CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LN997863	Brucella sp. F60 genome assembly BVF60, chromosome : 1	1 crisprs	csa3,DEDDh	0	0	8	0
NZ_LN997864	Brucella sp. F60 genome assembly BVF60, chromosome : 2	0 crisprs	csa3,cas3,DEDDh	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LN997863_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN997863_1

124265-124371

Orphan

Consensus_repeat	Method
TACATGTTCACATAGACCGGTCCTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN997863_1

>merge|NZ_LN997863|1|124265-124371|CRISPRCasFinder
TACATGTTCACATAGACCGGTCCTTCACCGACATTTTTCCAGCGGCGGTCGAGACGGACACGGTCTTAAAATGTGAACATTTACATGTTCACATAGACCGGTCCTTC

>NZ_LN997863|1|1|124265-124371|CRISPRCasFinder
TACATGTTCACATAGACCGGTCCTTC	ACCGACATTTTTCCAGCGGCGGTCGAGACGGACACGGTCTTAAAATGTGAACATT
TACATGTTCACATAGACCGGTCCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN997863.1\|WP_004683353.1\|118916_119174_-\|sel1-repeat-family-protein	unknown	unknown	gnl\|CDD\|223861
NZ_LN997863.1\|WP_059242731.1\|143051_143759_-\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_LN997863.1\|WP_059242721.1\|119443_119683_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LN997863.1\|WP_059242720.1\|116766_117279_+\|BA14K-family-protein	unknown	unknown	gnl\|CDD\|369573
NZ_LN997863.1\|WP_082253056.1\|141648_143055_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_LN997863.1\|WP_059242730.1\|137725_140677_-\|glutamine-synthetase-adenylyltransferase	unknown	unknown	gnl\|CDD\|237612
NZ_LN997863.1\|WP_059242729.1\|135569_137681_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225843
NZ_LN997863.1\|WP_002964621.1\|116134_116350_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_LN997863.1\|WP_082253055.1\|124020_124260_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LN997863.1\|WP_006011906.1\|121371_122874_+\|AMP-nucleosidase	unknown	unknown	gnl\|CDD\|236222
NZ_LN997863.1\|WP_059242723.1\|122918_123986_+\|AP-endonuclease	unknown	unknown	gnl\|CDD\|225565
NZ_LN997863.1\|WP_059242727.1\|129902_132554_+\|aminopeptidase-N	unknown	unknown	gnl\|CDD\|237585
NZ_LN997863.1\|WP_059476629.1\|126424_127297_+\|DNA-polymerase	unknown	unknown	gnl\|CDD\|381680
NZ_LN997863.1\|WP_059242732.1\|143852_145394_-\|serine-peptidase	unknown	unknown	gnl\|CDD\|273938
NZ_LN997863.1\|WP_059242733.1\|145535_146012_-\|cytochrome-c-type-biogenesis-protein-CcmH	unknown	unknown	gnl\|CDD\|377161
NZ_LN997863.1\|WP_059242692.1\|141210_141579_-\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_LN997863.1\|WP_002963776.1\|119679_120027_+\|DUF2147-domain-containing-protein	unknown	unknown	gnl\|CDD\|227074
NZ_LN997863.1\|WP_059242707.1\|117378_118749_+\|transposase	unknown	unknown	gnl\|CDD\|372705
NZ_LN997863.1\|WP_059242722.1\|120091_120805_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|183298
NZ_LN997863.1\|WP_059242728.1\|132944_135296_+\|PAS-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715

Protein	Function_ID	Function_description	E-value
NZ_LN997863.1\|WP_004683353.1\|118916_119174_-\|sel1-repeat-family-protein	gnl\|CDD\|223861	COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only].	0.00134753
NZ_LN997863.1\|WP_059242729.1\|135569_137681_+\|hypothetical-protein	gnl\|CDD\|225843	COG3306, COG3306, Glycosyltransferase involved in LPS biosynthesis [Cell envelope biogenesis, outer membrane].	5.87071e-42
NZ_LN997863.1\|WP_059476629.1\|126424_127297_+\|DNA-polymerase	gnl\|CDD\|381680	cd10030, UDG-F4_TTUDGA_SPO1dp_like, Uracil DNA glycosylase family 4, includes Thermotoga maritima TTUDGA, Bacillus phage SPO1 DNA polymerase, and similar proteins. Uracil DNA glycosylase family 4 includes Thermotoga maritima TTUDGA, a robust uracil DNA glycosylase that shares narrow substrate specificity and high catalytic efficiency with family 1, acting on double-stranded and single-stranded uracil-containing DNA. Members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. This family also includes the N-terminal domain of Bacillus phage SPO1 DNA polymerase. Bacteriophage SPO1 is one of a group of large, lytic, tailed bacteriophages of Bacillus subtilis, and contains hydroxymethyluracil (hmUra) in place of thymine in their DNA. It has been speculated that this UDG domain may help discriminate between hmUra containing SPO1 DNA and thymine-containing host DNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	3.37552e-84
NZ_LN997863.1\|WP_082253056.1\|141648_143055_-\|sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	6.05112e-53
NZ_LN997863.1\|WP_059242730.1\|137725_140677_-\|glutamine-synthetase-adenylyltransferase	gnl\|CDD\|237612	PRK14108, PRK14108, bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase.	0
NZ_LN997863.1\|WP_059242723.1\|122918_123986_+\|AP-endonuclease	gnl\|CDD\|225565	COG3021, COG3021, Uncharacterized protein conserved in bacteria [Function unknown].	4.34628e-95
NZ_LN997863.1\|WP_006011906.1\|121371_122874_+\|AMP-nucleosidase	gnl\|CDD\|236222	PRK08292, PRK08292, AMP nucleosidase; Provisional.	0
NZ_LN997863.1\|WP_059242728.1\|132944_135296_+\|PAS-domain-containing-sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	4.25883e-60
NZ_LN997863.1\|WP_059242727.1\|129902_132554_+\|aminopeptidase-N	gnl\|CDD\|237585	PRK14015, pepN, aminopeptidase N; Provisional.	0
NZ_LN997863.1\|WP_002964621.1\|116134_116350_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	6.28238e-29
NZ_LN997863.1\|WP_059242732.1\|143852_145394_-\|serine-peptidase	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	1.4288e-167
NZ_LN997863.1\|WP_059242733.1\|145535_146012_-\|cytochrome-c-type-biogenesis-protein-CcmH	gnl\|CDD\|377161	pfam03918, CcmH, Cytochrome C biogenesis protein. Members of this family include NrfF, CcmH, CycL, Ccl2.	7.03244e-69
NZ_LN997863.1\|WP_059242731.1\|143051_143759_-\|DNA-binding-response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.60683e-84
NZ_LN997863.1\|WP_059242692.1\|141210_141579_-\|IS5/IS1182-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	2.20235e-28
NZ_LN997863.1\|WP_059242720.1\|116766_117279_+\|BA14K-family-protein	gnl\|CDD\|369573	pfam07886, BA14K, BA14K-like protein. The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.	1.08085e-10
NZ_LN997863.1\|WP_059242707.1\|117378_118749_+\|transposase	gnl\|CDD\|372705	pfam13751, DDE_Tnp_1_6, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	3.52274e-32
NZ_LN997863.1\|WP_059242722.1\|120091_120805_-\|glutathione-S-transferase	gnl\|CDD\|183298	PRK11752, PRK11752, putative S-transferase; Provisional.	1.62222e-69
NZ_LN997863.1\|WP_002963776.1\|119679_120027_+\|DUF2147-domain-containing-protein	gnl\|CDD\|227074	COG4731, COG4731, Uncharacterized protein conserved in bacteria [Function unknown].	1.63768e-25

>NZ_LN997863.1|WP_082253055.1|124020_124260_+|hypothetical-protein
MKNPSIFGSSQKRGVLIPICSRFESVTFRESEAILTLPEVCQQSEGGIEAALFSQITILVPVLYRHFPNGGRNGHGLKM
>NZ_LN997863.1|WP_059242723.1|122918_123986_+|AP-endonuclease
MLEPCRKRGARTTRNLFPYPIHFIAVIRHYCRLMSKSRLNLPFLILVAATLVSIPLVLSFLNSLHPAFDTFSHLRIHLAVLMGLLALPLLFTKLRREGAMILLLAVFAIAVTPHVFPASEDAHAGEAAQPHYRLLQMNLRFDNGSPEQALSLIAHIRPDVVTLEEVSSMWREKFGHIASAYPYSIFCPHPGAVFGVAILSRRPFIADSTPACDPKGMMAVASVDFGGRPVDVAALHLHWPWPFQQSEQIEALSEQFRGLSENAILSGDLNATPWSATTKRIAELAAMTPAPPTGPTWLYRRLPASLRFAGLPIDQTFAKGRVAISKITRQQPIGSDHLPVLVEFSIIPPPETVAS
>NZ_LN997863.1|WP_006011906.1|121371_122874_+|AMP-nucleosidase
MTQRIEHPFLTDIKTPPLMEPEVFSDAQAAVAALCKLYERNTAFLRSAFEKVARGEIAPQRYRAFYPEICLSTSSFAHVDSRLAYGHVSTPGDYSATVTRPDLFGHYLREQIRLLMRNHGVTVTVRESSTPIPIHFAFKEGAYVEASVASAFTHPLRDLFDVPDLAATDDKIVNADFEPAPGEPMPLAPFTAQRIDYSLHRLSHYTATSPSHFQNFVLFTNYQFYMDEFCAYARQLMAEGGGGYDQFVEPGNIVTRAGETAPSTGNPLQRLPQMPAYHLQKAGHGGITMVNIGVGPSNAKTITDHIAVLRPHAWLMLGHCAGLRNSQQLGDYVLAHAYMREDHVLDDDLPVWVPLPALAEIQVALEEAVEEITGLQGYDLKQIMRTGTVATIDNRNWELRDQRGPVQRLSQARAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGELKLPGMATEFYKRQVAQHLRIGIRAMEKIASMPDERLHSRKLRSFYETAFQ
>NZ_LN997863.1|WP_059242722.1|120091_120805_-|glutathione-S-transferase
MAEQTKPIELYYWPTPNGFKISIMLEELGVPYAVKYINIGKGDQFEPGFLKIAPNNRMPAIIDPEGPGGEPISVFESGAILQYLGRKFGKFYPADERKRVAVEEEWLMWQMGGLGPMSGQAGHFRIYAPEKIQYGIDRYTNEVNRLYGVLNRRLEGRDYIADEYSIADMACIGWVNAYKNYEQNLDDFANLKRWHETMNTRPAVQRGLLVGKEERERAAAAANKEEEQKILFGQKAR
>NZ_LN997863.1|WP_002963776.1|119679_120027_+|DUF2147-domain-containing-protein
MIRTLILGVTLAAGFAAPAFADEAIVGTWKRPNGTLISYAACGANKFCGTVMTGEYKGKSIGTMSGKDGNYKGEVNKLDEGKTYSGKASVKGNTLSLSGCVMGGLICKSESLARQ
>NZ_LN997863.1|WP_059242721.1|119443_119683_+|hypothetical-protein
MITIGRIDMVRIGGMRALQTAMMKLKIAPSASPETRLRLRLRKLMRASKSMLLQRLKRMNSGFIAAPTIRDSRHFGRNE
>NZ_LN997863.1|WP_004683353.1|118916_119174_-|sel1-repeat-family-protein
MAQFQSFNHNENPAAQDRILLEMGMKYAIGRDCEIDVIEAHKWLNIAAIRGNQKAERMRNQVAATMSKSELAAALRCAREWMTAH
>NZ_LN997863.1|WP_059242707.1|117378_118749_+|transposase
MLKKPSPEQTALEMVTLEQLVPKDHLLRRIDAVIDFTFIHDRVSGLYCADNGRPALDPTLMFKALFIGYLFGIRSERQLVREIEVNVAYRWFLRLKLTDTVFDASTLSQNRRRRFNDTDVAQAIFDHIVEQAIGHGLVDGTVLYTDSTHLKANANKGKYDLALLQKSRADYWADLDRAIDAERALHSQPPLKEKEREPEVKETKVSRTDPDSGYMVREGKPKGFFYLDHRTVDGRLAIITDTHVTPANVHDSIVYLERLDRQRQRFAFDVKAVGLDAGYATSGIAKGLEERHILGVTGYRNPTPPKPGMMRKSKFVYDGPGDGYRCPEGQLLPYATTDRTGYRHYRSDPAICRDCPLLASCTTNAKAQRTITRHVWADARERTDAHRLTPWGKAIYKRRKETVERSFADAKQLHGHRYARFRGLIKVRWQCLLAAAAQNIKKIAMALTKTPKPAWG
>NZ_LN997863.1|WP_059242720.1|116766_117279_+|BA14K-family-protein
MNRFLKITILAAASLATVAAPLATASADSWSRHSWGSETWKRDSWGPGHWESRSTERGWSRSHSHHSSRSNNDALAAGVIGLAAGALLGSVLSQPRTTYIQPMPVYAAPPPPPPPAYYPAAPTRNVVYRAGYEPWSRGWYQYCSGRYRSFNPNTGTYRGYDGRDHFCTAN
>NZ_LN997863.1|WP_002964621.1|116134_116350_+|cold-shock-protein
MAQTGQVKFFNTEKGFGFIKPDDGGADIFVHISAVQASGLPGLADNQKVSYETEPDRRGKGPKAVNITITG
>NZ_LN997863.1|WP_059476629.1|126424_127297_+|DNA-polymerase
MTDGRETLDMEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQSRMQAAAQQPESNPAQAREERARTVTVPSPSSKPVQAAMDLPDNAQIALAREAASQAETLEELREKLAAFDGCNLKFTAKNLCFADGDPSSGIMFIGEAPGRDEDMEGLPFVGKSGQLLNRMIEAIGLKREEVYIANTIPWRPPGNRAPTPLETELCRPFIERQIELAAPKVLVALGGPAGKALTGAAEGILRLRGNWKIHRTPTGMEIPVMPTLHPAYLLRTPAQKRFAWRDFLAVKLKLAELRG
>NZ_LN997863.1|WP_059242727.1|129902_132554_+|aminopeptidase-N
MRTETGHTFRLEDYRQTPYAIPETKLDFTLEPEKTIVRATLTIERRPDTPAGTPLVLHGDELKLVSLAIDGKALSDNSFSATPDQLTISDLPKDARFTLQIVTEVNPTANRQLSGLYRSSGVYCTQCEAEGFRRITYFYDRPDVLSVYTVRVDADRKAAPILLSNGNPVENGMVEGQPERHFAVWHDPHPKPSYLFALVAGSLGVVKEHFTTRSGRPVDLAIHVEHGKEGRALYAMDALKRSMKWDEEKFGREYDLNVFNIVAVSDFNMGAMENKGLNIFNDKYVLADPETATDADYAGIEAFIAHEYFHNWTGNRITCRDWFQLCLKEGLTVYRDHEFSADQRSRPVKRIAEVKILKAQQFPEDAGPLAHPVRPREYREINNFYTATVYEKGSEVVRMIRTIIGPELFRKGMDLYFERHDGDAATIEDFIQVFADVSGQNFSQFALWYDQAGTPKVEAGFHHDAAAKTFTIKLEQSLAPTLGQSIRKPMHIPIAFGLIGPDGKDMQPSSVEGGEVRDGIIHLRHPSETIVFHGIEARPVPSLLRGFSAPVNLAAPLTAEDRIFLALNDSDPVARWQAMNSIFSAALLDGAKRVRGGHQPETDPKIVALAGKVAFDEMLDPAFRALCLTLPSESDIAREMGNNVDPDAILASRNHLIAAIASAYTDGFAGLYDRLKQEGAFSPDAAPAGKRALRSAVLDYLSVQEKSPERAERQFIEADNMTDRATALAVLVHRFGDSGEARQALATFEQTFGQDALVMDKWFIVQATRPGETALEAVRELTRHPLFSLDNPNRVRALIGAFTASNPTGFNRQDGAAYGFLADTLLTIDPKNPQLSARLLTAMRSWRSLEEVRREHARAALARIAGAGKLSTDLRDIIDRTLA
>NZ_LN997863.1|WP_059242728.1|132944_135296_+|PAS-domain-containing-sensor-histidine-kinase
MVSTDAYGAPAGTHCESGRKKRKGRLSGHVSLLAGPAYSKFIIIEPILRRLVPALIIIFLIILVVARVFSLLAWRDDIELQHKAALSGATAHLAQMIERVANGIETGAQLSAKDLQDAMTELRSRGLTSSSMTIAIVDAQSMIKAASGPAGIAGSQIDTILGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAAQAREADDLSGQIQRRIDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEITSEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGAALFITIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIRSTERVGTVVSVCIPDRNPAPNAGHDARTHAA
>NZ_LN997863.1|WP_059242729.1|135569_137681_+|hypothetical-protein
MILPVFVINMASQPAAYKTVAASIEAYGQGFQLHRIDAVNGHTATQRIGIDDARFDAINGREMLPGEYGCYRSHLKALESFLSDGSPYGLILEDDVVFTETTSARIHDIIKSLPDFDVVKLVNHRSPLFMSLLETDAGDRIGCAIHGPQGSAAAYLVSREGARKLLSALSTMELPWDVAMERFWHHKARLFSSDENILAFSSHSEISNISDQNSGYDEAKYPWHKRLRTSLFRTFDYYVRVHHTLLQPQNPDDSSMKSQSGAYRLPGISLTGELIAAISLLVFMSTVWVETDAYRYIALGFVVAALIRYARTDFWKYEKPMVGWAGLLCVAWTFYVLARFAYIYLFYPEMGTGSAEGIYLFPLFYPTLGFALLLFIRRPFLIAVAFMAISLVILIFGFHYDPSWNERAVTLLQHNPIHAAVSSGFIALCAMAFGIHTLNRNTLNTKARVVLCLLALATFIAALIAIYSLYSKGVWLAMAIAFPTFVVLVALTDKSQTSRMAALVCILIGLLSVFAGEHILQRVGGNTANTSWELLSDLKTGDNIMQDFDKAIKNPETGLSERERLMIWANTLHIWHKNPIFGAGVSWLHYWEKRPYQQTDFTLLHNGYLEIAIRYGFLGLLFYGVLTIWAVRCTWQATRAGLIDSAAFQCYVATLVFFAVTILSNSNVRLAIGESYMALAFGFAFYCQYLLQQHNRQYPRTYF
>NZ_LN997863.1|WP_059242730.1|137725_140677_-|glutamine-synthetase-adenylyltransferase
MTVENAKALFFERNLCALTPLDPERASAFLADLEARAREEELADVVALLGRKKAEDFLSAILDLSPFIREALTRQPRILDRIVSATPESALEAILDEISASGTVAGVSESELMTSLRQLKREAHVLIALCDLVRIFNTETTTDRLTDLAEACTGAAVRFLLLDADAAGRINLPDRSNPEKDCGWIVLGMGKFGARELNYSSDIDLIVFIDETKPAIGDPYECVDTFSRLTRRLVRILQDRTGDGYVFRVDLRLRPDPGSTPLAIPVGAALHYYEGRGQNWERAAMIKARPVAGDRLSGKQILAELSPYVWRKYLDYAAIADVHSIKRQIHAHKGHGDIAVRGHNVKLGRGGIREIEFFVQTQQLIAGGRFPELRGNQTVPMLARLAERGWITQQARDALAQEYWFLRDVEHRIQMIADEQTHILPEDDEGFARVSHMMGYADPAEFSEIFLAALKVVEKHYAALFEQAPELGTASGNLVFTGDVDDPGTLETLSAMGYERPSDICRVIRTWHFGRYRATQSAEARERLTELTPALLKAFAETRRADESLLRFDGFLQGLPAGIQLFSLLQSNPRLLNLLVMIMSAAPRLADIITRNPHVFDGLLDPAIFSEVPTRAYLEERLRAFLGSATDFEEVLDRLRIFAAEHRFLIGIRLLTGAINGVRAGQAFSDLAELMVGRALEAVEAELQRRHGKVKGAKVALLAMGKLGSRELTAGSDVDLILLYDHDKDAEESDGEKPLAPSQYYIRLTQCLIAALSAPTAEGVLYEVDMRLRPSGNKGPVATHIEAFGKYQRNDAWTWEHMALTRARPIHGDETFIARIKVDIEDVLAMPRDVRKLAGDVREMRELIAQEKPPRDDWDLKLKPGGIIDLEFIAQFATLAGYVKKTPRPFATEEVLANLDPSFADPAMVDSLVEAHRFYTNLSQAIRLCLNDSAGLDQFPPGMRELLCRVAGLPDIERIEYELLEHYRLVRAAFDKLVGHGAV
>NZ_LN997863.1|WP_059242692.1|141210_141579_-|IS5/IS1182-family-transposase
MSRRSLTDEQWNRIEAYLPGRVGTPGRSGVDNRLFVDAILWMAANAAHWRDLPATFGKWTAVHARFRRWSHAGVWERLFHTLADTPDFEYVLIDSTISKVHADAAGAKGGLKLPASVARVGD
>NZ_LN997863.1|WP_082253056.1|141648_143055_-|sensor-histidine-kinase
MMSRFCALMRTTAARLSALYLLLFAVGAVALVFYMTNLSASILAGQTQQALGEEVASIGKSYARGGIPQLVRTIDYRSRQPGAYLYLVADPTGRILAGNVESVEPGVLNTDGIIERAFTYRRYGEQAPQVEHRAIAVVIALPNGMRLLVGRDLGEPERFRDLIRNSLVLALGIMGVGALLIWLFVGRRALKRIDDVSRASQRIMDGDLTGRLPVNGSGDEFDRLSGNLNVMLARILELNEGLKQVSDNIAHDLKTPLTRLRNRAEEALGGEKVEPEYRAALEDIIGESDQLIRTFNAILMISRLEAGYSSENLDDMPVAPIMRDVAEMYEPVAEDAGVTLTLGALDDVALHINRELVGQTVSNLVDNAIKYAGGEGRTATVTLLMEKDAQWVRIVVADNGPGIPADKRDHATERFVRLEESRTQPGSGLGLSLAKAVMKLHGGALRLEDNGPGLRAVLEFPLPHREVG
>NZ_LN997863.1|WP_059242731.1|143051_143759_-|DNA-binding-response-regulator
MKILVIEDDREAARYLEKAFAEAGHSADIAGDGETGYALAENGNYDVLVVDRMLPKRDGLSVVAGLRAKGMETPVLILSALGEVDDRVTGLRAGGDDYLTKPYAFSELLARVEVLQRRSSPREADTIYRVGDLELDRLAHTARRQSVDITLQPREFRLLEYLMRHAGQVVTRTMLLENVWDYHFDPQTNVIDVHISRLRSKIEKGFDEPLLHTVRGAGYMLKAGRGKQSAAAKAE
>NZ_LN997863.1|WP_059242732.1|143852_145394_-|serine-peptidase
MSRARISNYRKGVAAVALSAALAGAFVVTGPLGALNEARAEEVHVTPPPQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFRDFGMEPRGDSRSDNRRGKANKPRPGHERPIAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMPNDKGKSGGQSNDNGGGQGETLDSYGLTVVPSEDGKGVVVTDVDPDSDAADRGIRSGDVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQSNDQSRFVALPINQE
>NZ_LN997863.1|WP_059242733.1|145535_146012_-|cytochrome-c-type-biogenesis-protein-CcmH
MKKSNLFRALLISATFALQATAALAVNPDEVLADPKLEKRAREISAELRCMVCQNESIDDSNAELARDLRILVRERLTKGDTDGQVIDFVVDRYGEFVLLKPRFNAQTALLWGFPVIILLIGGGALLVAFRRRRAAGTAPQPLSESEKAELSRLLDEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

57134 : 97484

Streptococcus_phage(15.38%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059242688.1\|57134_58505_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	3.6e-83	39.6
WP_004684033.1\|58590_60240_-	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	1.1e-46	27.8
WP_059476627.1\|60319_60499_-	hypothetical protein	NA	NA	NA	NA
WP_059242689.1\|60735_61680_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_059242690.1\|61970_62384_+	hypothetical protein	NA	NA	NA	NA
WP_059242691.1\|62477_63164_-	D-lyxose/D-mannose family sugar isomerase	NA	NA	NA	NA
WP_059242692.1\|65851_66220_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059242693.1\|66216_66609_+\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059242694.1\|66740_66962_-	PhnA protein	NA	NA	NA	NA
WP_059243950.1\|67099_67729_+	bifunctional nicotinamidase/pyrazinamidase	A0A1V0SEH9	Indivirus	1.5e-15	29.9
WP_059242695.1\|67725_68787_-	hypothetical protein	K4JUR1	Caulobacter_phage	1.1e-66	43.3
WP_082253053.1\|69594_69804_+	hypothetical protein	NA	NA	NA	NA
WP_059243951.1\|69760_70864_-	linear amide C-N hydrolase	A7IWP6	Paramecium_bursaria_Chlorella_virus	5.7e-31	31.9
WP_059242696.1\|72204_72702_-	hypothetical protein	NA	NA	NA	NA
WP_059242692.1\|73104_73473_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059242693.1\|73469_73862_+\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059242697.1\|73875_74217_-	hypothetical protein	NA	NA	NA	NA
WP_059242698.1\|74460_74919_-	YcgN family cysteine cluster protein	NA	NA	NA	NA
WP_008506802.1\|75110_75401_-	hypothetical protein	NA	NA	NA	NA
WP_059242699.1\|75424_77443_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.7e-36	34.0
WP_059242700.1\|77899_79867_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	9.7e-98	37.5
WP_008506807.1\|80236_81913_+	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_059242701.1\|81980_82433_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	6.2e-16	39.9
WP_059243952.1\|82812_84036_+	carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	6.5e-44	33.1
WP_059242702.1\|84203_85130_-	flagellar biosynthesis protein FlgM	NA	NA	NA	NA
WP_059242703.1\|85834_86650_+	DNA-binding response regulator	NA	NA	NA	NA
WP_059242704.1\|86884_90373_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_059242705.1\|91089_92949_-	glycosyl transferase family 1	NA	NA	NA	NA
WP_004684049.1\|93388_93598_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.8e-10	55.4
WP_008506825.1\|93890_94502_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_059242706.1\|94751_95954_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_059242707.1\|96113_97484_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-83	39.6

DBSCAN-SWA_2

107938 : 223310

100

Paenibacillus_phage(13.04%)

portal,capsid,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059242707.1\|107938_109309_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-83	39.6
WP_082253054.1\|109416_109611_+	hypothetical protein	NA	NA	NA	NA
WP_025199819.1\|109720_110110_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_059242693.1\|110163_110556_-\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059242692.1\|110552_110921_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059476628.1\|111072_111270_+	hypothetical protein	NA	NA	NA	NA
WP_059242716.1\|111175_111757_+	SH3 domain-containing protein	NA	NA	NA	NA
WP_059242717.1\|111882_114705_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_059242718.1\|114836_115640_+	lytic transglycosylase	A0A0S2SXL7	Bacillus_phage	2.0e-09	36.2
WP_002964621.1\|116134_116350_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.3e-08	48.4
WP_059242720.1\|116766_117279_+	BA14K family protein	NA	NA	NA	NA
WP_059242707.1\|117378_118749_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-83	39.6
WP_004683353.1\|118916_119174_-	sel1 repeat family protein	NA	NA	NA	NA
WP_059242721.1\|119443_119683_+	hypothetical protein	NA	NA	NA	NA
WP_002963776.1\|119679_120027_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_059242722.1\|120091_120805_-	glutathione S-transferase	NA	NA	NA	NA
WP_006011906.1\|121371_122874_+	AMP nucleosidase	NA	NA	NA	NA
WP_059242723.1\|122918_123986_+	AP endonuclease	NA	NA	NA	NA
WP_082253055.1\|124020_124260_+	hypothetical protein	NA	NA	NA	NA
WP_059242724.1\|124344_126036_-	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_059476629.1\|126424_127297_+	DNA polymerase	NA	NA	NA	NA
WP_059242727.1\|129902_132554_+	aminopeptidase N	NA	NA	NA	NA
WP_059242728.1\|132944_135296_+	PAS domain-containing sensor histidine kinase	A0A1V0SGX0	Hokovirus	6.3e-27	34.8
WP_059242729.1\|135569_137681_+	hypothetical protein	NA	NA	NA	NA
WP_059242730.1\|137725_140677_-	glutamine-synthetase adenylyltransferase	NA	NA	NA	NA
WP_059242692.1\|141210_141579_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_082253056.1\|141648_143055_-	sensor histidine kinase	NA	NA	NA	NA
WP_059242731.1\|143051_143759_-	DNA-binding response regulator	NA	NA	NA	NA
WP_059242732.1\|143852_145394_-	serine peptidase	A0A1B1IT49	uncultured_Mediterranean_phage	1.3e-28	29.8
WP_059242733.1\|145535_146012_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_059242734.1\|146008_148000_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_059242735.1\|148019_148517_-	cytochrome c biogenesis protein CcmE	NA	NA	NA	NA
WP_059242736.1\|148513_149653_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_059242737.1\|149753_150206_-	hypothetical protein	NA	NA	NA	NA
WP_059242738.1\|150299_151610_-	ATP-binding protein	NA	NA	NA	NA
WP_059243955.1\|152452_152749_-	hypothetical protein	NA	NA	NA	NA
WP_059242693.1\|152863_153256_-\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059242692.1\|153252_153621_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_008508561.1\|153754_153961_-	hypothetical protein	NA	NA	NA	NA
WP_059242739.1\|157894_158329_-	peptidase P60	NA	NA	NA	NA
WP_082253057.1\|158325_158679_-	hypothetical protein	A0A0K1Y6Z2	Rhodobacter_phage	6.7e-18	48.5
WP_059242741.1\|159196_159829_-	TIGR02217 family protein	A0A0B5A2K3	Paracoccus_phage	1.3e-48	47.6
WP_059242742.1\|159831_160377_-	hypothetical protein	A0A1B0VMG8	Pseudomonas_phage	1.1e-06	40.8
WP_059242743.1\|160596_160938_-	gene transfer agent family protein	NA	NA	NA	NA
WP_008935501.1\|160934_161348_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_006072374.1\|161388_161796_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_059242744.1\|162253_162820_-	hypothetical protein	NA	NA	NA	NA
WP_059242745.1\|162984_164259_-\|capsid	phage major capsid protein	Q8HAD2	Salmonella_phage	2.6e-83	43.8
WP_002967499.1\|164934_165312_-	hypothetical protein	NA	NA	NA	NA
WP_059242746.1\|165308_166502_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	2.0e-66	39.7
WP_059242747.1\|166533_167793_-	ATP-binding protein	A0A1V0DY66	Dinoroseobacter_phage	2.6e-72	40.9
WP_059242748.1\|167731_168244_-	hypothetical protein	NA	NA	NA	NA
WP_059242749.1\|168601_170758_+	penicillin-binding protein 1A	NA	NA	NA	NA
WP_059242750.1\|170764_171376_+	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_059242751.1\|171368_171911_+	hypothetical protein	NA	NA	NA	NA
WP_059242752.1\|172134_173202_+	DUF2336 domain-containing protein	NA	NA	NA	NA
WP_059242753.1\|173211_173559_-	DUF1491 domain-containing protein	NA	NA	NA	NA
WP_059242754.1\|173572_174541_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_059242755.1\|174515_176345_-	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	1.1e-23	29.7
WP_059242756.1\|176635_177085_+	hypothetical protein	NA	NA	NA	NA
WP_059243956.1\|177164_177590_+	cysteine desulfuration protein SufE	NA	NA	NA	NA
WP_059242757.1\|177630_178968_-	amidase	NA	NA	NA	NA
WP_059242758.1\|179058_179853_-	hypothetical protein	NA	NA	NA	NA
WP_059243957.1\|179849_180305_-	hypothetical protein	NA	NA	NA	NA
WP_002969861.1\|180486_180798_+	hypothetical protein	NA	NA	NA	NA
WP_004688116.1\|181006_181435_-	transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.0e-20	47.6
WP_082253058.1\|181389_181584_-	hypothetical protein	NA	NA	NA	NA
WP_059242759.1\|182007_184116_+	S9 family peptidase	NA	NA	NA	NA
WP_059242760.1\|184233_184569_+	hypothetical protein	NA	NA	NA	NA
WP_004689540.1\|184739_185339_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	6.9e-39	42.6
WP_082253059.1\|186217_186460_-	hypothetical protein	NA	NA	NA	NA
WP_059242761.1\|186518_187235_+	L,D-transpeptidase	NA	NA	NA	NA
WP_059242762.1\|187432_188944_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	7.5e-82	43.8
WP_059242763.1\|189279_189642_+	hypothetical protein	NA	NA	NA	NA
WP_059242764.1\|190937_191615_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_059242765.1\|191770_192763_+	magnesium transporter CorA	NA	NA	NA	NA
WP_002963708.1\|192823_193054_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_059242766.1\|193050_193440_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	1.7e-06	43.9
WP_059242767.1\|193436_193907_-	transcription elongation factor	NA	NA	NA	NA
WP_059243958.1\|193951_194974_-	asparaginase	NA	NA	NA	NA
WP_059243959.1\|195164_195761_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_059242768.1\|197582_199046_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_059242769.1\|199582_200653_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_059242770.1\|200904_201936_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_059242771.1\|201968_203420_+	xylulokinase	NA	NA	NA	NA
WP_059242772.1\|203466_204774_+	xylose isomerase	NA	NA	NA	NA
WP_059243960.1\|204974_206147_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_059242773.1\|208303_209305_-	ABC transporter permease	NA	NA	NA	NA
WP_059242774.1\|209325_210861_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-14	24.9
WP_082253060.1\|210859_211072_+	hypothetical protein	NA	NA	NA	NA
WP_059242775.1\|211552_212662_-	glycosyl transferase family 1	NA	NA	NA	NA
WP_059242776.1\|212744_213917_-	AGE family epimerase/isomerase	NA	NA	NA	NA
WP_059242777.1\|213949_215374_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.5e-52	30.5
WP_005969645.1\|218553_219108_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.9e-12	33.9
WP_082253061.1\|219150_219303_+	hypothetical protein	NA	NA	NA	NA
WP_059242780.1\|220055_221174_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_059242781.1\|221304_221544_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_059242693.1\|221544_221937_-\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059242692.1\|221933_222302_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_082253062.1\|222371_223310_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1206778 : 1270827

Ochrobactrum_phage(42.86%)

tRNA,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059242707.1\|1206778_1208149_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-83	39.6
WP_082253136.1\|1208231_1208441_+	hypothetical protein	NA	NA	NA	NA
WP_059243365.1\|1208492_1210679_-	malate synthase G	NA	NA	NA	NA
WP_059243366.1\|1210821_1211697_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_059244044.1\|1211772_1212417_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_002967872.1\|1212690_1213263_+	HNH endonuclease	A0A223W0A5	Agrobacterium_phage	8.6e-31	40.9
WP_004684121.1\|1213279_1213798_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_059243367.1\|1213910_1214501_-	DedA family protein	NA	NA	NA	NA
WP_059243368.1\|1214596_1214830_+	hypothetical protein	NA	NA	NA	NA
WP_082253137.1\|1214759_1214942_+	hypothetical protein	NA	NA	NA	NA
WP_059243369.1\|1214942_1216394_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_059243370.1\|1216511_1217333_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_059242693.1\|1225848_1226241_-\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059242692.1\|1226237_1226606_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059243371.1\|1226675_1226993_-	hypothetical protein	NA	NA	NA	NA
WP_059243372.1\|1228852_1229857_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_059243373.1\|1230033_1231023_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059243374.1\|1231111_1231885_+	D-threitol dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	7.3e-09	27.8
WP_059243375.1\|1231917_1232910_+	dihydroxyacetone kinase	NA	NA	NA	NA
WP_059243376.1\|1232921_1233563_+	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_082253138.1\|1233721_1235806_+	3,4-dihydroxy-2-butanone kinase	NA	NA	NA	NA
WP_059244046.1\|1235871_1236519_+	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_059243377.1\|1236795_1237077_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_059243378.1\|1239318_1240104_-	porin family protein	O11861	Bartonella_henselae_phage	7.7e-22	32.7
WP_059243379.1\|1240395_1241010_-	MarC family protein	NA	NA	NA	NA
WP_059243380.1\|1242791_1243586_-	2-deoxy-D-gluconate 3-dehydrogenase	NA	NA	NA	NA
WP_082253139.1\|1243651_1244566_-	7-alpha-hydroxysteroid dehydrogenase	A0A0M4JSW6	Mollivirus	1.4e-11	27.9
WP_002964713.1\|1245129_1245366_-	hypothetical protein	NA	NA	NA	NA
WP_059243381.1\|1246938_1248354_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_082253219.1\|1248729_1249833_+	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059243383.1\|1252027_1252849_+	ABC transporter permease	NA	NA	NA	NA
WP_059243384.1\|1252856_1254794_-	AsmA family protein	NA	NA	NA	NA
WP_082253140.1\|1254937_1255183_+	hypothetical protein	NA	NA	NA	NA
WP_059243385.1\|1255533_1258635_-	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	9.5e-23	31.2
WP_009365134.1\|1261609_1262128_+\|tail	phage tail protein	A0A219VHB2	Ochrobactrum_phage	1.6e-97	97.7
WP_059244048.1\|1262691_1264980_+\|tail	phage tail tape measure protein	A0A219VHB3	Ochrobactrum_phage	8.4e-311	75.6
WP_059243386.1\|1264980_1265418_+\|tail	phage tail protein	A0A219VHA8	Ochrobactrum_phage	3.4e-72	93.8
WP_059243387.1\|1265414_1265675_+\|tail	phage tail protein	A0A219VHB0	Ochrobactrum_phage	7.8e-40	94.2
WP_059243388.1\|1265674_1266649_+	late control protein	A0A219VHA9	Ochrobactrum_phage	4.8e-175	93.8
WP_059243389.1\|1266648_1266936_+	hypothetical protein	NA	NA	NA	NA
WP_059243390.1\|1266932_1267253_+	hypothetical protein	A0A219VHA6	Ochrobactrum_phage	7.4e-48	89.1
WP_059243391.1\|1267316_1267868_+	hypothetical protein	NA	NA	NA	NA
WP_059243392.1\|1267864_1268146_+	hypothetical protein	NA	NA	NA	NA
WP_059243393.1\|1268586_1269543_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_009362888.1\|1269702_1270827_+	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A2K9L0G1	Tupanvirus	1.4e-29	31.1

DBSCAN-SWA_4

1349025 : 1396502

Streptococcus_phage(22.22%)

tRNA,protease,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059244054.1\|1349025_1350438_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_059243436.1\|1350579_1351206_-	invasion associated locus B family protein	NA	NA	NA	NA
WP_002963625.1\|1351606_1352494_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_059243437.1\|1352631_1354290_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.2e-09	36.3
WP_059243438.1\|1354517_1355465_+	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_004683131.1\|1355464_1355650_+	hypothetical protein	NA	NA	NA	NA
WP_059243439.1\|1355669_1356275_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_059243440.1\|1356483_1357362_+	cytochrome c oxidase subunit 3	NA	NA	NA	NA
WP_004688061.1\|1357475_1357859_+	DUF983 domain-containing protein	NA	NA	NA	NA
WP_059243441.1\|1357855_1358605_+	SURF1 family protein	NA	NA	NA	NA
WP_059243442.1\|1358713_1359754_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_059243443.1\|1359759_1360740_+	homoserine kinase	NA	NA	NA	NA
WP_002963635.1\|1360736_1361201_+	ribonuclease HI	J9Q745	Salmonella_phage	1.7e-40	53.6
WP_059242707.1\|1361616_1362987_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-83	39.6
WP_082253148.1\|1363069_1363255_+	hypothetical protein	NA	NA	NA	NA
WP_002964694.1\|1363341_1363617_-	DUF1153 domain-containing protein	NA	NA	NA	NA
WP_082253149.1\|1363921_1365118_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_059243444.1\|1365338_1366169_-	RNA methyltransferase	NA	NA	NA	NA
WP_059243445.1\|1366198_1366546_-	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_082253150.1\|1366535_1366763_+	hypothetical protein	NA	NA	NA	NA
WP_082253151.1\|1366848_1367088_-	hypothetical protein	NA	NA	NA	NA
WP_082253152.1\|1367003_1367309_-	hypothetical protein	NA	NA	NA	NA
WP_059243446.1\|1369333_1370341_+	peptide ABC transporter permease	NA	NA	NA	NA
WP_082253153.1\|1371252_1372110_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.2e-05	26.3
WP_059243447.1\|1372106_1372955_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-21	34.7
WP_059243448.1\|1373228_1374275_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-21	33.2
WP_059243449.1\|1374444_1375281_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_059243450.1\|1375368_1376337_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059243451.1\|1376772_1377969_+	DUF2333 domain-containing protein	NA	NA	NA	NA
WP_059243452.1\|1379309_1380395_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	7.6e-20	57.6
WP_059243453.1\|1380576_1380927_+	ArsC family reductase	NA	NA	NA	NA
WP_059243454.1\|1383863_1385111_+	peptide transporter	NA	NA	NA	NA
WP_059243455.1\|1385149_1386148_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_059243457.1\|1386395_1387067_+	hypothetical protein	NA	NA	NA	NA
WP_059243459.1\|1387088_1388540_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_082253154.1\|1388572_1388755_+	hypothetical protein	NA	NA	NA	NA
WP_059243460.1\|1388858_1390175_+	Hsp70 family protein	NA	NA	NA	NA
WP_059244056.1\|1390569_1391859_+	cell wall hydrolase	A0A218MLD1	uncultured_virus	1.8e-23	45.0
WP_008508103.1\|1392129_1392528_+	ATP synthase subunit	NA	NA	NA	NA
WP_059243462.1\|1392635_1393385_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_059243464.1\|1393452_1393680_+	ATP F0F1 synthase subunit C	NA	NA	NA	NA
WP_008508118.1\|1393851_1394478_+	F0F1 ATP synthase subunit B'	NA	NA	NA	NA
WP_059243466.1\|1394488_1394968_+	ATP F0F1 synthase subunit B	NA	NA	NA	NA
WP_059242707.1\|1395131_1396502_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-83	39.6

DBSCAN-SWA_5

1582209 : 1624619

Paenibacillus_phage(27.27%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006072570.1\|1582209_1583538_+\|tRNA	proline--tRNA ligase	A0A2K9L6B6	Tupanvirus	8.8e-10	27.1
WP_059243586.1\|1583534_1584848_+	lipoprotein-releasing system transmembrane subunit LolC	NA	NA	NA	NA
WP_059243587.1\|1584847_1585531_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-27	32.3
WP_059243588.1\|1586188_1589680_+	DNA polymerase III subunit alpha	A0A0K1Y8F0	Streptomyces_phage	8.0e-188	37.6
WP_002963959.1\|1589720_1589918_+	DUF3008 domain-containing protein	NA	NA	NA	NA
WP_059243589.1\|1589962_1590361_-	hypothetical protein	NA	NA	NA	NA
WP_082253173.1\|1590308_1590491_-	hypothetical protein	NA	NA	NA	NA
WP_059244077.1\|1590793_1591765_-	extensin	NA	NA	NA	NA
WP_002967582.1\|1592099_1592717_+	30S ribosomal protein S4	NA	NA	NA	NA
WP_002969416.1\|1593225_1594107_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	7.2e-77	56.4
WP_059244078.1\|1594093_1594909_+	inositol monophosphatase	NA	NA	NA	NA
WP_002963966.1\|1595139_1596405_-	Bcr/CflA family drug resistance efflux transporter	NA	NA	NA	NA
WP_082253174.1\|1596388_1596589_+	hypothetical protein	NA	NA	NA	NA
WP_059243590.1\|1596657_1597008_-	monothiol glutaredoxin, Grx4 family	NA	NA	NA	NA
WP_059243591.1\|1597189_1597426_-	BolA family transcriptional regulator	NA	NA	NA	NA
WP_059243592.1\|1597695_1599918_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	9.7e-163	42.3
WP_059244079.1\|1600104_1600506_-	hypothetical protein	NA	NA	NA	NA
WP_059243593.1\|1600565_1601213_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_059243594.1\|1601464_1602136_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002963973.1\|1602158_1602401_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_004688254.1\|1602516_1603281_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3F9V5	Synechococcus_phage	3.1e-44	41.7
WP_076770561.1\|1603305_1603500_+	hypothetical protein	NA	NA	NA	NA
WP_059243595.1\|1603536_1603860_+	DUF1476 domain-containing protein	NA	NA	NA	NA
WP_059243596.1\|1604741_1605308_-	serine hydrolase family protein	NA	NA	NA	NA
WP_059244080.1\|1605576_1606452_+	glyoxalase/bleomycin resistance/extradiol dioxygenase family protein	NA	NA	NA	NA
WP_059243597.1\|1606498_1606990_+	hypothetical protein	NA	NA	NA	NA
WP_059243598.1\|1606970_1608272_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.8e-20	30.9
WP_059243599.1\|1608298_1608976_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_059242692.1\|1609104_1609473_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059242693.1\|1609469_1609862_+\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059244081.1\|1609908_1610697_-	amino acid ABC transporter	NA	NA	NA	NA
WP_059243600.1\|1610952_1611636_+	glycerol-3-phosphatase	NA	NA	NA	NA
WP_059243601.1\|1611632_1612772_-	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
WP_059243602.1\|1612775_1613507_-	hypothetical protein	NA	NA	NA	NA
WP_059243603.1\|1613707_1614625_+	sugar kinase	NA	NA	NA	NA
WP_059243604.1\|1614621_1615644_-	galactose mutarotase	NA	NA	NA	NA
WP_082253224.1\|1615596_1615851_+	endonuclease	NA	NA	NA	NA
WP_059243605.1\|1615860_1616622_+	acetylmuramidase	A0A088F6V6	Sulfitobacter_phage	1.9e-33	42.1
WP_002963985.1\|1616822_1617104_+	acyl carrier protein	NA	NA	NA	NA
WP_059243606.1\|1617251_1618433_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_008505494.1\|1618434_1619712_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_059243607.1\|1619793_1620822_+	NADPH:quinone oxidoreductase	NA	NA	NA	NA
WP_059243608.1\|1620835_1621762_+	lipid A biosynthesis lauroyl acyltransferase	NA	NA	NA	NA
WP_059242693.1\|1621877_1622270_-\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059242692.1\|1622266_1622635_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059243610.1\|1622881_1623634_-	SIMPL domain-containing protein	NA	NA	NA	NA
WP_059242693.1\|1623861_1624254_-\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059242692.1\|1624250_1624619_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1642647 : 1654551

uncultured_Mediterranean_phage(80.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059243625.1\|1642647_1643499_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.0e-31	33.9
WP_059243626.1\|1643491_1644217_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.0e-44	46.2
WP_002964012.1\|1644362_1644581_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.5e-07	65.1
WP_059244083.1\|1644692_1645247_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_002964014.1\|1645243_1646068_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	9.8e-44	41.1
WP_059244082.1\|1646144_1647428_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.6e-104	47.0
WP_059243627.1\|1647578_1648346_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.0e-39	40.5
WP_059243628.1\|1648342_1649011_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC50	Streptomyces_phage	5.0e-14	31.8
WP_059243629.1\|1649155_1649341_+	hypothetical protein	NA	NA	NA	NA
WP_059243630.1\|1649389_1650688_+	peptidase M24	Q8SBN9	Clostridium_phage	1.0e-18	41.1
WP_059243631.1\|1650736_1651603_-	DUF815 domain-containing protein	NA	NA	NA	NA
WP_002964021.1\|1651762_1652104_+	immunogenic membrane protein YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	9.1e-12	40.2
WP_082253176.1\|1652223_1654551_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	8.0e-51	43.5

DBSCAN-SWA_7

1687788 : 1747366

Brucella_phage(32.0%)

portal,protease,transposase,integrase,tRNA,tail,head

attL 1687604:1687663|attR 1754357:1754498

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1687604:1687663	attL	NA	NA	NA	NA
WP_059243653.1\|1687788_1689042_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	7.6e-64	35.6
WP_059243654.1\|1689157_1690279_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_009363452.1\|1690275_1690608_-	multidrug transporter	E5E3Y9	Acinetobacter_phage	1.0e-07	33.7
WP_059243655.1\|1690719_1691397_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_059244086.1\|1691601_1692780_+	cysteine desulfurase	H7BUW1	unidentified_phage	5.5e-24	36.0
WP_059243656.1\|1692960_1694484_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_004688299.1\|1694551_1695307_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	1.2e-08	25.5
WP_059243657.1\|1695320_1696598_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_059243658.1\|1696679_1697924_+	cysteine desulfurase	Q2XUY6	environmental_halophage	3.5e-101	42.9
WP_059243659.1\|1697920_1698340_+	SUF system Fe-S cluster assembly protein	NA	NA	NA	NA
WP_059243660.1\|1698373_1699345_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_059243661.1\|1699771_1700545_+	NAD kinase	NA	NA	NA	NA
WP_059243662.1\|1700872_1702321_+	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.9e-51	33.7
WP_059243663.1\|1702556_1702937_-	Fe-S cluster assembly scaffold SufA	A0A218MM00	uncultured_virus	1.2e-09	33.7
WP_059243664.1\|1703129_1703753_+	hypothetical protein	NA	NA	NA	NA
WP_059243665.1\|1703833_1704034_+	copper chaperone	NA	NA	NA	NA
WP_044286316.1\|1704186_1704369_+	hypothetical protein	NA	NA	NA	NA
WP_002964067.1\|1704362_1705031_+	protein-L-isoaspartate O-methyltransferase	NA	NA	NA	NA
WP_059243666.1\|1705169_1706540_+	transporter	NA	NA	NA	NA
WP_059243667.1\|1706791_1707523_+	DUF2497 domain-containing protein	NA	NA	NA	NA
WP_082253180.1\|1707617_1707821_+	hypothetical protein	NA	NA	NA	NA
WP_059243668.1\|1707813_1710546_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	4.3e-144	39.9
WP_059243671.1\|1713990_1714866_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_059243672.1\|1715686_1716520_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_059243673.1\|1716522_1717245_-	ABC transporter permease	NA	NA	NA	NA
WP_009363100.1\|1717260_1717440_-	hypothetical protein	NA	NA	NA	NA
WP_059243674.1\|1717487_1718294_-	amino acid ABC transporter	NA	NA	NA	NA
WP_004689665.1\|1718638_1719142_-	molybdopterin-guanine dinucleotide biosynthesis protein B	NA	NA	NA	NA
WP_082253181.1\|1719138_1719804_-	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_004689666.1\|1719979_1721014_-	cyclic pyranopterin monophosphate synthase	NA	NA	NA	NA
WP_059243676.1\|1721200_1721560_+	DUF971 domain-containing protein	NA	NA	NA	NA
WP_059244087.1\|1723077_1724697_-	fumarate hydratase	NA	NA	NA	NA
WP_059242692.1\|1724985_1725354_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059242693.1\|1725350_1725743_+\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059243677.1\|1725850_1727851_+	peptidoglycan-binding protein	NA	NA	NA	NA
WP_082253182.1\|1728583_1728766_-	hypothetical protein	NA	NA	NA	NA
WP_004683734.1\|1728798_1729050_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_059243678.1\|1729517_1730543_-\|integrase	integrase	A0A141GEZ3	Brucella_phage	9.6e-49	37.8
WP_059243679.1\|1730529_1730730_-	hypothetical protein	NA	NA	NA	NA
WP_002971459.1\|1730732_1730948_-	hypothetical protein	NA	NA	NA	NA
WP_002964088.1\|1730944_1731148_-	hypothetical protein	NA	NA	NA	NA
WP_059243680.1\|1731144_1731348_-	hypothetical protein	NA	NA	NA	NA
WP_082253183.1\|1731337_1731526_-	hypothetical protein	NA	NA	NA	NA
WP_059243681.1\|1731509_1731929_-	hypothetical protein	NA	NA	NA	NA
WP_059243682.1\|1732160_1732811_-	hypothetical protein	NA	NA	NA	NA
WP_082253225.1\|1732937_1733594_-	DUF550 domain-containing protein	A0A076G6W7	Sinorhizobium_phage	4.9e-46	75.2
WP_059243683.1\|1733866_1734097_-	hypothetical protein	A0A1B0VMC0	Pseudomonas_phage	7.2e-05	42.7
WP_059243684.1\|1734093_1734471_-	HNH endonuclease	A0A141GF07	Brucella_phage	2.6e-07	41.7
WP_059243685.1\|1734636_1735038_-	hypothetical protein	A0A1I9KFA6	Aeromonas_phage	8.2e-12	37.6
WP_059243687.1\|1735729_1736239_-	hypothetical protein	NA	NA	NA	NA
WP_059243688.1\|1736235_1736451_-	hypothetical protein	NA	NA	NA	NA
WP_082253226.1\|1737154_1738120_+\|portal	phage portal protein	A0A0U2BXP2	Paracoccus_phage	4.5e-72	62.0
WP_059243689.1\|1738126_1738789_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	6.0e-60	53.6
WP_059243690.1\|1740098_1740278_+	hypothetical protein	A0A2H4JDE5	uncultured_Caudovirales_phage	3.5e-07	63.0
WP_059243691.1\|1740281_1740848_+	hypothetical protein	NA	NA	NA	NA
WP_059243692.1\|1740850_1741216_+\|head,tail	head-tail adaptor protein	A0A141GEW5	Brucella_phage	1.3e-45	81.6
WP_059243693.1\|1741193_1741631_+	hypothetical protein	A0A141GEW6	Brucella_phage	1.6e-37	55.7
WP_059476646.1\|1742030_1742234_+	hypothetical protein	A0A141GEW8	Brucella_phage	3.0e-31	97.0
WP_059243694.1\|1742312_1742765_+	hypothetical protein	A0A141GEW9	Brucella_phage	3.8e-74	88.0
WP_059243695.1\|1742764_1743160_+	gene transfer agent family protein	B4UTQ4	Rhizobium_phage	1.3e-33	62.3
WP_059243696.1\|1743344_1744919_+	hypothetical protein	B4UTQ6	Rhizobium_phage	3.0e-57	35.8
WP_059243697.1\|1744936_1745695_+	hypothetical protein	A0A141GEX2	Brucella_phage	2.4e-44	56.5
WP_059244088.1\|1746973_1747366_+	hypothetical protein	A0A141GEY4	Brucella_phage	3.5e-68	92.3
1754357:1754498	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2107677 : 2157878

Bacillus_virus(14.29%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059242790.1\|2107677_2108634_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_059476649.1\|2108571_2108949_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_059244111.1\|2109321_2110251_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_082253201.1\|2110284_2110551_-	hypothetical protein	NA	NA	NA	NA
WP_059243911.1\|2111678_2112458_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-11	24.5
WP_059243912.1\|2112472_2113282_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_059243913.1\|2113375_2113798_+	ribose ABC transporter	NA	NA	NA	NA
WP_059242693.1\|2113890_2114283_-\|transposase	IS5/IS1182 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.1e-16	40.2
WP_059243045.1\|2114279_2114525_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_006173995.1\|2114525_2114648_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059243914.1\|2119091_2120159_-	glycoside hydrolase family 43	NA	NA	NA	NA
WP_082253232.1\|2120138_2120318_+	hypothetical protein	NA	NA	NA	NA
WP_002964466.1\|2120395_2120632_-	hypothetical protein	NA	NA	NA	NA
WP_059244112.1\|2120704_2121949_-	glycoside hydrolase family 10 protein	NA	NA	NA	NA
WP_059243915.1\|2122775_2123078_+	urease subunit gamma	NA	NA	NA	NA
WP_059243916.1\|2123126_2123606_+	urease subunit beta	NA	NA	NA	NA
WP_059243917.1\|2125412_2126018_+	urease accessory protein UreE	NA	NA	NA	NA
WP_059244113.1\|2125989_2126721_+	urease accessory protein UreF	NA	NA	NA	NA
WP_002964473.1\|2126736_2127375_+	Urease accessory protein UreG 2	NA	NA	NA	NA
WP_059243918.1\|2127374_2128289_+	urease accessory protein UreD	NA	NA	NA	NA
WP_059243919.1\|2128298_2129348_+	urea transporter	NA	NA	NA	NA
WP_059243920.1\|2129374_2130133_+	DUF4198 domain-containing protein	NA	NA	NA	NA
WP_059243921.1\|2130152_2130788_+	cobalamin biosynthesis protein CbiM	NA	NA	NA	NA
WP_059243922.1\|2130784_2131411_+	hypothetical protein	NA	NA	NA	NA
WP_059243923.1\|2131407_2132172_+	cobalt ECF transporter T component CbiQ	NA	NA	NA	NA
WP_059243924.1\|2132168_2132888_+	cobalt ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.8e-17	33.2
WP_059243925.1\|2132908_2133721_-	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_059243926.1\|2133733_2134123_-	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_059243927.1\|2134392_2135418_+	hypothetical protein	NA	NA	NA	NA
WP_059244114.1\|2136100_2136535_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_059243928.1\|2136583_2137510_-	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_059243929.1\|2137614_2138346_-	NUDIX hydrolase	NA	NA	NA	NA
WP_059243930.1\|2138365_2139475_-	endonuclease	NA	NA	NA	NA
WP_059244115.1\|2139659_2140067_+	BA14K family protein	NA	NA	NA	NA
WP_059243931.1\|2140273_2141506_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_006642931.1\|2141638_2141863_-	hypothetical protein	NA	NA	NA	NA
WP_059243932.1\|2141940_2142960_-	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_015799671.1\|2143015_2143657_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_059243933.1\|2143865_2145821_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	8.2e-73	34.9
WP_059243934.1\|2146183_2146924_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_082253233.1\|2147222_2147621_+	STAS/SEC14 domain-containing protein	NA	NA	NA	NA
WP_059243936.1\|2147621_2148743_-	ATP-binding protein	A0A291LA07	Bordetella_phage	1.1e-103	52.9
WP_059243937.1\|2148922_2149495_-	acetolactate synthase small subunit	NA	NA	NA	NA
WP_082253202.1\|2149513_2151337_-	acetolactate synthase 3 large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	3.6e-54	32.2
WP_082253203.1\|2151319_2151505_+	carbonic anhydrase	NA	NA	NA	NA
WP_059243938.1\|2151602_2152517_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_059243939.1\|2152534_2153434_+	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_059244117.1\|2154706_2156281_-\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	8.2e-23	29.0
WP_002964504.1\|2156770_2156956_-	DUF2065 domain-containing protein	NA	NA	NA	NA
WP_059243940.1\|2156975_2157878_-\|protease	protease modulator HflC	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_LN997864

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

517200 : 590747

Streptococcus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059242707.1\|517200_518571_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-83	39.6
WP_059244626.1\|518952_520170_-	6-aminohexanoate hydrolase	NA	NA	NA	NA
WP_059244628.1\|520422_522720_-	GGDEF-domain containing protein	G3MA91	Bacillus_virus	4.3e-12	26.9
WP_059244630.1\|523085_523835_-	2-deoxy-D-gluconate 3-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.9e-17	30.1
WP_059244634.1\|524878_525874_-	2-hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_059244636.1\|525959_526979_-	transcriptional regulator	NA	NA	NA	NA
WP_082253267.1\|527125_527617_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_059244638.1\|527795_528566_+	creatininase	NA	NA	NA	NA
WP_059244640.1\|528801_529926_+	GTP-binding protein	NA	NA	NA	NA
WP_059244642.1\|530044_531019_+	WD40 repeat domain-containing protein	NA	NA	NA	NA
WP_059244643.1\|531138_532023_-	carboxylesterase	NA	NA	NA	NA
WP_059244646.1\|532427_533387_+	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_059244647.1\|533388_534051_+	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_002965659.1\|534267_534612_-	RidA family protein	NA	NA	NA	NA
WP_059245347.1\|534685_535639_-	ABC transporter permease	NA	NA	NA	NA
WP_059244650.1\|535635_536595_-	ABC transporter permease	NA	NA	NA	NA
WP_002968592.1\|538134_539202_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059244654.1\|539503_540298_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_059244656.1\|540392_541574_-	hypothetical protein	NA	NA	NA	NA
WP_059244659.1\|541741_543772_-	TonB-dependent copper receptor	NA	NA	NA	NA
WP_059244660.1\|543869_544277_-	hypothetical protein	NA	NA	NA	NA
WP_059244662.1\|544417_544804_-	VOC family virulence protein	NA	NA	NA	NA
WP_059244664.1\|544986_545592_-	glutathione S-transferase	NA	NA	NA	NA
WP_059244666.1\|545695_546997_-	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_059244668.1\|547161_548328_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.6e-18	35.0
WP_059244670.1\|548502_549735_-	L-2-hydroxyglutarate oxidase	NA	NA	NA	NA
WP_059244672.1\|549890_550889_+	3'-5' exonuclease	U5Q053	Bacillus_virus	1.6e-08	28.9
WP_059244675.1\|552075_552924_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-21	33.5
WP_059244677.1\|552920_553946_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-18	32.4
WP_002965640.1\|553942_554803_-	ABC transporter permease	NA	NA	NA	NA
WP_008511275.1\|554799_555753_-	ABC transporter permease	NA	NA	NA	NA
WP_059476656.1\|555850_557329_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059244680.1\|558144_559638_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_025198526.1\|559621_560308_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_059244682.1\|560678_562058_+	MFS transporter	NA	NA	NA	NA
WP_059242707.1\|562439_563810_-\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-83	39.6
WP_004682439.1\|565234_565579_-	RidA family protein	NA	NA	NA	NA
WP_002965630.1\|565661_565886_+	hypothetical protein	NA	NA	NA	NA
WP_002965629.1\|565886_566021_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_004692143.1\|566070_566496_+	ribonuclease P protein component	NA	NA	NA	NA
WP_059244688.1\|566485_568318_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_082253268.1\|568242_568479_-	hypothetical protein	NA	NA	NA	NA
WP_059244690.1\|568517_569321_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_059245349.1\|569491_570382_+	acetylglutamate kinase	NA	NA	NA	NA
WP_059244692.1\|570428_571133_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_011005564.1\|571194_572025_-	3-isopropylmalate dehydrogenase	A0A1D8KU27	Synechococcus_phage	1.3e-11	31.9
WP_002965622.1\|572243_573098_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_012460498.1\|573241_573493_-	hypothetical protein	NA	NA	NA	NA
WP_082253269.1\|573492_573825_-	hypothetical protein	NA	NA	NA	NA
WP_059244694.1\|574078_575266_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_059244696.1\|575327_575933_+	hypothetical protein	NA	NA	NA	NA
WP_059242693.1\|576021_576414_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_059242692.1\|576410_576779_-\|transposase	IS5/IS1182 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.0e-21	42.4
WP_082253270.1\|576749_577730_+	hypothetical protein	NA	NA	NA	NA
WP_059243255.1\|585306_586263_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_059242967.1\|589790_590747_+\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LN997863

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_LN997864

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection