050623.1\|2259188_2259497_-	hypothetical protein	A0A2H4JC15	uncultured_Caudovirales_phage	1.1e-27	62.7
WP_061050624.1\|2259559_2260054_-	hypothetical protein	A0A2H4JI48	uncultured_Caudovirales_phage	1.1e-61	72.0
WP_061050625.1\|2260106_2260652_-	hypothetical protein	A0A1W6JPA3	Staphylococcus_phage	1.0e-73	80.8
WP_061050626.1\|2260657_2261080_-	DUF3168 domain-containing protein	A1BU61	Staphylococcus_virus	2.9e-44	63.7
WP_061050627.1\|2261091_2261505_-	HK97 gp10 family phage protein	A0A0N9BAY5	Staphylococcus_phage	7.8e-58	74.3
WP_061050628.1\|2261491_2261827_-	hypothetical protein	Q4ZCE5	Staphylococcus_virus	2.0e-35	59.1
WP_061050629.1\|2261828_2262125_-\|head,tail	phage head-tail adapter protein	Q4ZC67	Staphylococcus_virus	4.9e-30	63.3
WP_061050630.1\|2262124_2262418_-	Rho termination factor N-terminal domain-containing protein	A0A1W6JQI6	Staphylococcus_phage	2.5e-26	65.3
WP_061050631.1\|2262431_2263364_-	hypothetical protein	A0A1W6JPD7	Staphylococcus_phage	6.8e-142	79.7
WP_061050632.1\|2263376_2263901_-	phage scaffolding protein	Q4ZBR6	Staphylococcus_phage	3.7e-20	59.4
WP_160279508.1\|2264020_2264185_-	hypothetical protein	NA	NA	NA	NA
WP_157822572.1\|2264251_2264398_-	hypothetical protein	NA	NA	NA	NA
WP_081095024.1\|2264394_2265987_-	hypothetical protein	A0A2H4JC26	uncultured_Caudovirales_phage	1.3e-132	76.7
WP_061050633.1\|2265946_2267359_-\|portal	phage portal protein	A0A0H4IPW9	Staphylococcus_phage	2.2e-208	73.9
WP_061050634.1\|2267371_2268580_-\|terminase	PBSX family phage terminase large subunit	R4IG95	Staphylococcus_phage	2.7e-199	82.0
WP_061050635.1\|2268572_2269094_-\|terminase	terminase small subunit	I1W650	Staphylococcus_phage	1.6e-36	62.7
WP_061050636.1\|2269159_2269492_-	hypothetical protein	NA	NA	NA	NA
WP_061050637.1\|2269753_2270176_-	transcriptional regulator	A0A0F6N3E5	Staphylococcus_phage	1.6e-58	80.6
WP_164972273.1\|2270190_2270334_-	hypothetical protein	Q4ZC01	Staphylococcus_virus	6.9e-06	52.2
WP_174544312.1\|2270667_2270988_+	hypothetical protein	NA	NA	NA	NA
WP_061050639.1\|2271003_2271357_-	hypothetical protein	Q4ZC91	Staphylococcus_virus	2.2e-05	29.6
WP_061050640.1\|2271356_2271542_-	hypothetical protein	NA	NA	NA	NA
WP_061050641.1\|2271554_2271761_-	hypothetical protein	A0A1W6JPS2	Staphylococcus_phage	2.3e-10	47.8
WP_061050642.1\|2271738_2271939_-	hypothetical protein	NA	NA	NA	NA
WP_081095027.1\|2271935_2272739_-	ATP-binding protein	A0A2I6PDV5	Staphylococcus_phage	3.5e-62	46.2
WP_061050644.1\|2272836_2273688_-	DnaD domain protein	A0A1Q1PVU4	Staphylococcus_phage	9.4e-50	44.8
WP_061050645.1\|2273729_2274545_-	recombinase RecT	S6AVW6	Thermus_phage	2.1e-59	48.9
WP_061050682.1\|2274556_2275468_-	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	6.1e-79	50.5
WP_061050646.1\|2275512_2275812_-	hypothetical protein	NA	NA	NA	NA
WP_061050647.1\|2275886_2276066_-	hypothetical protein	NA	NA	NA	NA
WP_061050648.1\|2276071_2276377_-	DUF771 domain-containing protein	Q4ZD49	Staphylococcus_phage	8.4e-17	45.5
WP_061050649.1\|2276577_2277117_+	hypothetical protein	NA	NA	NA	NA
WP_061050650.1\|2277415_2277595_+	hypothetical protein	NA	NA	NA	NA
WP_174544313.1\|2277728_2277893_-	hypothetical protein	NA	NA	NA	NA
WP_061050683.1\|2277910_2278177_-	helix-turn-helix transcriptional regulator	H9A0Y0	Staphylococcus_phage	3.7e-29	76.1
WP_061050651.1\|2278307_2279066_+	helix-turn-helix transcriptional regulator	A0A2I6PF08	Staphylococcus_phage	6.9e-52	46.4

DBSCAN-SWA_10

2361145 : 2369620

Synechococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011303433.1\|2361145_2361712_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.7e-27	38.2
WP_011303434.1\|2361714_2362743_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	4.6e-67	44.5
WP_011303435.1\|2362735_2364223_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.6e-44	31.7
WP_011303436.1\|2364201_2366391_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.4e-137	39.6
WP_011303437.1\|2366383_2367055_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_011303438.1\|2367054_2367315_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011303439.1\|2367317_2368019_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SE76	Cyanophage	6.8e-46	42.5
WP_011303440.1\|2368023_2369151_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_011303441.1\|2369137_2369620_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.6e-20	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054444

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection