CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP054571	Achromobacter xylosoxidans strain FDAARGOS_789 chromosome, complete genome	3 crisprs	DinG,csa3,WYL,DEDDh,PD-DExK,RT,cas3	1	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054571_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054571_1

1944351-1944453

Orphan

Consensus_repeat	Method
TTTTCATCGCCGAGCCGCCTCAAGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054571_1

>merge|NZ_CP054571|1|1944351-1944453|CRISPRCasFinder
TTTTCATCGCCGAGCCGCCTCAAGATGAAAAATGCCCCCTCGGGGGGCAGCAAGCCGAAGGCGCGGCGTGGGGGCCCTTTTCATCGCAGAGCCGCCTCAAGAT

>NZ_CP054571|1|1|1944351-1944453|CRISPRCasFinder
TTTTCATCGCCGAGCCGCCTCAAGAT	GAAAAATGCCCCCTCGGGGGGCAGCAAGCCGAAGGCGCGGCGTGGGGGCCC
TTTTCATCGCAGAGCCGCCTCAAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054571.1\|WP_024069795.1\|1946576_1948076_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP054571.1\|WP_054448509.1\|1939354_1940242_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187627
NZ_CP054571.1\|WP_081247790.1\|1948126_1949209_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|185090
NZ_CP054571.1\|WP_024069797.1\|1950773_1951478_+\|siderophore-interacting-protein	unknown	unknown	gnl\|CDD\|99790
NZ_CP054571.1\|WP_020928786.1\|1941594_1944300_+\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445
NZ_CP054571.1\|WP_054443954.1\|1937846_1939286_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236215
NZ_CP054571.1\|WP_006384576.1\|1951513_1952404_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP054571.1\|WP_006387145.1\|1935886_1936795_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|184959
NZ_CP054571.1\|WP_006387133.1\|1953462_1954665_+\|DUF2863-family-protein	unknown	unknown	gnl\|CDD\|371362
NZ_CP054571.1\|WP_024069788.1\|1934793_1935768_-\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NZ_CP054571.1\|WP_024069793.1\|1944470_1945433_-\|DUF4892-domain-containing-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP054571.1\|WP_024069800.1\|1954674_1955790_+\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	unknown	unknown	gnl\|CDD\|378385
NZ_CP054571.1\|WP_024069789.1\|1936805_1937789_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP054571.1\|WP_024069792.1\|1940360_1941290_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP054571.1\|WP_024069786.1\|1930486_1931482_+\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP054571.1\|WP_020928792.1\|1949208_1950738_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP054571.1\|WP_058207445.1\|1932307_1934509_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP054571.1\|WP_058207625.1\|1945585_1946479_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176149
NZ_CP054571.1\|WP_006387148.1\|1931478_1932246_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NZ_CP054571.1\|WP_024069798.1\|1952444_1953218_-\|dioxygenase	unknown	unknown	gnl\|CDD\|153375

Protein	Function_ID	Function_description	E-value
NZ_CP054571.1\|WP_024069795.1\|1946576_1948076_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	3.77231e-66
NZ_CP054571.1\|WP_054448509.1\|1939354_1940242_-\|SDR-family-oxidoreductase	gnl\|CDD\|187627	cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR. TTER is a peroxisomal protein with a proposed role in fatty acid elongation. Fatty acid synthesis is known to occur in the both endoplasmic reticulum and mitochondria; peroxisomal TER has been proposed as an additional fatty acid elongation system, it reduces the double bond at C-2 as the last step of elongation. This system resembles the mitochondrial system in that acetyl-CoA is used as a carbon donor. TER may also function in phytol metabolism, reducting phytenoyl-CoA to phytanoyl-CoA in peroxisomes. DECR processes double bonds in fatty acids to increase their utility in fatty acid metabolism; it reduces 2,4-dienoyl-CoA to an enoyl-CoA. DECR is active in mitochondria and peroxisomes. This subgroup has the Gly-rich NAD-binding motif of the classical SDR family, but does not display strong identity to the canonical active site tetrad, and lacks the characteristic Tyr at the usual position. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	1.7065e-110
NZ_CP054571.1\|WP_081247790.1\|1948126_1949209_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|185090	PRK15136, PRK15136, multidrug efflux MFS transporter periplasmic adaptor subunit EmrA.	7.10952e-104
NZ_CP054571.1\|WP_024069797.1\|1950773_1951478_+\|siderophore-interacting-protein	gnl\|CDD\|99790	cd06193, siderophore_interacting, Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one-electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and two electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).	7.80577e-39
NZ_CP054571.1\|WP_020928786.1\|1941594_1944300_+\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0
NZ_CP054571.1\|WP_054443954.1\|1937846_1939286_-\|AMP-binding-protein	gnl\|CDD\|236215	PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP054571.1\|WP_006384576.1\|1951513_1952404_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.94943e-47
NZ_CP054571.1\|WP_006387145.1\|1935886_1936795_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|184959	PRK14997, PRK14997, LysR family transcriptional regulator; Provisional.	1.1118e-62
NZ_CP054571.1\|WP_006387133.1\|1953462_1954665_+\|DUF2863-family-protein	gnl\|CDD\|371362	pfam11062, DUF2863, Protein of unknown function (DUF2863). This bacterial family of proteins have no known function.	0
NZ_CP054571.1\|WP_024069788.1\|1934793_1935768_-\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	1.35864e-36
NZ_CP054571.1\|WP_024069793.1\|1944470_1945433_-\|DUF4892-domain-containing-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	3.6355e-40
NZ_CP054571.1\|WP_024069800.1\|1954674_1955790_+\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	gnl\|CDD\|378385	pfam10093, EarP, Elongation-Factor P (EF-P) rhamnosyltransferase EarP. This entry includes family members such as EarP enzymes which are essential for post-translational activation of elongation factor P(EF-P). It was identified as EF-P arginine R32 specific rhamnosyl transferase in Shewanella oneidensis using dTDP-beta-L-rhamnose as donor substrate. This was further confirmed for Pseudomonas aeruginosa, Pseudomonas putida, and Neisseria meningitidis. As for S. oneidensis and P. aeruginosa, EarP enzyme acts as an inverting glycosyltransferase, thus mediating the formation of an alpha-L-rhamnosidic linkage. Structural analysis show that EarP is composed of two opposing domains with Rossmann folds, thus constituting a B pattern-type glycosyltransferase (GT-B) and provide basis for arginine glycosylation by EarP. Mutational analysis of efp and earP genes, resulted in a substantial decrease in the production of rhamnolipids and pyocyanin (important factors for colonization and invasion during infection) of P. aeruginosa. Collectively this indicates that EarP and EF-P are essential for P. aeruginosa pathogenicity.The protein family is also annotated in the CaZy Database as GT104.	4.19896e-175
NZ_CP054571.1\|WP_024069789.1\|1936805_1937789_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.81934e-127
NZ_CP054571.1\|WP_024069792.1\|1940360_1941290_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.34323e-56
NZ_CP054571.1\|WP_024069786.1\|1930486_1931482_+\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP054571.1\|WP_020928792.1\|1949208_1950738_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.39588e-126
NZ_CP054571.1\|WP_058207445.1\|1932307_1934509_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	5.36338e-108
NZ_CP054571.1\|WP_058207625.1\|1945585_1946479_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176149	cd08460, PBP2_DntR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.38816e-69
NZ_CP054571.1\|WP_006387148.1\|1931478_1932246_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	4.98682e-91
NZ_CP054571.1\|WP_024069798.1\|1952444_1953218_-\|dioxygenase	gnl\|CDD\|153375	cd07363, 45_DOPA_Dioxygenase, The Class III extradiol dioxygenase, 4,5-DOPA Dioxygenase, catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine. This subfamily is composed of plant 4,5-DOPA Dioxygenase, the uncharacterized Escherichia coli protein Jw3007, and similar proteins. 4,5-DOPA Dioxygenase catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine (4,5-DOPA). The reaction results in the opening of the cyclic ring between carbons 4 and 5 and producing an unstable seco-DOPA that rearranges to betalamic acid. 4,5-DOPA Dioxygenase is a key enzyme in the biosynthetic pathway of the plant pigment betalain. Homologs of DODA are present not only in betalain-producing plants but also in bacteria and archaea. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.	1.79369e-120

>NZ_CP054571.1|WP_020928786.1|1941594_1944300_+|aconitate-hydratase-AcnA
MPHNTLDTLKNFKIGNKSCQYYSLPALGKALGIDVQRLPVSIRIVLESVLRNCDGKKVTEEHVRQLANWQANAKREDEIPFVVARVVLQDFTGVPLLADIAAMRSVADKMGKSPKSIEPLVPVDLVVDHSVMIDYFGTKNALDLNMKLEFKRNQERYQFMKWGMQAFDTFGVVPPGFGIVHQVNLEYLARGVHQDKKNNVYYPDSLVGTDSHTTMINGIGVVGWGVGGIEAEAGMLGQPVYFLTPDVVGVELKGKLRGGVTATDLVLTITEMLRREKVVGKFVEFCGEGTASLSVAERATIGNMAPEYGATMGFFPVDGRTIDYFRGTGRTEDEIAAFEAYFKAQDMFGVPAAQDINYTKLLTLDLSTVAPSLAGPKRPQDRIEIGNVKSTFIDLFSKPVAENGFNQPAEKLQQTFTTSTGTKVKNGDILIAAITSCTNTSNPSVLLAAGLLAKKAVEAGLKVPKHIKTSLAPGSRVVTEYLTKTGLLPYLEKLGFDVAAYGCTTCIGNAGDLTPDLNEVITSNDLVCSAVLSGNRNFEARIHPNIKANFLASPPLVVAYALAGTVTRDLMTEPVGRGKNGDIWLGDIWPTTEEVEALLKYALDPKAFEANYGQVKSNPGKLWENIKGVTGETYNWPDSTYIAEPPFFEGFGMTPGAMPTVKNARALGVFGDSVTTDHISPAGSIKETSPAGKWLKENGVMKADFNSYGSRRGNHEIMMRGTFANVRIKNLMIPARPDGSRFEGGETLFQPTGEQMSIYDAAMKYVAAGTPTVVFGGEEYGTGSSRDWAAKGTQLLGVKAVITRSFERIHRSNLVGMGVLPLQFKGSDSVQSLGITGEETYDISGLENGIKPMQDVTLTITRKDGSKQDVTLLLRIDTPIEVDYYQHGGILPFVLRQLLAA
>NZ_CP054571.1|WP_024069792.1|1940360_1941290_+|LysR-family-transcriptional-regulator
MTTPPVLDLNLIQLFVTIVEAGTLSEAALRQGVTRSHVSRNLQKLERAFGAQLIRRTTRRLELTHEGSVLYDHGARMAREVESARHALQKLGAEPTGHVRLSLPTGLGELDMLRPLLVRFALEHPSLSLRVLFSNRVSDLISSEIDVALRAISVPPQDYVARELGRIKWHLCAAPEYLARMGMPAHPRDLGRFDFLGPPGARPQATLRLRGKGQPHEVKLATRLQSEYFPFLAQAAREGAGVALLPAYIVRPDLEAGRLLQVLPAYQAEGPGDKLYILTSPTPYPSSAQRALVDFLKRELEPLLRTFLA
>NZ_CP054571.1|WP_054448509.1|1939354_1940242_-|SDR-family-oxidoreductase
MFRADLFQGQRILITGGGTGLGYAMARQLAALGATVHLCGRRLAVLEQAAQALRGESGGQVHVHPVDIRDAGAVDAMVARIWDQHGGLDALVNNAAGNFISPTEKLSERGFNAIADTVFRGTFYMTQAVGKRWIGSGASGAVVSIVVTWVWTGSPFVVPSAMSKAGIDAMTKSLAVEWGRRGIRLNAIAPGVIPTEGASARLRPNDSGTDALVKQNPMQRLGQGQDIGELAAFLLAPGNDWINGQTIALDGGDYLANGAYFKQYFDWSDDDWAAARAAIEARTAADKAQRPAGQA
>NZ_CP054571.1|WP_054443954.1|1937846_1939286_-|AMP-binding-protein
MRRGEQVAAGLAAMGIGQGDVVAVLLRNGMPYLEIIQACKRLGCYYCPINWHYTPDEVAYLVRDSGARLLIAEEDLWQAARAALPADLPSRRVGAAAVSEDYASWREAQAPYDGPVVAPRGHMAYTSGTTGRPKGVVRAPFPLDQLAQRLAAVEAVVEQAYGLRPGCRALLPAPVYHSAPSVFAQVALRVCETLVLAPRFDPLEVLRLIERHRIDTVYLVPIMYVRLLKLDPAQRAAFDLSSLRFVASTGAPCAPALKRAMIDWLGPVIHETYASSEAGMVTVIDSHEALARPGSAGRPIGGAQIRIYGDDGALCAPGQIGRIHVRQPAYADFTYRNNPEARSRIERDGLIGLGDLGYLDDDGYLFVCDRESDMVISGGVNIYPAEIEHHLTQYPGVADCAVFGVPDDEFGERLLALVQPAADTALAPEEVLRWLSTRVARYKVPRELRLRQSLPRDDNGKIAKRRLRDAFWAERDRKV
>NZ_CP054571.1|WP_024069789.1|1936805_1937789_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MFMKNSGIGRAAAALLLCMAAVSPAQAAFPERPVKLVVPYTPGGAADLLSRVLAERLSQELAQPVVVENKPGANTMIAATQVARAQPDGYTLFLASNASMVLNPMLYRKISYDAQRDFRVLSVVAELPLVVVANNSVPASTLAQFVDYARARPGKLNYASVGIGNPLQLATELLKSRTGIDVAHVPYNGSAPALSSLMANDTQLMVDVISTSLPLVRENKIKALAVTGAQRLPVLPDVPTVAESGFAGFRAATWFGVAVPRGTPPAEADRLREAVAAVMRQADFRDRFQAQGLVIQAPRGQAEVDAYLAEDRERWNGVIQANHIRLD
>NZ_CP054571.1|WP_006387145.1|1935886_1936795_+|LysR-family-transcriptional-regulator
MHSYIHHLDDLLLFTEVVEKGGFSAAARVLNMQRSKLSRRVAELEARLGLRLLQRNTRRVSLTPMGEQIYVHALAMAREARSAFDLAAAMGDTPSGLLRMTAPSALAVTLLGELVARFCLQHPGVRVLLDTRDQVIDLVGEGYDLAFRAQGASLTDSRLVARELAPVPLILVAAPAMARAAPRHPRDLNALPLLAHATQDSPQSWHFVGPAGEAESIEFRPRCLSSNLAALREMARAGLGVALLPHYLCAGSLAKGDLAQLLPAWRAAPARIYAVMPARRGAPLALRRFLDFAAAEMPALLA
>NZ_CP054571.1|WP_024069788.1|1934793_1935768_-|pirin-family-protein
MTIRLSPPVARPFEPEGDICSYRHFRHSDFPQGMSPLVLVDHFIMTGPAVAPHPHAGISTVTLLLEDTQGGLRIRDSLDNEHEARAGDLHWTVAGRGIVHGHELVGAARLNGLRLYVNLPARLKSMPPSATLVRGWEMPVLQSDAGRVRVVSGRYDGWDAPLATPEPLLILDGWLRPGASRLVPLPAGWNAWLYAAQGEVGVRARHETTPPPRPPVEAAPVIPAARFRPAGRAATTGRRAADPDFAVLPPGAALTATADRDGFLQLLAAGAPAHFILVAGAAIDEPVIQRGPFVMTDARALAQAVAAYEAGDFGQLRQESGVPG
>NZ_CP054571.1|WP_058207445.1|1932307_1934509_-|TonB-dependent-receptor
MKIRTLACVVAALPYTAIVHAQSAAPAADGSVVSMEAIKVEASADASAGGLAQPYAGGQVARGGRVGVLGTQDIMSTPFSVTSYTNELIQDKQARSVGDVLQNDAGVRVARGFGNFQESYFIRGFILSSDDVAYNGLYSLLPRQYIATELFERVEVLRGASAFLTGAAPSGGGIGGVINLVPKRAPNEPLTRFTTGVSSGGQFSVSTDIARRFGPDDSTGIRLNVANRSGDTGIDDEHSRTSLVSLGLDWRSADTRLSADIGWQENKLKRARPNVTLRGVTSVPDAPDASSNYAQPWSYSNERDVFGTVRAEHDFSDKLTGWAAFGMRRSDEANSLGNVTVTNGSTGDGNFYRFDNTREDSVNTGELGLRAKVRTGPVGHEFVASASFFDLKKKNAYVMDYLNTFPTNIYDPVSYDRPAYGSKALFGNDLDDPALQGRTRLSSYAFGDTMSFLDDKVLLTLGIRHQRLSQRDYAYNTGKEQSAYDASRNSPAAGIVFKVAPSVSLYANYIEALVAGDTAPQTANGKPVPNAGQSLQPYVSKQKEIGVKYDGGGLGAGLALFSTDKPRAAYDASNRFTASGKDRHQGIELTVFGEPVNRVRVLGGMTFLDAKQRSTGNSAIDGNRVIGVPRFQANLGAEWDIPGVQGLTVDGRVVYTGASYADDANTLKVPGWTRFDAGLRYMMDVDGHVVTLRARVENIANRNYWSSVGGYPGNGYLVLGGPRTFSLSASMDF
>NZ_CP054571.1|WP_006387148.1|1931478_1932246_+|SDR-family-oxidoreductase
MSARFQDQVIIVTGAVGGIGSAIVEGFLAEGGKVGLIDFNSQGGQAYEKELKKRGHAVSFVHADVSHFDQCQAAYERITRDLGPATILVNNVGISPKTDGRALKVWEMTPGEWDKVVAVNLNSVFYMTHLATPHMVRQRQGRVINMSSVAGKAYCDIVAAHYAATKAALLGLTRHWAAELGEHDVTVNGLAPGRISTPLLKSVPKEINDAVAEVTALRRLGTPEEVADACLFFASDQARFVTGQVLDVAGGWLMT
>NZ_CP054571.1|WP_024069786.1|1930486_1931482_+|NAD(P)H-quinone-oxidoreductase
MSLRCTFIDHGTGGAPDCLRLAEREMAAPAGRQVLIEVAYAGVNRPDVLQRSGSYPPPPGASPYLGLEVAGTVIAVGPDATRWQVGDRVCALTPGGGYAQYCLADERHCLPVPRGLDLLSAAAIPENYFTVWTNVFERARLAAGEKFLVHGGSSGIGLTAIQLARAFGAEVWTTVGNQEKAEACLKAGAQHALIYRDTDFEADIRQATGGQGVDVILDMVGGAYINKNIRLLAVNGRLVQIAFLEGSKAEIDALPIMTKRLSFTGSTLRPRSDEDKGAIAQALADKVLPLMEQGRCLPLIHQVFPLEQAAQAHALMESSRHIGKIMLKVRA
>NZ_CP054571.1|WP_024069793.1|1944470_1945433_-|DUF4892-domain-containing-protein
MKAHIVKVASLAIVAATLTASPAWAEDVEGSRDHPALTRFEGAEIRAYEHKDYDEALMPDRPVARESEAKGLTLEGKLTRIAYRIDGKKSALEVYRNYQGALQAGGFKTVFECKGDEQCGGDFQSFVLNSGKVSQPGQGDAAFGGKYYVVLAKKEAPTGDIYVFLDVMEDSSNNITPVFQQVIETKPMQTGQVKVLDMAAMQKSLAESGRVAVYGVYFDTDKAEVKAESKAALDEMGKLLNANPKLKVYVVGHTDNQGTLAGNLELSQKRADAVVKALEAGYKIPAARLSARGVASLAPVAANDAEAGRAKNRRVELVAQ
>NZ_CP054571.1|WP_058207625.1|1945585_1946479_-|LysR-family-transcriptional-regulator
MDLNLLVALDALLAEGSVTGAAERLQLSVPAMSRTLERIRRMMGDPLFVRAGRGLVPTPRAEALREPVRTLVAQARELLAQDAAFDLKTLRRVFTIRADDGAVSTLGPALLDTLAKEAPRVTVRFISQGKQDVLSLREGAIDLDIGVIEDMGPEIVRQRLFPDRFVAVFRPANPLARHRKLTPERFARARHATVSRRGVLSGPVDIELGKVGLARHISAVTHSFAEALAITRKSDLVATVPDLLTLHLRDDLQMRALPFDTPAVTISQAWHPRFNEDPAHRAIRQMVHRISLAISGR
>NZ_CP054571.1|WP_024069795.1|1946576_1948076_+|efflux-transporter-outer-membrane-subunit
MIHSTRYRPDARPARRMRLRHAPLAAALAALVAVAGCASHDGLRPAGKPLDLAALDAGQDIAAAVRDTADDAAPWWRAWGDDQLDRLMADALRQAPGVRAAQARLGQAEAVFGSVDANRQPTLDGSATITADRYPGHYTYGAPYADNTGGSGSLLASLRLRLDIWGKWRALADAARLDAEGAALAHADAQLALQQGIAAAYLRLDAAFRLHELARQQRERQRQALELHQTRRQAGLGSDAPVADARGRLARMDAEVERLDREIARQRHALAALAGQAPGYGDVLRRPRLALRADPALPAALPARLLGLRPDVLAQRKRLDAADRRIEAAKAEFYPDIDLKAFAGLQSLGLSHLLQGNSLAAGIGPALTLPIFDGGRLRAGLRDRIAGYDLAVADYDATVVRALQEVADGLAGMAQARARRDAARVSLREAGTLARLQAVRASRGLSARQDEIDTDLARLRADSELAAADLDLGLARTALAGALGGRWSPSQSSDNEALK
>NZ_CP054571.1|WP_081247790.1|1948126_1949209_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MLAGGATLLAGAGWAAWTFLAGAATQTTDNAYVNGHVVAITPQVGGAVSAIWADNADRIRAGQTLVEVDPADTQIALAGARADLARARRRVQALFASRDQAGAEVARRQAELDRAQADVSARRGIAAQGAITSEEARHAADALNAARAALAVAQAAERAAQAQVDGVTPDTHPDVTLAQARLRAAALDAQRTTIRAPVGGMVAQRSVQLGKHVAIGDKLMAVVPLDQMWIDANFKEIQLAGICPGQPAVVTVDAHGAKVRYRGRVGDVMAGSGSAFALLPSQNATGNWIKVVQRVPVRINLDPKELADHPLRIGLSAEVTVDTARCDPAQAGAARGETTDIYRQQRQAADTLAQAGQGLQ
>NZ_CP054571.1|WP_020928792.1|1949208_1950738_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MSAAPRPIEPMTGLPRVVAAVAISLASFMAVVDITIANVSVPTISGNLGVSPEIGEWAITFFAIANSICIPLTGWLSRRLGQVRLFVLSVAAFTLASVLCGVAQNFESLLAFRVLQGMVSGPIVPLSQALLVAIFPPDKRTLALSMWAMTNMAGPVAGPVLGGWLTDDFSWPWIFLVNAPVGIAVVAVTATMFRGRDTPSTRLPVDLRGLILLAVAIGCLQLTLDRGRTLDWFASPFIVTTALLSALGFVFLVIWELGEAHPIVDLSLFRHRNFAMGTLAVAVGFGLYFAALVLIPLWLQTDMRYTATWAGLATAPMGVFGILLAPLLGRWVQRGDARVFASLAFVAWSLVAWWRASMTTDVGVGLISLACLLQGIGIGLFLTPLVSLSLAGLPPERIAAASGLQTAIRMMAGSLVASLASTYWDERSRYYQNVLVDSATPARPAVQDTLNALAGAGLDEPQSWGVIWNGLKTQADMLALNDFFLWSSLAFALSIALVWLARHPRAAKA
>NZ_CP054571.1|WP_024069797.1|1950773_1951478_+|siderophore-interacting-protein
MQPFSLPRRDVPCIVLRARDVARDMRRLTLGGPELSAWLARPGVDQPGAWVKVFPPGVPGRAYTLRGIDFEASSVEIDFVVHGDAPGTVSEWARRARPGDAVSIAGPRDGGFSLLADTRWVWLGADASAWPAASRIIESLPGGIQVLGVRHPAGDDDWPAIASARAPQWAARSLPPGGDEPSAPAPDGPGQVWLAGQAAWVKAWRAHWLQRLRFDPARLSAKGYWKAGEQDYKE
>NZ_CP054571.1|WP_006384576.1|1951513_1952404_+|LysR-family-transcriptional-regulator
MKKELDRMRDMALFVQVAALGSLTRAAESTGVPASTLSRRISEFESQIGVKLLHRSTRRLALTDIGQRYLERITDVVDRARAISGELEEEMGRPTGHLRVCAPVDFNAYFPEAALADYCASHPGVRFELHCSAQLPDLATEPYDICIATTEPPQASRMVRRRIGMAEYQLYAAPAYLRAYGVPAHPAELARHRCVVMPDSESGLALTDGNASAQVALAPLLVLNNQLAVENLLRDGLGIGPLTRGRADALVREGALAPVLPGWTLPPRPILALTASRALPARVRGFIDLLVARVVT
>NZ_CP054571.1|WP_024069798.1|1952444_1953218_-|dioxygenase
MRWPTLFVSHGSPMLAVEPGATGPALAAWSRSLGRKPGAILVVSPHWMGHGLALSTRDRQVAWHDFGGFPPELYTLQYAAPGSPELAARVQALLAEGGIAADRDPRRPLDHGAWVPLRYLYPEVDVPVVQLSLDMGRDAAGQLELGRALAPLRDEDVLIIGSGSLTHNLRDVRMPQDAPPAPYVPAFQAWYADRLAAHDVPALLDWQARAPGAAQAHPHDDHLMPLYVALGAGGARATRLTDEISYGALAMDAYAFD
>NZ_CP054571.1|WP_006387133.1|1953462_1954665_+|DUF2863-family-protein
MARSRSQSAPRLTRDATRLITLAQSLNRSGSRVEDVYWENQLGEAIPKLLKAGQDAPLEAALDHLAQGDVGAYEVLIEQAETLSESMKIDKNGVRYDILLIVAPVVAWTRYAIPTGPVPASAQQALLAQLHGHVLSSQARSALMPHLVSVDQMPRTFSETWQWLQRLGSQALGAETTKPALNTEVETANMLADTRYIVAAVAVPEFAPVFRWQEQIGEADASRDACLAQWAAQAQPTLAGLLPGCGFEALLPDAYYVSNREADRRVRPLSLRAAISWLEGAVSLDASQLRAVIAGCGESRVDEYRVSFTARNSNDVYYGCVWPLYGREEDLPADEGQPDVVDEIAALLKEYGVSDVRRIPGVLPPEYCEDCGAPYFPNPLGELVHAELPEDAEAAPAKFH
>NZ_CP054571.1|WP_024069800.1|1954674_1955790_+|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP
MQADIFCRVVDNYGDIGVCWRLARRLAHGHGWEVRLWVDDLASFARIQPGIDAGLARQAFNGVDIVRWSDAPDPALGARDVVIEAFACDPPEPFLDSMRQRHPAWINLEYLSAEAWVESCHGLPSQRPDGLVKHFYFPGFTPATGGLLREPGLSAERDAFQADTAAQDTFLRGLGVAEAHLSLRHNGARTMSLFCYPDAPVDGLARALAADPRPALLLAPEGVAPGLEAACAMPGGPAVARLPFVAQPDFDRVLWCADLNFVRGEDSFVRAAWAARPLVWQIYPQDENIHLEKLDAWLARYPAPETATALMRAWNQPGAGAATAAALAAALAPPAWQAWARAARDWDAAQAARPDLAENLAGFCAELAKKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054571_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054571_2

4930416-4930510

Orphan

Consensus_repeat	Method
GCCGTGGGGGCCGGCATCGGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054571_2

>merge|NZ_CP054571|2|4930416-4930510|CRISPRCasFinder
GCCGTGGGGACCGGGGCCGGCGCCGCCGTGGGGGCCGGCATCGGCGCCCTGATCGGCCATGGCACCGGCGCGGCCGTGGGCGCCGGCATCGGCGC

>NZ_CP054571|2|2|4930416-4930510|CRISPRCasFinder
GCCGTGGGGACCGGGGCCGGCGC	CGCCGTGGGGGCCGGCATCGGCGCCCTGATCGGCCATGGCACCGGCGCG
GCCGTGGGCGCCGGCATCGGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054571.1\|WP_024067769.1\|4919529_4921458_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP054571.1\|WP_006388843.1\|4932034_4933669_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|236158
NZ_CP054571.1\|WP_047992622.1\|4938947_4940516_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|236758
NZ_CP054571.1\|WP_006388841.1\|4931364_4931820_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP054571.1\|WP_006388844.1\|4933804_4934503_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054571.1\|WP_006388830.1\|4925439_4926084_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP054571.1\|WP_024067780.1\|4940534_4941326_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	unknown	unknown	gnl\|CDD\|234708
NZ_CP054571.1\|WP_006388831.1\|4926201_4926948_+\|3-oxoacyl-ACP-reductase-FabG	unknown	unknown	gnl\|CDD\|235500
NZ_CP054571.1\|WP_024067776.1\|4935348_4936389_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|225719
NZ_CP054571.1\|WP_006388829.1\|4923832_4925428_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP054571.1\|WP_006388842.1\|4931816_4932038_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054571.1\|WP_024067772.1\|4929554_4930238_+\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319787
NZ_CP054571.1\|WP_024067775.1\|4934662_4935349_-\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|133044
NZ_CP054571.1\|WP_006388826.1\|4918871_4919513_+\|DNA-3-methyladenine-glycosylase-I	unknown	unknown	gnl\|CDD\|377025
NZ_CP054571.1\|WP_058207216.1\|4936557_4938951_+\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|224369
NZ_CP054571.1\|WP_020925100.1\|4930981_4931308_+\|4a-hydroxytetrahydrobiopterin-dehydratase	unknown	unknown	gnl\|CDD\|234845
NZ_CP054571.1\|WP_024067771.1\|4929313_4929463_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054571.1\|WP_006388832.1\|4927518_4928463_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277358
NZ_CP054571.1\|WP_024067770.1\|4928588_4929212_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224103
NZ_CP054571.1\|WP_020925109.1\|4921753_4923826_+\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|225529

Protein	Function_ID	Function_description	E-value
NZ_CP054571.1\|WP_024067769.1\|4919529_4921458_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	3.36035e-84
NZ_CP054571.1\|WP_006388843.1\|4932034_4933669_-\|FAD-dependent-monooxygenase	gnl\|CDD\|236158	PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional.	0
NZ_CP054571.1\|WP_047992622.1\|4938947_4940516_+\|peptidylprolyl-isomerase	gnl\|CDD\|236758	PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional.	4.08084e-92
NZ_CP054571.1\|WP_006388841.1\|4931364_4931820_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	9.40517e-15
NZ_CP054571.1\|WP_006388830.1\|4925439_4926084_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.35841e-09
NZ_CP054571.1\|WP_024067780.1\|4940534_4941326_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	4.15353e-134
NZ_CP054571.1\|WP_006388831.1\|4926201_4926948_+\|3-oxoacyl-ACP-reductase-FabG	gnl\|CDD\|235500	PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.	9.38496e-90
NZ_CP054571.1\|WP_024067776.1\|4935348_4936389_-\|phosphotransferase	gnl\|CDD\|225719	COG3178, COG3178, Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only].	4.50518e-106
NZ_CP054571.1\|WP_006388829.1\|4923832_4925428_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.77993e-57
NZ_CP054571.1\|WP_024067772.1\|4929554_4930238_+\|HAD-IA-family-hydrolase	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.54201e-26
NZ_CP054571.1\|WP_024067775.1\|4934662_4935349_-\|nucleotidyltransferase-family-protein	gnl\|CDD\|133044	cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family. This is a subfamily of nucleotidyl transferases. Nucleotidyl transferases transfer nucleotides onto phosphosugars. The activated sugars are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Other subfamilies of nucleotidyl transferases include Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase.	2.80258e-82
NZ_CP054571.1\|WP_006388826.1\|4918871_4919513_+\|DNA-3-methyladenine-glycosylase-I	gnl\|CDD\|377025	pfam03352, Adenine_glyco, Methyladenine glycosylase. The DNA-3-methyladenine glycosylase I is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.	1.00409e-106
NZ_CP054571.1\|WP_058207216.1\|4936557_4938951_+\|LPS-assembly-protein-LptD	gnl\|CDD\|224369	COG1452, Imp, Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane].	8.45597e-136
NZ_CP054571.1\|WP_020925100.1\|4930981_4931308_+\|4a-hydroxytetrahydrobiopterin-dehydratase	gnl\|CDD\|234845	PRK00823, phhB, pterin-4-alpha-carbinolamine dehydratase; Validated.	5.33645e-45
NZ_CP054571.1\|WP_006388832.1\|4927518_4928463_+\|metallophosphoesterase	gnl\|CDD\|277358	cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain. PA3087 is an uncharacterized protein from Pseudomonas aeruginosa with a metallophosphatase domain that belongs to the phosphoprotein phosphatase (PPP) family. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.8882e-60
NZ_CP054571.1\|WP_024067770.1\|4928588_4929212_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|224103	COG1182, AcpD, Acyl carrier protein phosphodiesterase [Lipid metabolism].	8.9462e-33
NZ_CP054571.1\|WP_020925109.1\|4921753_4923826_+\|AsmA-family-protein	gnl\|CDD\|225529	COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane].	3.93388e-152

>NZ_CP054571.1|WP_024067772.1|4929554_4930238_+|HAD-IA-family-hydrolase
MSAVAAPAAYPRVVLFDLLTALLDSWTVWNAAAGSEARGRAWRAEYLRLTYGCGAYQPYEQLVEAAAVAVGLPASAPAALEAGWDQLAAWDGARELLAALRPHCRLGVVTNCSRRLGHRAAALLGVDWDVVVTSEEAGYYKPDPRPYQLALARLETPASQAAFVAGSGYDLFGTSKVGLATYWHNRVGLALPAGAPAPAAQSARLEDALPWLARFGGAGRDGTNCCA
>NZ_CP054571.1|WP_024067771.1|4929313_4929463_+|hypothetical-protein
MTRFNCKPGRSTRSRAAGRHVFVIVAIARTALDRAAHACRADFAQACQH
>NZ_CP054571.1|WP_024067770.1|4928588_4929212_-|NAD(P)H-dependent-oxidoreductase
MRLLNIESSPRGRRSASISIANAFIDAYGKACPALQVDTLNVWEEDLPEFDGKAIGAKYKGVSKEPLDPAEASIWTRIGALARRFQQADRIVLGVPMWNFDYPYKLKQLIDLVSQRGMLFGFDGKAYEPLLGIPRALVIHVRGQSHDPSTYAASPGFAHQADYLDFWLRFIGVKEIRRLMVEHTWDGRATETIARGRADAATMAADF
>NZ_CP054571.1|WP_006388832.1|4927518_4928463_+|metallophosphoesterase
MYDIIGDIHGEDLKLEGLLRCLGYVPAGRGYKAPQGHQAIFLGDLVDRGAGQRRVLEIVRAMMDDGQALCIMGNHEFNAIGYVTADPHNPGEFLRPNRGDSEKSRKNRKQHSAFINQIGEGSPEHAAWVAWFRQLPPYMDLGGIRVAHACWDDGAVKALADAGWLPGQPLDDAMLVATHEKGSDLERARKLLTSGAELALPDGRYIEDKEGHRHYEVRLANWRDWASALHEVALVPAGQEAQIHGLALPEGFNRTPTTGAPIFIGHHWFKGQPRIESGKLACLDWSAAAGGPLVAYRWDGEDTLSNEKLVWERA
>NZ_CP054571.1|WP_006388831.1|4926201_4926948_+|3-oxoacyl-ACP-reductase-FabG
MQNLNGKVAFVTGGSRGIGAAIVRRLAADGADVAFTYVSASSRDSAAALARELEAGGRRARAIQADSADPAQVRQAVEQAIDELGPVDVLVNNAGIFLAGPLGEVTLDDYERTMNINVRAPFVAIQAAQASMPDGGRIINIGSCLAERSGRAGVTLYSASKSALLGMTRGLARDLGARGITANVVHPGPIDTDMNPADGERAGDLVAVLSLPHYGETRDIAGMVAFLAGPDGRYVTGASLAVDGGYAA
>NZ_CP054571.1|WP_006388830.1|4925439_4926084_-|TetR/AcrR-family-transcriptional-regulator
MAERGRPRNFDRAQALRKAMEVFWSKGYEGASLTDLTAAMGINSPSLYGAFGSKEGLFREAVQLYRDTDGAASRRALAAGATAREGVCGMLLAAAERFTAPGAPPGCLIVLGAPSGAESHDGVGVFLGDNRREMQSRILARLTAAASAGELPAGADLKGLAAFYTTILHGMSIQARDGASRKTLQAVARQAMCAWDALTGSAPQSDPPSGRAHA
>NZ_CP054571.1|WP_006388829.1|4923832_4925428_-|GGDEF-domain-containing-protein
MLRIDLRRLILWISLLSIFLVLAAGLHASYLVQRDLLLHNALESNRVYAAKLAATTEYFLGDLRRHLAYSADVLADMETHPGLMASETRRQEEQLGHFNSSFVVSAQGEVLAVSTSYPQLRGQHMTSDAAKTALTTRRPFISEPFRASNGRWLILYTHPIFSRDYRYLGYIAGTLYLHEDNVLDRLLGQHFNRDDSLLYVLSRDGTLIYHPDRSRLGQASADKAALAAALRGETGEIRFTDASRNAILAGYAPVPSTGWTIIAQRPVASTLLPLNDLLMATARNTLPLLVMSIVLIWLLSRWIARPLGELAGIAKRMQDPDSAERIRKVRSWYFEASQLKRALLMGLTSIQHKIRDLRRASTTDTLTSLLNRRGLNEAMALLQAAETPLAIVALDIDHFKNINDRYGHAAGDRALQILAALLTEGSRGGDTVARSGGEEFVMLMPGASLAAAVGAAERLRLKLERLGTDTGLPAPITLSAGVACYPAHGATLDEVMQRADRALYYAKNHGRNAVCVADNHAADGARMALPR
>NZ_CP054571.1|WP_020925109.1|4921753_4923826_+|AsmA-family-protein
MTRKTKIAGGIVGGIVLLVAVLVVVVATFDWNRARPMINERVSAAIGRPFAINGDLSVEWSRESDEGGWRAWVPWPRVVANDISVANTEWGKAPQFATLKRGEFSLSPLPLLSQRVVIRRIQLTEPAADLERLADGRANWVFTLPESGEPSPWVLDINEIGFDKGRVGLSDAILQADLTVVVDPLGKPVPFADVAGASFVPEDAAATAPRDYVFGWKAEGKYKGLATKGEGKVGGMLALQDPRQPFPVQADVTIGGTKAAVAGTLTDPVNLGALDLRLKLSGGSMAQLYPLTGVTLPDTPPYSTDGHLVAKLRNAGGAVFDYRDFNGRVGGSDLHGDVSFALSAPRPKLTGKLTSRQLRMEDLGPLIGVPSGKQAPAQDKPKDAPAKRAGGKVLPTQAFRTDRWRDMDADVALEAGRIVHDAKLPLSDLSVHLVLQDGQLTLDPLRFGMAGGSMAATVRLDGSQQTLTGRVDMHARRLRLKQLFPSAQAMQKTLGELNGDLALSGTGNSVAALLGSASGDVKMLVNDGVISRSLMEIAGLNVGNYVVSKLFGDDEVKINCGAADLSMKNGVMTPRVFVFDTENALINITGTTDFKNEKLDLDITPDSKGFRIFSLRSPLYVRGTFGSPDVGVHVGPLAARGAGMVALGVILTPAAGLLALIAPSTTDDNSCGTLLKQMRTPPKAPAPKGK
>NZ_CP054571.1|WP_024067769.1|4919529_4921458_-|LTA-synthase-family-protein
MRHSSLIFVVAAFALLTLSRLALAAWQWQRVRNAGGLLPLLLGGLRIDAHQIGVMAALPAVLSPWFGHLPFAATAAGIWYLVAFILMAFLEVATPPFILEYDTRPNRLFVEYLKHPREVSGMLWRGYKGALLGGFGALGLIGWGAYELFGHAVPDAPLAWWQMPLASLAILAVVILAIRGTLGHRPINPSSVAYSSDGMLNTLALNSLYNVFYAVYSMKNEKSASAVYGGMDDDDMHRRVLAQAGLPYPPANADHPSLHRQPASRKTARPLNLVIILEESLGAQYSAGLGGMDLTPELDALARQAWTFTRAYATGTRSVRGLEAVVTGFLPTPAQAVLKLPRSQRGFFSLADLLGRHGYHSRFIYGGESHFDNMKGFFLGNGFKQIVDREDFVDPAFVGTWGASDEDMFNQLDRLLREDGDQPTFTLAFSVSNHSPWEYPAGRIQTDGNPATVENTVRYADWALGRFFERAKDAPYWENTVFLIAADHDSRVFGASLVPVRHFHIPAVILGAGIEARRDDRLISQIDLAPTLLSLIGVDTEHPMLGHDLTRSTPGRAIMQYDNTYGYLKENDLLVMAPNKTPVQYRYTAPEDYAPVALDPELAEEALAHALWPSWAYREGRYCIPAAAAPAQTASAPLTATR
>NZ_CP054571.1|WP_006388826.1|4918871_4919513_+|DNA-3-methyladenine-glycosylase-I
MNANSDFSDGLARCGWVDTSAEYMAYHDTEWGFPQGDDRALFEQLCLEGFQSGLSWRTILSKREAFRRGFAGFDPAKVARFGEAQIQALLADAGIVRHRGKIEAVINNAQRALEMIEREGSLGAFLWRFEAPAGASSTRGASTSAQSEALSKALKKLGWKFVGPTTVYAFMQSVGMVNDHHPDCHCHAPSERARKVFRRPAQAAADKGGAAGP
>NZ_CP054571.1|WP_020925100.1|4930981_4931308_+|4a-hydroxytetrahydrobiopterin-dehydratase
MSMFPPARIGTDTAVAALSGWQAVAMRDAIEKRFRFPNFNAAFGFMARVAMFAEKLNHHPEWTNVYNRVDVMLTTHDAGGVTELDVRMAQFMDEAAAQMGATAPKAGL
>NZ_CP054571.1|WP_006388841.1|4931364_4931820_-|winged-helix-turn-helix-transcriptional-regulator
MTTPALERFLTYRLHVINKITDRDTNRAYLEDCGIPLGEARCLAAIGRYAPLSVNDLARAANLNKGQASRSAQALAGRGLIEKKDSAADGRGVVLSLTPTGQAQYRRIIDLIARRNQDIFGCLSAEEQRQLGDMLDRLIAHQRERPEAPQD
>NZ_CP054571.1|WP_006388842.1|4931816_4932038_-|hypothetical-protein
MNDDQLDQVYTRMAQALTRVGEARAPLFLSILGLSALARLPDAQAACALLAQAEAACAAPVANYPAATADSPT
>NZ_CP054571.1|WP_006388843.1|4932034_4933669_-|FAD-dependent-monooxygenase
MTLPAHVPVLIVGGGPVGLTLAALLAHYGIASLTLEADDGYCDGSRAICISRRSQEILGWIGADAALNATGLPWTGGRSYYRDREVLHFEMPHDPLQRFAPMVNIQQYFVEEYAHQALQRQPGPAALHWSARAVGVRSTADGVQVDVDIAGHRHALRADWLVACDGGRSSVREALGLKLEGMQYEGRYVIVDIEQASHRPVERLAWFDPPSNPGSTLLMHRQPGNVWRVDYQIRDDEDAADAVAPGNVLPRVQSHLDMIGETAPWKPLWISLYNAKCLTLERYRHGRVLFAGDAAHLVPIFGVRGLNSGLDDAGNLAWKLAWVLRGQAPDSLLDSYSDERVHATRQNLAYGAKSTEFMAPPDFGFRLMREAALRLALSDERARPLINPRQSAPISYEGSPLNLADDAAAQPLAAAPGQPAPDLLLADADAVPRYLSACFGQGFVLLACAPDAAMAAGLQRLAAATRQAPCPLVTIVVGGPAPGAWSDPHGHLHERFGAQPGTVWLLRPDGYVMGRWAMLDATALRAALAPYYPMLESSRQETQP
>NZ_CP054571.1|WP_006388844.1|4933804_4934503_-|hypothetical-protein
MFGRSQRAVFKPSVYQPGQRTRRMPRWLVLLLVGIALGAGGVLFLQTNYGPQRLTVEQSEQLHTELSASKLENQRLQSQLEEATQQRDANKSGHEKLTADLADARAKLDTLNKELVLFQDAMPPDPRGGNLGIRSATFKRQPGLLDYQVLVMREERTGAPFKGTLTFSIDGSYSNGRAATVTPEGPALNVDRYDYALGQLKLPDGFTPKVVVLRVMDGNQKQQAMRIYYVRN
>NZ_CP054571.1|WP_024067775.1|4934662_4935349_-|nucleotidyltransferase-family-protein
MRAMILAAGRGERMRPLTDRLPKPLLPVGGKPLIAWHLERLAAAGFRDVVINHAWLGHEIERALADGAAFGLRIRYSPEAAALETAGGIAQALPLLGPDPFLVINGDIWCDWNPAAAPALATALPTGGAWLLMVDNPPQHPLGDFALDRDGRVRADGEPRLTFSGIGVYHPMLFAGVARGTAARLAPLLRQAMEHDHVRGARHTGRWVDVGTPQRLADLDAELGSSPV
>NZ_CP054571.1|WP_024067776.1|4935348_4936389_-|phosphotransferase
MKNDHDPRLEQIRAWLQGLPAALGLAVDTLRPASADASFRRYFRLDAAGRTLIVMDAPPQHEDCRPFLHVDQLLSDAGLNVPAVIEQDLAQGLLLLSDLGEQTYYQRIQDGVDDASLQSMYRDALAALVRLQQARTTGLAHYDSARLADELKLFPEWYVQKHHGATLDDKTAQALEKIFALLSASNGNQPTVLVHRDYHSPNLMVCDQPQYGPNPGVIDFQDALAGPITYDLASLVTDARTTWEEPQQLDWAIRYWEMARAAGLPVDADFAEFHRAYEWMGLQRNLRILGVFARLNHRDGKAHYLAHMPRVNGYVRQVAQRYGVFTPLLRLLDRLDDRQVSVGYTF
>NZ_CP054571.1|WP_058207216.1|4936557_4938951_+|LPS-assembly-protein-LptD
MRKVRWLILSAISVAGAVQAQGSQGSASSATSITAAPELRTSPGLRMHRLPDGNIPAYMEADTIEGDPDSDLTLTGAAQVRRIDGVIKGDRINYRKDTGEVDVQGNARMMRDGTLVTGPNAKFNVDKYSGEVEKPNFWLGATGGFAVADKADIFSKSQMRLHTVTYSGCSCETPSWYIKANMVDIDFDENEGVARNGVLYFKDVPILASPYMTFPVKKERKSGFLMPTYGTTSKGGFDFSLPYYLNIAPNYDATLQPRYFSKRGLQLGGEFRYLGASYAGSVYGAYLPHDNVSGEDRWMYWWRHQQLLGNGFYADWDVAKVSDNDYFRDISQLGLNQASTTYLPQRARVGWSSTYWSAYAQVYKYQTLQDPDALLTPPYDKQPELYLRGARYDWGGFDVDWTSTAVRFSKPLFLGNRNGPNGDRLQTYPTVSYPIVRPGWFVIPKAGVNYTQYQTDWYHGDWLGLNSGTANAGTSFGYPRSQSRTVPIMSLDAGLIFERDTTLFGKDSIQTLEPRLYYLRVPYRDQSKIPVYDTSLSDFSFSQAFDENIYSGGWDRISNANQLTAALTTRWLDASTGFERASVAVAQRLYFADQKVTLPGETPRENVRSDFLVGASAALTDTLTTDVAAQYNPYDNQWSRGLLSARWSPQRLTTVALAYRYQRDPQPGVLYQPQGQNQISLAVQWPFTKRWYGVGRVDYSLRDGPSSTVNGTTDSPRVTQAIAGLEYKGDCCWVGRMVFQRYAVSATDANTALFFQLELTGLGSLGTDPMNLLNRSIPGYSRITPPAPTGTTFERYE
>NZ_CP054571.1|WP_047992622.1|4938947_4940516_+|peptidylprolyl-isomerase
MMRRLHSLRRFSGNALLLAVCAAFSAAHAAEPNGKGTKNAPAATQKSAPAPAGEQFVDGIAAVVDKDVITLRELRDASLRIAAELKTRGIQVPDDKALQHQVLQRLIMERVQRHEADRLGIRVTDAQVDQAITTIAGRNKISVAQLRAEIEKSGVSWDSYRKSLMDEIRSDRLRQRAVDSTIVISDAEVDAFLKDQRRNPAFAAAPQQAQPQPQPEAAPEQAAAPAGPMLYAVAQILVRVPEGSSPEQLAALRKKAEDLLARVKRGDDFASLAAASSDGPEALQGGVMGVRPLDGWPDLFAKAIANLQKGQVSGLLQSGNGFHILKVMDRGTAQPAPSRTARAPVPTPAPQPRPQPQAQAPQGPVEVMQTHARHILIKTSTVMSDEQARQRLEQVRQRLVAGDAKFDDMARQYSQDATAPQGGDLGWLNPGETVPPFEAAMNALKPGEISQPIQTPFGWHLIQVEERRQHDATDDLARMKARQTLFERRAQPAFEDWLDQLRAQAYIDNRLEKQDRINQNNR
>NZ_CP054571.1|WP_024067780.1|4940534_4941326_+|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA
MSQHQARKRFGQNFLTDESVVESIVRAVNPARGDTVVEIGPGLSALTRPLLERLDHLTAVEIDRDLAARLRKQFEEGRLTVVEADALTVDFSQFGAGLRVVGNLPYNISSPLLFHLMAWADHVRDQHFMLQREVIDRMVAQPGSGDFSRLSVMLQSRYRMHKLFDVPPEAFDPPPKVVSAIVRMVPLPAERLRPVSARAFETVVARAFSQRRKMLRRVLADWAPQVPWEALDIAPTARAEDISVDRYIRLSDALVEAGVLQGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054571_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054571_3

6300158-6300274

Orphan

Consensus_repeat	Method
GGGGGGCAGCGACCCGCGCAGCGGCGGAGCGTGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054571_3

>merge|NZ_CP054571|3|6300158-6300274|CRISPRCasFinder
GGGGGGCAGCGACCCGCGCAGCGGCGGAGCGTGGGGGCCTTTTTTTGCCGCCGGGCCGCCCCAAGGCAAAAACGCCCCCTCGGGGGGCAGCGACCCGCGCAGCGGCGGAGCGTGGGG

>NZ_CP054571|3|3|6300158-6300274|CRISPRCasFinder
GGGGGGCAGCGACCCGCGCAGCGGCGGAGCGTGGGG	GCCTTTTTTTGCCGCCGGGCCGCCCCAAGGCAAAAACGCCCCCTC
GGGGGGCAGCGACCCGCGCAGCGGCGGAGCGTGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054571.1\|WP_006387995.1\|6297444_6298683_-\|ammonium-transporter	unknown	unknown	gnl\|CDD\|182630
NZ_CP054571.1\|WP_006387988.1\|6289684_6290599_+\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NZ_CP054571.1\|WP_006218735.1\|6298714_6299053_-\|P-II-family-nitrogen-regulator	unknown	unknown	gnl\|CDD\|366157
NZ_CP054571.1\|WP_024068408.1\|6300320_6300572_+\|accessory-factor-UbiK-family-protein	unknown	unknown	gnl\|CDD\|377337
NZ_CP054571.1\|WP_006387989.1\|6290941_6292894_+\|threonine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234752
NZ_CP054571.1\|WP_006388004.1\|6308721_6308880_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054571.1\|WP_006387997.1\|6302676_6302874_+\|50S-ribosomal-protein-L35	unknown	unknown	gnl\|CDD\|234676
NZ_CP054571.1\|WP_006388000.1\|6304364_6306782_+\|phenylalanine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234804
NZ_CP054571.1\|WP_006387992.1\|6294624_6295026_+\|PTS-mannose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|225446
NZ_CP054571.1\|WP_006388002.1\|6307181_6307613_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133393
NZ_CP054571.1\|WP_024068411.1\|6302891_6303251_+\|50S-ribosomal-protein-L20	unknown	unknown	gnl\|CDD\|179959
NZ_CP054571.1\|WP_026385253.1\|6293629_6294607_+\|glutathione-synthase	unknown	unknown	gnl\|CDD\|235371
NZ_CP054571.1\|WP_006387993.1\|6295136_6295406_+\|HPr-family-phosphocarrier-protein	unknown	unknown	gnl\|CDD\|376329
NZ_CP054571.1\|WP_006388001.1\|6306785_6307124_+\|integration-host-factor-subunit-alpha	unknown	unknown	gnl\|CDD\|178961
NZ_CP054571.1\|WP_026385254.1\|6295530_6297225_+\|phosphoenolpyruvate--protein-phosphotransferase	unknown	unknown	gnl\|CDD\|224006
NZ_CP054571.1\|WP_024068407.1\|6299596_6300031_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP054571.1\|WP_049051311.1\|6300657_6302220_+\|YifB-family-Mg-chelatase-like-AAA-ATPase	unknown	unknown	gnl\|CDD\|223679
NZ_CP054571.1\|WP_006387999.1\|6303328_6304351_+\|phenylalanine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|234780
NZ_CP054571.1\|WP_024068413.1\|6308074_6308512_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054571.1\|WP_076410237.1\|6292914_6293466_+\|translation-initiation-factor-IF-3	unknown	unknown	gnl\|CDD\|234582

Protein	Function_ID	Function_description	E-value
NZ_CP054571.1\|WP_006387995.1\|6297444_6298683_-\|ammonium-transporter	gnl\|CDD\|182630	PRK10666, PRK10666, ammonium transporter AmtB.	0
NZ_CP054571.1\|WP_006387988.1\|6289684_6290599_+\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	1.2411e-113
NZ_CP054571.1\|WP_006218735.1\|6298714_6299053_-\|P-II-family-nitrogen-regulator	gnl\|CDD\|366157	pfam00543, P-II, Nitrogen regulatory protein P-II. P-II modulates the activity of glutamine synthetase.	1.56881e-56
NZ_CP054571.1\|WP_024068408.1\|6300320_6300572_+\|accessory-factor-UbiK-family-protein	gnl\|CDD\|377337	pfam04380, BMFP, Membrane fusogenic activity. BMFP consists of two structural domains, a coiled-coil C-terminal domain via which the protein self-associates as a trimer, and an N-terminal domain disordered at neutral pH but adopting an amphipathic alpha-helical structure in the presence of phospholipid vesicles, high ionic strength, acidic pH or SDS. BMFP interacts with phospholipid vesicles though the predicted amphipathic alpha-helix induced in the N-terminal half of the protein and promotes aggregation and fusion of vesicles in vitro.	2.31634e-18
NZ_CP054571.1\|WP_006387989.1\|6290941_6292894_+\|threonine--tRNA-ligase	gnl\|CDD\|234752	PRK00413, thrS, threonyl-tRNA synthetase; Reviewed.	0
NZ_CP054571.1\|WP_006387997.1\|6302676_6302874_+\|50S-ribosomal-protein-L35	gnl\|CDD\|234676	PRK00172, rpmI, 50S ribosomal protein L35; Reviewed.	5.92937e-23
NZ_CP054571.1\|WP_006388000.1\|6304364_6306782_+\|phenylalanine--tRNA-ligase-subunit-beta	gnl\|CDD\|234804	PRK00629, pheT, phenylalanyl-tRNA synthetase subunit beta; Reviewed.	0
NZ_CP054571.1\|WP_006387992.1\|6294624_6295026_+\|PTS-mannose-transporter-subunit-IIA	gnl\|CDD\|225446	COG2893, ManX, Phosphotransferase system, mannose/fructose-specific component IIA [Carbohydrate transport and metabolism].	5.57584e-23
NZ_CP054571.1\|WP_006388002.1\|6307181_6307613_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133393	cd04765, HTH_MlrA-like_sg2, Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 2), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	9.75016e-41
NZ_CP054571.1\|WP_024068411.1\|6302891_6303251_+\|50S-ribosomal-protein-L20	gnl\|CDD\|179959	PRK05185, rplT, 50S ribosomal protein L20; Provisional.	8.30203e-63
NZ_CP054571.1\|WP_026385253.1\|6293629_6294607_+\|glutathione-synthase	gnl\|CDD\|235371	PRK05246, PRK05246, glutathione synthetase; Provisional.	0
NZ_CP054571.1\|WP_006387993.1\|6295136_6295406_+\|HPr-family-phosphocarrier-protein	gnl\|CDD\|376329	pfam00381, PTS-HPr, PTS HPr component phosphorylation site.	1.83273e-32
NZ_CP054571.1\|WP_006388001.1\|6306785_6307124_+\|integration-host-factor-subunit-alpha	gnl\|CDD\|178961	PRK00285, ihfA, integration host factor subunit alpha; Reviewed.	9.73249e-63
NZ_CP054571.1\|WP_026385254.1\|6295530_6297225_+\|phosphoenolpyruvate--protein-phosphotransferase	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
NZ_CP054571.1\|WP_024068407.1\|6299596_6300031_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	6.44042e-06
NZ_CP054571.1\|WP_049051311.1\|6300657_6302220_+\|YifB-family-Mg-chelatase-like-AAA-ATPase	gnl\|CDD\|223679	COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP054571.1\|WP_006387999.1\|6303328_6304351_+\|phenylalanine--tRNA-ligase-subunit-alpha	gnl\|CDD\|234780	PRK00488, pheS, phenylalanyl-tRNA synthetase subunit alpha; Validated.	0
NZ_CP054571.1\|WP_076410237.1\|6292914_6293466_+\|translation-initiation-factor-IF-3	gnl\|CDD\|234582	PRK00028, infC, translation initiation factor IF-3; Reviewed.	6.16089e-98

>NZ_CP054571.1|WP_024068407.1|6299596_6300031_+|hypothetical-protein
MMNTQRKTFAVLALAAALAALAGCNKSDEKAAPPAASTTPAPSTTTPGTPPAATTPPATTAPSGSGAPAGATAGLPAECDAYLTQVSACMDKLGASNPAAASFKQQLDAAKTQWATISDKTQLASQCKQSADLFAQSASQMGCK
>NZ_CP054571.1|WP_006218735.1|6298714_6299053_-|P-II-family-nitrogen-regulator
MKLIIAIIKPFKLDEVRVALSGIGVQGLTVTEVKGFGRQKGHTELYRGAEYAVDFLPKLRVEAAVPDHLVDQVIEAIEQAARTGKIGDGKIFAAPLEQVIRIRTGEAGEAAL
>NZ_CP054571.1|WP_006387995.1|6297444_6298683_-|ammonium-transporter
MDKADISWLLVSTLLVLMMAVPGLAMFYGGLVRSKNVLSVLLQVMCTFVLGLVLWFIYGYSLAFTEGNAFFGGLSRAFFSGMFTPADGKYAMSNSLTELLFASFQATFAGITCALIVGSFAERARFSAVLVFTVIWFTFAYIPIAHMVWFASETAPGLLNAKGALDFAGGTVVHINAGVAGLVGAYVVGKRVGYGREAMQPHNLPMTFVGAALLWVGWFGFNAGSALAANENATLAFFNTMIATAGAVLAWLFTEWAIKGKPSMLGAASGAVAGLVGITPAAGLVGPVGALIIGVVAGVVCVWGVNGLKRLLRADDALDVFGVHGVGGIVGALLTGIFNAQALGGPGLAEPGMILGQLWVQLEGVLLTIVWSGVVAWIAYKIANALCGLRVPEDQEREGLDVTSHGESAYHS
>NZ_CP054571.1|WP_026385254.1|6295530_6297225_+|phosphoenolpyruvate--protein-phosphotransferase
MARGYAIGRAVVMGAAALEVAHYRIAPEDVPAESSRLTEALASAQQELRQLADTLPADAPRELGAMLNVHSLLLGDPLLAEQTLALIAERHYNAEWALTTQGQILGQQFDAMEDEYLRERGADVRQVIERVLHVLSGTSAILPDMSHMGGDEALVVVAHDISPADMLRLRGGRFAAFVTDLGGPTSHTAIVARSMGVPAVVAMGNVRELVRDGDMLIIDGAAGAVVVNPSERILQEYRRRQAAYADERAELGLLRDEPSVTLDGIDIVLHANIELPEEAALALASGAHGIGLFRSEFLFMGRPDLPGEEEQYEAYASVVKVMAGRPVTIRTLDIGSDKTLDGEATVATNPALGQRAIRYCLARPEMFATQLRAILRASAHGPVRLLIPMIAHMHEVVATRAAIESARRELDARGQAYAAHMEVGAMVEVPAIAIAIEPFAQALDFLSIGTNDLIQYTLAIDRGDHDVASLYDPLHPAVLRLVAHTINAGERAGKPVAVCGEMAGDSRMTRLLLGLGLTEFSMHPQQLLDVKREVRRAHTNALRVKVASALNRALPVDLDTLDLA
>NZ_CP054571.1|WP_006387993.1|6295136_6295406_+|HPr-family-phosphocarrier-protein
MPNTDIVISNKLGLHARAAAKLTQLASKFSSEIFISRGAQRVNAKSIMGVMMLAAGLGVTVKLEASGSDAEQALSEIETLFDSKFGEQE
>NZ_CP054571.1|WP_006387992.1|6294624_6295026_+|PTS-mannose-transporter-subunit-IIA
MTTGIVIVVHAPLGAAMRECASHVMGNLDGMLAIHDIQPEDLPDDLAPAVLKDILEQDHGGGVLVLTDLIGATPANISKRAVADAQAQGIQCCVLAGLNTPMLLRALTYRNLSLAETREKALAGGVQGVLRVD
>NZ_CP054571.1|WP_026385253.1|6293629_6294607_+|glutathione-synthase
MHVLFVLDPLPLLKAYKDSSVAMMRALVARGHTLSVAMQGDLYIETGTVKAVTTPIELVDGADLHGHDWWRESAPQDLPLADFGAVVMRKDPPFDMEYVYSTHLLEYAQAQGAKVFNGGAAIRNHPEKLAITEISEFTAPTLVTRNMARLKAFHDTHHDVIVKPLDGMGGTGVFRLQPKDPNLNAILETLTDNGARTIMAQRYIPEIVKGDKRILLIGGEPVPYSLARIPLAGETRGNLAAGGRGVAQPLSPRDREIAEAVAPRLAARGLLLVGLDVIGDYVTEVNVTSPTCFVEIAEQTGFDVAGMFVEALEKAVATGAVAAAA
>NZ_CP054571.1|WP_076410237.1|6292914_6293466_+|translation-initiation-factor-IF-3
MATEKANRINGEIRVPEVRLIGLDGEQLGIVKIADAFRLSEQNDVDLVEIAPNAEPPVCRLMDYGKFKYQEQKRQAEARSKQKVIQVKEVKFRPATDEGDYQVKLRNLRRFLEEGDKAKVTLRFRGREMAHQELGMRVLERVRDDLLELAQVEAMPKLEGRQMVMVLAPKKKAAPAGKPESAA
>NZ_CP054571.1|WP_006387989.1|6290941_6292894_+|threonine--tRNA-ligase
MVQITLPDGSQRQYPGPVTVAEVAQSIGAGLAKAALGGRVTFDGADSTLVDTSYRIEGDARLAIVTAKDADGLDMIRHSTAHLLAYAVKELFPDAQVTIGPVIDNGFYYDFSYKRPFTPEDLAAIEKKMAELAKKDEVVTREVWSRDDAVEFFKGIGEKYKAEIIASIPSNEPLSLYREGEFIDLCRGPHVPSTGKLKVFKLMKVAGAYWRGDSKNEMLQRIYGTAWATKEEQEAYLHMLEEAERRDHRKIGRELDLFHFQDEAPGLIFWHPKGWALWQQVEQYMRSVYRDNGYQEVKAPQILDISLWKKTGHWDNYRENMFTTESENRVYGLKPMNCPGHVQIFNAGLHSYRELPLRYGEFGQCHRNEPSGSLHGMMRVRGFTQDDGHIFCTEEQLQDECADFTALLQKVYRDFGFTEVLYKVATRPEKRIGSDEVWDTAEQALMESLRRTGCEFEISPGEGAFYGPKVEYTLKDAIGRHWQCGTIQVDFSMPVRLGAEYVDQNDQRRPPVMLHRAILGSLERFIGMLIENHAGAMPPWLAPVQAVVCCISEPSADYAAEITQSLKKQGFRVESDLRGEKITRKIREHSLQKVPYILVVGDKEKQNGTVAVRGLGGLDLGAIAFDDFVARLSEDVSTRRDVNQPDGSAA
>NZ_CP054571.1|WP_006387988.1|6289684_6290599_+|dTDP-4-dehydrorhamnose-reductase
MPKKILVIGRDGQLGFELRRSLAPLGVVTAVGRADCDLTYPLQIARLVRREKPDVIVNAAAFTAVERAQEDGVRAMRINAEAAGELSALAAERGALIVHYSSDYVFDGAKPGAYDERDTPAPLNVYGRSKLAGEQAVRAMNPAHLVFRTSWVYGVFGNSFLKTMLMALRQPETLRVVSDQRGAPTGAAYIADATALVLARYLARPADEAFPFGLYHLAATGDASWHEYACFIAQQARRAGLAVTLTPADIRAVPSDQYPTTARRPLNSRLDSRLLERTFGIRAPHWEDGVTHALAAIADSRNLA
>NZ_CP054571.1|WP_024068408.1|6300320_6300572_+|accessory-factor-UbiK-family-protein
MNNRTQWMEDIQKNISDLIARSPAADVERNVRALMTQAFSKLDLVTREEFDVQADLLARTRARVDQLSATVEQLESRLAALDK
>NZ_CP054571.1|WP_049051311.1|6300657_6302220_+|YifB-family-Mg-chelatase-like-AAA-ATPase
MTLAVIASRTLSGLHAHAVRVETHLGPGLPSFNVVGLPDTEVRESRERVRAAILNSGFNFPAGRITVNLSPADIPKESGRFDLPIALGLLLAAGQLAPREEGAREEGAREGGAGAADAAAPDPLLAGLVLAGELSLTGALVPVSAALVIALSVARESPGATLILPAGSAEQAAWVEGLRVLSARSLADVAAHVAGVCRLPDAIAASWPAAPPAPCLSDVRGQPGARRALEVAAAGGHSLLMVGPPGAGKSMLAARLPGLLPPLARTQALEVAAIAALAGAPDARMGTPPFRAPHHSASPFALVGGGGRPRPGEISLAHHGVLFLDELPEFSRRTLEALREPLETGRVVIARALHTAQFPARFQLVAAMNPCPCGWRGHPRRACQCTPDQVARYAGKVSGPLLDRIDLYVTLPPPDLESLQGPPGEASAPVRARVARCRERQLARQGKSNAGLAGAELERHCPMDPSAQALLLQAMRRLAGSGRALHRALRVARTIADLDGADTLQASHVAQAVQYRRPGV
>NZ_CP054571.1|WP_006387997.1|6302676_6302874_+|50S-ribosomal-protein-L35
MPKMKTKKSAAKRFQVRGSGSIKRGQAFKRHILTKKTTKNKRQLRGSAAVHETNVASVKAMMPFA
>NZ_CP054571.1|WP_024068411.1|6302891_6303251_+|50S-ribosomal-protein-L20
MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRALWITRINAAVREHGVSYSVFIAGLKKAAIELDRKVLADLAVRDKAGFAAIVQQAKAALAA
>NZ_CP054571.1|WP_006387999.1|6303328_6304351_+|phenylalanine--tRNA-ligase-subunit-alpha
MTQSVDDLVSQAQERFAAATDAAALENAKARFLGKDGALTVLLKGLGKLDPEQKRDMGARINQAKQKVEELLNLRRAALAQAELDARLASETIDVSLPGRGRVPGGIHPVIRTWERVEEIFRSIGFDVADGPEVENDWTNFTALNNPLDHPARSMQDTFYVDMKDADGLPLLLRTHTSPMQVRYARMHKPPIKVIAPGRTYRVDSDATHSPMFHQVEGLWIAEDISFADLKGVYTDFLRCFFESDDLVVRFRPSFFPFTEPSAEIDMMFTSGPNRGRWLEISGSGQVHPQVVRNFGLDPERYIGFAFGSGLERLTMLRYGVNDLRQFYEGDLRFLRQFNE
>NZ_CP054571.1|WP_006388000.1|6304364_6306782_+|phenylalanine--tRNA-ligase-subunit-beta
MQFPESWLRTLVNPPIATDELAHRLTMAGLEVEDTVPAAPAFTGVVVAHIVEIAPHPDADKLRVCQVDDGSGALLQIVCGAPNAAAGLKVPLARVGAELPGGMKIGVAKMRGVQSSGMLCSARELGLSQDHAGLLELPADMAPGQSIREALDLDDTLFTLKMTPNRADCLSILGVAREVAALTGAPLSVPTAKAVPVTLDELRPVRIEAPDLCGRFGGRVIRGVNARAQTPAWMKTRLERAGQRSVSALVDISNYVMLELGRPSHVFDLDKIHGDLSVRWAREGETLELLNGQTVTLDSKVGVVVAGDQVESLAGIMGGEATAVTLDTQNIYLEAAFWWPQSLAGRARRYKFSSEASHRGERGVDFATIPQHIEFITRLIVDICGGQAGPLDDQIVNLPKREPVRMRLARCHRVLGVPVTQAEVAKIFGSLGLEFTLDGDDFVVTPPSYRFDLEIEEDLIEEVARIYGFENIPTVPPLARAKMFSQPEVRRGPHALRRLAAAQDYQEVVNYSFVEAEWERDYAGNDTPVKLVNPIASHLSVMRSSLIAGLVANIRHNANRKQTRVRLFELGRVFARDDAAKDGPLEVAGVRQPLKLAGAAWGPSVEEQWGVPARQVDFYDVKMDVEALFGARGARLRFEAAAHPALHPGRSARITLDGTQVGWLGELHPRWAQQADLAHAPVVFELDVQALSEGELPQVRELSRQPVVVRDLALWVDAPVTVQSMLDTVAATVKADPQLAVVQDVRLFDVWREKPQGDQPVAEKSLAFRFWLQDTEVTLDEARVAACLARIKDALVSAHGARQRA
>NZ_CP054571.1|WP_006388001.1|6306785_6307124_+|integration-host-factor-subunit-alpha
MGNSMLAEPRTLTKAELAELLFERVGLNKREAKDIVDTFFEEIRDALARGDSVKLSGFGNFQVRDKPPRPGRNPKTGETIPIAARRVVTFHASQKLKSVVEQATPAAPDAEE
>NZ_CP054571.1|WP_006388002.1|6307181_6307613_+|MerR-family-transcriptional-regulator
MTRTESTVTLPPIPAKRYFTIGEVSDLCGVKPHVLRYWEQEFTQLKPVKRRGNRRYYQHHEVLLIRRIRSLLYEQGFTISGARNRLGDARDTPHDQDAAVRLSGAEMQALRNELGNVSTMLGEALGSAATASSGNAVSANATA
>NZ_CP054571.1|WP_024068413.1|6308074_6308512_-|hypothetical-protein
MLKSICRIAPAVILPLTLSACMGLSVYSPTRNKLNAQVGKNINEMLPAWPPETGAKPFVNKVDDQTTSYTYVYGYHPGHYEGRGYSTNGPMGTTYGSYCAYVPEYTDCAVIFYTDKAGTVLRYDMKTNGKISYNSCGEYISGFRF
>NZ_CP054571.1|WP_006388004.1|6308721_6308880_-|hypothetical-protein
MKWLLISLLCLSCTGCGLAAAPCRVTSAVIKIVPVVGGVAAAPTDACAEVID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP054571_3	3.1\|6300194\|45\|NZ_CP054571\|CRISPRCasFinder	6300194-6300238	45	NZ_CP054571.1	6068387-6068431	1	0.978

1. spacer 3.1|6300194|45|NZ_CP054571|CRISPRCasFinder matches to position: 6068387-6068431, mismatch: 1, identity: 0.978

gcctttttttgccgccgggccgccccaaggcaaaaacgccccctc	CRISPR spacer
gcttttttttgccgccgggccgccccaaggcaaaaacgccccctc	Protospacer
**.******************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

63846 : 71780

Moraxella_phage(33.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006388149.1\|63846_64434_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.2e-19	36.8
WP_024068720.1\|64467_64842_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	1.1e-10	27.8
WP_006388151.1\|65038_66061_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_006388152.1\|66439_66796_+	VOC family protein	NA	NA	NA	NA
WP_006388153.1\|66880_68173_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-65	36.3
WP_006388154.1\|68281_69313_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-92	51.6
WP_006388155.1\|69382_70024_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_020927471.1\|70212_70971_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.5e-67	51.6
WP_006388157.1\|71015_71780_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.3e-31	45.2

DBSCAN-SWA_2

1046354 : 1056512

uncultured_Mediterranean_phage(28.57%)

holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024069257.1\|1046354_1047533_-\|tail	tail fiber domain-containing protein	A0A248SL32	Klebsiella_phage	1.0e-33	33.2
WP_024069258.1\|1047543_1048017_-	hypothetical protein	NA	NA	NA	NA
WP_024069259.1\|1048013_1048301_-	hypothetical protein	NA	NA	NA	NA
WP_058207367.1\|1048322_1048967_-	hypothetical protein	NA	NA	NA	NA
WP_024069261.1\|1048967_1049258_-	hypothetical protein	NA	NA	NA	NA
WP_024069262.1\|1049257_1050427_-	hypothetical protein	Q08J79	Stx2-converting_phage	3.4e-18	38.4
WP_024069263.1\|1050429_1052085_-	hypothetical protein	A0A1B1ITF2	uncultured_Mediterranean_phage	9.4e-54	30.0
WP_049052356.1\|1052087_1052396_-\|holin	phage holin family protein	A0A0U4J8T9	Pseudomonas_phage	7.9e-07	46.2
WP_024069265.1\|1052397_1052745_-	Prophage membrane protein	E5E3W4	Burkholderia_phage	7.3e-17	45.4
WP_058207368.1\|1052771_1053212_-	hypothetical protein	NA	NA	NA	NA
WP_058207369.1\|1053211_1054465_-\|tail	tail fiber protein	A0A0B5A596	Achromobacter_phage	1.6e-50	43.3
WP_024069266.1\|1054468_1054930_-	hypothetical protein	NA	NA	NA	NA
WP_024069267.1\|1054942_1055476_-	hypothetical protein	NA	NA	NA	NA
WP_024069268.1\|1055477_1055867_-	hypothetical protein	NA	NA	NA	NA
WP_024069269.1\|1055870_1056512_-	hypothetical protein	A0A1B1ITG1	uncultured_Mediterranean_phage	4.6e-25	34.2

DBSCAN-SWA_3

1076507 : 1089362

Pseudomonas_phage(54.55%)

integrase

attL 1076952:1076967|attR 1095113:1095128

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024069290.1\|1076507_1077008_+	hypothetical protein	A0A0S3UG68	Pseudomonas_phage	5.0e-35	50.3
1076952:1076967	attL	NA	NA	NA	NA
WP_024069291.1\|1077004_1077214_+	hypothetical protein	NA	NA	NA	NA
WP_024069292.1\|1077210_1077495_+	hypothetical protein	NA	NA	NA	NA
WP_024069293.1\|1077491_1077680_+	hypothetical protein	NA	NA	NA	NA
WP_024069294.1\|1077694_1078498_+	PD-(D/E)XK nuclease family protein	J7HXJ4	Pseudomonas_phage	2.9e-69	51.0
WP_024069295.1\|1078513_1078735_+	hypothetical protein	NA	NA	NA	NA
WP_058207378.1\|1078737_1079949_+	hypothetical protein	J7HXB6	Pseudomonas_phage	1.2e-66	53.7
WP_155523072.1\|1079964_1081125_+	recombination-associated protein RdgC	A0A218M310	Acidovorax_phage	2.2e-41	33.0
WP_024069298.1\|1081134_1082919_+	AAA family ATPase	J7HXJ7	Pseudomonas_phage	1.8e-82	36.8
WP_024069299.1\|1082934_1083549_+	3'-5' exonuclease	I3PUZ1	Vibrio_phage	4.9e-48	49.7
WP_049054998.1\|1083674_1084040_+	hypothetical protein	NA	NA	NA	NA
WP_024069301.1\|1084036_1084789_+	hypothetical protein	H2BD37	Pseudomonas_phage	1.3e-18	41.9
WP_024069302.1\|1084788_1085262_+	hypothetical protein	NA	NA	NA	NA
WP_024069303.1\|1085264_1085546_+	hypothetical protein	K4JS57	Caulobacter_phage	8.3e-11	33.7
WP_058207379.1\|1085549_1086293_+	hypothetical protein	NA	NA	NA	NA
WP_024069305.1\|1086285_1087287_+	phage Gp37/Gp68 family protein	Q8W6R4	Burkholderia_virus	1.4e-100	56.1
WP_058207380.1\|1087283_1087931_+	hypothetical protein	O03965	Myxococcus_phage	2.3e-48	47.4
WP_158646888.1\|1087932_1088277_+	hypothetical protein	NA	NA	NA	NA
WP_024069307.1\|1088276_1089362_+\|integrase	tyrosine-type recombinase/integrase	A0A059VF45	Pseudomonas_phage	4.7e-46	32.9
1095113:1095128	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1376207 : 1399316

uncultured_Caudovirales_phage(29.41%)

capsid,terminase,tail,head,protease,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024069458.1\|1376207_1376699_-	hypothetical protein	I6NSS1	Burkholderia_phage	1.2e-44	59.3
WP_058207395.1\|1376702_1377146_-	hypothetical protein	A0A0A1IVG1	Pseudomonas_phage	3.8e-10	35.3
WP_058207396.1\|1377234_1377963_-	hypothetical protein	A0A0B5A5A1	Achromobacter_phage	1.5e-64	51.5
WP_024069460.1\|1378258_1381432_-	host specificity protein J	A4JX16	Burkholderia_virus	3.8e-277	47.3
WP_006387649.1\|1381428_1382037_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	2.9e-53	56.2
WP_024069462.1\|1382040_1382814_-	C40 family peptidase	A4JX14	Burkholderia_virus	7.7e-67	51.7
WP_024069463.1\|1382816_1383545_-\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	1.1e-65	55.3
WP_145964689.1\|1383553_1383784_-	hypothetical protein	NA	NA	NA	NA
WP_024069466.1\|1385477_1385819_-\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	5.7e-30	54.5
WP_058207398.1\|1385815_1388791_-\|tail	phage tail tape measure protein	A0A2H4J9A1	uncultured_Caudovirales_phage	1.2e-94	32.9
WP_158646890.1\|1388824_1389136_-	DUF1799 domain-containing protein	NA	NA	NA	NA
WP_024069468.1\|1389201_1389621_-	hypothetical protein	NA	NA	NA	NA
WP_058207400.1\|1389693_1390629_-	hypothetical protein	G8CLB2	Synechococcus_phage	2.9e-60	40.9
WP_058207401.1\|1390661_1390865_-	hypothetical protein	NA	NA	NA	NA
WP_058207402.1\|1390891_1391314_-	hypothetical protein	NA	NA	NA	NA
WP_058207403.1\|1391310_1391613_-	hypothetical protein	NA	NA	NA	NA
WP_020928365.1\|1391618_1392623_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	4.1e-68	42.2
WP_024069470.1\|1392703_1393054_-\|head	head decoration protein	A0A2H4JF15	uncultured_Caudovirales_phage	8.7e-18	49.6
WP_024069471.1\|1393081_1394188_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	3.3e-47	36.8
WP_058207404.1\|1394216_1395716_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	4.1e-125	50.1
WP_020928369.1\|1395712_1395919_-	hypothetical protein	A0A2H4EUL1	Aeromonas_phage	4.5e-06	42.6
WP_024069473.1\|1395964_1397959_-\|terminase	phage terminase large subunit family protein	R9TMM4	Vibrio_phage	2.3e-115	37.4
WP_006387630.1\|1398036_1398534_-\|terminase	terminase small subunit	NA	NA	NA	NA
WP_024069474.1\|1398530_1399316_-	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	5.7e-33	39.3

DBSCAN-SWA_5

3254085 : 3322835

Burkholderia_virus(15.0%)

tail,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006385759.1\|3254085_3254856_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_006385758.1\|3254855_3255797_+	prolyl aminopeptidase	NA	NA	NA	NA
WP_006385757.1\|3255807_3256008_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_006385756.1\|3256287_3256605_+	hypothetical protein	NA	NA	NA	NA
WP_006385755.1\|3256651_3257098_+	peptidoglycan-binding protein LysM	G3MBQ1	Bacillus_virus	1.2e-06	50.7
WP_020926210.1\|3257268_3258675_-	signal recognition particle protein	NA	NA	NA	NA
WP_006385753.1\|3258781_3259624_+	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_024070496.1\|3259625_3259892_+	hypothetical protein	NA	NA	NA	NA
WP_058207501.1\|3260102_3260681_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.4e-07	30.5
WP_024070498.1\|3260698_3261319_+	glutathione S-transferase	NA	NA	NA	NA
WP_058207502.1\|3261395_3261947_-	hypothetical protein	NA	NA	NA	NA
WP_058207503.1\|3261990_3262527_-	hypothetical protein	NA	NA	NA	NA
WP_058207504.1\|3262622_3263180_-	hypothetical protein	NA	NA	NA	NA
WP_058207646.1\|3263197_3265165_-	hypothetical protein	NA	NA	NA	NA
WP_024070502.1\|3265641_3266601_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_024070503.1\|3266708_3267740_-	NAD-dependent epimerase/dehydratase family protein	A0A2H4UUK0	Bodo_saltans_virus	6.8e-26	27.2
WP_024070504.1\|3267745_3269221_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_035182028.1\|3269313_3270255_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058207505.1\|3270383_3271742_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_024070506.1\|3271738_3273085_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_024070507.1\|3273081_3275004_-	type I secretion system permease/ATPase	F2Y302	Organic_Lake_phycodnavirus	1.5e-15	30.4
WP_053500861.1\|3275135_3275741_-	heme acquisition protein HasAp	NA	NA	NA	NA
WP_081247857.1\|3275883_3278925_-	TonB-dependent hemoglobin/transferrin/lactoferrin family receptor	NA	NA	NA	NA
WP_058207506.1\|3279171_3280527_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_006385738.1\|3280530_3280791_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024070511.1\|3280925_3281945_-	FecR domain-containing protein	NA	NA	NA	NA
WP_024070512.1\|3282017_3282524_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_024070513.1\|3282715_3283555_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_058207507.1\|3283811_3284828_+	2-dehydro-3-deoxygalactonokinase	NA	NA	NA	NA
WP_024070515.1\|3284824_3285478_+	2-dehydro-3-deoxy-6-phosphogalactonate aldolase	NA	NA	NA	NA
WP_006391563.1\|3285474_3286623_+	galactonate dehydratase	Q6A202	Oenococcus_phage	3.3e-58	37.0
WP_024070516.1\|3286655_3287966_+	MFS transporter	NA	NA	NA	NA
WP_006385730.1\|3288199_3288910_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	4.8e-07	24.5
WP_024070517.1\|3288906_3290295_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_024070518.1\|3290305_3291766_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_024070519.1\|3291807_3293991_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_006385726.1\|3293994_3295194_-	MFS transporter	NA	NA	NA	NA
WP_045952967.1\|3295629_3297519_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	7.3e-119	37.4
WP_058207648.1\|3297720_3299124_-	DKNYY domain-containing protein	NA	NA	NA	NA
WP_024070521.1\|3299274_3300666_+	purine permease	H9YQ34	environmental_Halophage	3.7e-27	49.6
WP_024070522.1\|3301147_3301471_-	YXWGXW repeat-containing protein	NA	NA	NA	NA
WP_006385707.1\|3301762_3302779_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	5.0e-66	39.0
WP_006385706.1\|3302978_3303260_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_024070524.1\|3303606_3304542_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_024070525.1\|3304594_3305794_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006385703.1\|3305824_3306643_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.4e-10	49.3
WP_024070526.1\|3306661_3307591_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006385701.1\|3307732_3308329_-\|tail	tail assembly protein	C7BGD3	Burkholderia_phage	1.9e-49	53.0
WP_024070527.1\|3308325_3308562_-	hypothetical protein	NA	NA	NA	NA
WP_024070528.1\|3308542_3308914_-	hypothetical protein	NA	NA	NA	NA
WP_006385697.1\|3312518_3313124_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	1.0e-50	55.7
WP_006385696.1\|3313120_3313900_-	C40 family peptidase	Q3HQU3	Burkholderia_phage	1.5e-65	47.3
WP_006385695.1\|3313902_3314631_-\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	2.2e-71	58.3
WP_054499929.1\|3314633_3316595_-\|tail	tail fiber domain-containing protein	A0A0K0KVF1	Prochlorococcus_phage	1.9e-13	36.2
WP_080684394.1\|3316591_3316936_-\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	4.8e-21	38.4
WP_024070535.1\|3316932_3318219_-\|tail	phage tail tape measure protein	A0A1W6JP49	Morganella_phage	1.4e-12	27.2
WP_006385691.1\|3318276_3318567_-	DUF4035 domain-containing protein	S4TND7	Salmonella_phage	9.1e-13	50.0
WP_024070536.1\|3318566_3319040_-\|tail	Phage tail assembly chaperone	A4JX08	Burkholderia_virus	4.8e-27	45.1
WP_006385689.1\|3319045_3319513_-	hypothetical protein	NA	NA	NA	NA
WP_102949899.1\|3319763_3320333_-	hypothetical protein	NA	NA	NA	NA
WP_053497387.1\|3320629_3321325_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024070538.1\|3321377_3322835_-	DUF1254 domain-containing protein	M1IA53	Paramecium_bursaria_Chlorella_virus	2.3e-64	35.6

DBSCAN-SWA_6

5997448 : 6008726

Burkholderia_phage(50.0%)

integrase

attL 5992456:5992471|attR 6008225:6008240

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5992456:5992471	attL	NA	NA	NA	NA
WP_024068262.1\|5997448_5997898_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	1.1e-17	36.5
WP_024068263.1\|5998075_5999749_+	hypothetical protein	NA	NA	NA	NA
WP_049050997.1\|5999741_6000341_+	hypothetical protein	NA	NA	NA	NA
WP_006388474.1\|6000350_6000650_+	hypothetical protein	NA	NA	NA	NA
WP_024068265.1\|6000669_6001680_+	hypothetical protein	A9YX04	Burkholderia_phage	1.8e-76	50.3
WP_024068266.1\|6001714_6002458_+	hypothetical protein	A9YX06	Burkholderia_phage	2.5e-83	63.5
WP_020924456.1\|6002466_6002820_+	hypothetical protein	A9YX11	Burkholderia_phage	6.1e-35	66.7
WP_024068267.1\|6002816_6003998_+	putative bacteriophage protein	A9YX12	Burkholderia_phage	5.8e-130	62.6
WP_024068268.1\|6003999_6004665_+	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	9.6e-74	60.6
WP_174717674.1\|6004679_6005627_+	hypothetical protein	A0A0M3ULD8	Salmonella_phage	5.8e-16	54.1
WP_024068270.1\|6006183_6006534_+	hypothetical protein	NA	NA	NA	NA
WP_024068271.1\|6006536_6007559_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JE37	uncultured_Caudovirales_phage	2.8e-24	32.3
WP_164497481.1\|6007714_6008206_+	hypothetical protein	A0A0U5LBV3	unidentified_phage	6.3e-14	37.2
WP_024068272.1\|6008195_6008726_+	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	7.0e-43	57.4
6008225:6008240	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054571

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection