CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LN890476	Achromobacter xylosoxidans isolate R4 chromosome BN2905	3 crisprs	DinG,cas3,DEDDh,csa3,WYL,PD-DExK	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LN890476_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890476_1

32337-32444

Orphan

Consensus_repeat	Method
GGGGGGCAGCGACCCGCGCAGCGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN890476_1

>merge|NZ_LN890476|1|32337-32444|CRISPRCasFinder
GGGGGGCAGCGACCCGCGCAGCGGCGAGCGTGGGGGGCTTTTTTTGCCGCCGGGCCGCCCCAAGGCAAAAACGCCCCCTCGGGGGGGGCAGCGACCCGCGCAGCGGCG

>NZ_LN890476|1|1|32337-32444|CRISPRCasFinder
GGGGGGCAGCGACCCGCGCAGCGGCG	AGCGTGGGGGGCTTTTTTTGCCGCCGGGCCGCCCCAAGGCAAAAACGCCCCCTCGG
GGGGGGCAGCGACCCGCGCAGCGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890476.1\|WP_155866878.1\|30295_32248_+\|phospholipase-C,-phosphocholine-specific	unknown	unknown	gnl\|CDD\|274561
NZ_LN890476.1\|WP_155866877.1\|16531_20023_-\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|235554
NZ_LN890476.1\|WP_149894951.1\|39852_40578_-\|DNA-3-methyladenine-glycosylase	unknown	unknown	gnl\|CDD\|234840
NZ_LN890476.1\|WP_006384047.1\|32503_33229_-\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|182974
NZ_LN890476.1\|WP_006384050.1\|35816_37346_-\|amidase	unknown	unknown	gnl\|CDD\|223232
NZ_LN890476.1\|WP_006384044.1\|28409_29768_+\|amino-acid-N-acetyltransferase	unknown	unknown	gnl\|CDD\|235386
NZ_LN890476.1\|WP_006384054.1\|40582_40939_-\|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein	unknown	unknown	gnl\|CDD\|239333
NZ_LN890476.1\|WP_006384056.1\|41741_42662_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182646
NZ_LN890476.1\|WP_155866879.1\|34097_35762_-\|isovaleryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|183199
NZ_LN890476.1\|WP_006384040.1\|20152_21052_+\|lipid-A-hydroxylase-LpxO	unknown	unknown	gnl\|CDD\|380241
NZ_LN890476.1\|WP_006384057.1\|42658_43786_-\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
NZ_LN890476.1\|WP_155866880.1\|37534_38914_-\|DNA-recombination-protein-RmuC	unknown	unknown	gnl\|CDD\|224241
NZ_LN890476.1\|WP_049050957.1\|14595_15444_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|213026
NZ_LN890476.1\|WP_155869586.1\|24331_28243_-\|ATP-dependent-RNA-helicase-HrpA	unknown	unknown	gnl\|CDD\|273900
NZ_LN890476.1\|WP_006384045.1\|29887_30160_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_LN890476.1\|WP_006384038.1\|15440_16532_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_LN890476.1\|WP_049055496.1\|33380_34061_-\|ribose-5-phosphate-isomerase-RpiA	unknown	unknown	gnl\|CDD\|234816
NZ_LN890476.1\|WP_006384041.1\|21123_22419_-\|AAA-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|224041
NZ_LN890476.1\|WP_049050958.1\|22427_24161_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|227319
NZ_LN890476.1\|WP_006384055.1\|40935_41745_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182574

Protein	Function_ID	Function_description	E-value
NZ_LN890476.1\|WP_155866878.1\|30295_32248_+\|phospholipase-C,-phosphocholine-specific	gnl\|CDD\|274561	TIGR03396, PC_PLC, phospholipase C, phosphocholine-specific, Pseudomonas-type. Members of this protein family are bacterial, phosphatidylcholine-hydrolyzing phospholipase C enzymes, with a characteristic domain architecture as found in hemolytyic (PlcH) and nonhemolytic (PlcN) secreted enzymes of Pseudomonas aeruginosa. PlcH hydrolyzes phosphatidylcholine to diacylglycerol and phosphocholine, but unlike PlcN can also hydrolyze sphingomyelin to ceramide ((N-acylsphingosine)) and phosphocholine. Members of this family share the twin-arginine signal sequence for Sec-independent transport across the plasma membrane. PlcH is secreted as a heterodimer with a small chaperone, PlcR, encoded immediately downstream. [Cellular processes, Pathogenesis].	0
NZ_LN890476.1\|WP_155866877.1\|16531_20023_-\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|235554	PRK05673, dnaE, DNA polymerase III subunit alpha; Validated.	0
NZ_LN890476.1\|WP_149894951.1\|39852_40578_-\|DNA-3-methyladenine-glycosylase	gnl\|CDD\|234840	PRK00802, PRK00802, DNA-3-methyladenine glycosylase.	1.70734e-66
NZ_LN890476.1\|WP_006384047.1\|32503_33229_-\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|182974	PRK11115, PRK11115, phosphate signaling complex protein PhoU.	3.54726e-72
NZ_LN890476.1\|WP_006384050.1\|35816_37346_-\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	3.62445e-96
NZ_LN890476.1\|WP_006384044.1\|28409_29768_+\|amino-acid-N-acetyltransferase	gnl\|CDD\|235386	PRK05279, PRK05279, N-acetylglutamate synthase; Validated.	0
NZ_LN890476.1\|WP_006384054.1\|40582_40939_-\|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein	gnl\|CDD\|239333	cd03035, ArsC_Yffb, Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC. The structure of Yffb and the conservation of the catalytic cysteine suggest that it is likely to function as a glutathione (GSH)-dependent thiol reductase. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from GSH via glutaredoxin, through a single catalytic cysteine.	6.45727e-47
NZ_LN890476.1\|WP_006384056.1\|41741_42662_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182646	PRK10683, PRK10683, putrescine transporter subunit: membrane component of ABC superfamily; Provisional.	3.4801e-128
NZ_LN890476.1\|WP_155866879.1\|34097_35762_-\|isovaleryl-CoA-dehydrogenase	gnl\|CDD\|183199	PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provisional.	0
NZ_LN890476.1\|WP_006384040.1\|20152_21052_+\|lipid-A-hydroxylase-LpxO	gnl\|CDD\|380241	NF033391, lipid_A_LpxO, lipid A hydroxylase LpxO. Members of this family are LpxO, an enzyme that modifies one of the lipid chains in lipid A by hydroxylation, with resulting changes in resistance to the host immune response and to the antibiotic colistin. This family, as built, includes LpxO1 from Pseudomonas aeruginosa, but not its paralog LpxO2.	0
NZ_LN890476.1\|WP_006384057.1\|42658_43786_-\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	1.1279e-159
NZ_LN890476.1\|WP_155866880.1\|37534_38914_-\|DNA-recombination-protein-RmuC	gnl\|CDD\|224241	COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only].	2.52835e-94
NZ_LN890476.1\|WP_049050957.1\|14595_15444_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|213026	cd10969, CE4_Ecf1_like_5s, Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.	6.05208e-87
NZ_LN890476.1\|WP_155869586.1\|24331_28243_-\|ATP-dependent-RNA-helicase-HrpA	gnl\|CDD\|273900	TIGR01967, ATP-dependent_RNA_helicase_HrpA, RNA helicase HrpA. This model represents HrpA, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterized, is about 800 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing. The HrpA/B homolog from Borrelia is 500 amino acids shorter but appears to be derived from HrpA rather than HrpB. [Unknown function, Enzymes of unknown specificity].	0
NZ_LN890476.1\|WP_006384045.1\|29887_30160_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	2.71711e-57
NZ_LN890476.1\|WP_006384038.1\|15440_16532_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	5.99363e-66
NZ_LN890476.1\|WP_049055496.1\|33380_34061_-\|ribose-5-phosphate-isomerase-RpiA	gnl\|CDD\|234816	PRK00702, PRK00702, ribose-5-phosphate isomerase RpiA.	3.4245e-115
NZ_LN890476.1\|WP_006384041.1\|21123_22419_-\|AAA-associated-domain-containing-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	3.19271e-110
NZ_LN890476.1\|WP_049050958.1\|22427_24161_-\|ABC-transporter-permease-subunit	gnl\|CDD\|227319	COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism].	4.11939e-173
NZ_LN890476.1\|WP_006384055.1\|40935_41745_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182574	PRK10592, PRK10592, putrescine transporter subunit: membrane component of ABC superfamily; Provisional.	1.7753e-105

>NZ_LN890476.1|WP_155866878.1|30295_32248_+|phospholipase-C,-phosphocholine-specific
MKEDPSSASSSDLPPAIRRALAVAPDRKHGTLHDVRHVVILMQENRSFDHYFGSLPGVRGFADPHPVPTPASDVLTQADGAERVRPYALQGEYASDTPVGYITPHTWDDAQRAWNDGRMDQWLAAKRRLGMGAYRPAEVPFQTALANAFTLCDAYHCSVQAGTNPNRLFLWTGTNDPLGRAGGPALVNTFDRLGPADQGYGWTTYPERLQAAGIDWRIYQDMADNFHDNPLAGFRQYRRQHEAGGADAPLRDRGLSTHTLDDLAHDVEQDALPQVSWIIAPAADSEHPEVSSPRQGGAYTERVLEILTRNPAVWSGCVLLVTYDENDCFFDHMPPPAPPTRETDGRSGGLSTVELDGEYHDTRHGPSAATPDDPAALHGRGFGMGPRVPMLVVSPWSRGGWVNSQVFDHTSVIRFLEARFGVAEPNISAWRRAVAGDLTSAFDFAGDRATLHADSARHTCALPYALEAVGRMTADGEHYRLTFRNPGTAGAVLHVYDRRALERAPRRYTVGAGARLDDGWRLDAEGAYDLWLLGPDGFHRRFRGDTRDAGLLETQLVPVTSGIRLRLINHGDTHLPVQIESRMGDGWRAMAHVQAGGALELKYAGCEGWYDLDVSAQGLPAFGRRLAGRINAGKSGVPDPRLCQGAELPL
>NZ_LN890476.1|WP_006384045.1|29887_30160_+|oxidative-damage-protection-protein
MARTVNCVKLKREAEGLDFPPYPGELGTRIWQSISKEAWEEWKQVQTRLVNENRLNLADARARKYLQQQMERFLFEDGSVEAQGYVPPSA
>NZ_LN890476.1|WP_006384044.1|28409_29768_+|amino-acid-N-acetyltransferase
MPDLEPDTVSALEAPEFAPAQFVRWFRDVAPYVHAFRGKTFVVAFGGELVQAGALNALVQDLSLLSSLGIRLVLVHGSRPQVNEQLRLKGFTQQFDRGLAPTDAAALECAKEAAGEIRLDIEAAFSQGLPNTPMSHAHIRVISGNFVTARPTGVLDGVDYKHTGQVRKIDVDALKFAIEKGSSVVLLSPLGFSPTGDAFNLAMEDLATSVAVALRAEKLIFLSSGQGVLNDDGSVDTELARVDADALLAGGSLDEETGAYLQYASLAVKRGVARAHLVPFALDGSVLLEIFTHDGVGTMVVEDTLDDLRPATLDDVGAILSLIEPLEADGTLVPRPRSVIERDVENFTVLEHDGVIYGCATLHNFPEDHMAEMACLIVHPEWQGSGEGEILLRHMESRARASGAKRLFVLTTRTSHWFMKRGFVQGGIADLPREKQNNYNRSRNSLVFIKKL
>NZ_LN890476.1|WP_155869586.1|24331_28243_-|ATP-dependent-RNA-helicase-HrpA
MPADGPTRGPRKPRADAAAPAARQAPRPERPIPAVTYPEDLPVSARRQEIARAIAGHQVVIVSGETGSGKTTQLPKICLELGRGRQKMIGHTQPRRLAATSVAKRIAEELNTPMGEVVGYQVRFNDRTGPNASIKLMTDGILLAESQRDPLLRRYDTIIIDEAHERSLNIDFLLGYLKQLLPRRPDLKVIITSATIDAERFARHFAASEDKPAPVIEVSGRLYPVEVRYRPVREEAAEDEAAPARPGRDRERMSGDEERDLIDAIVDAVDECARHGPGDVLVFLPGEREIRESAEALRKRHPAGTEVLPLYARLSQAEQEQIFHPRGNARRIVLATNVAETSLTVPGIRFVVDSGLARVKRYSWRNKVEQLRIEPVSRASANQRAGRCGRVGPGVCVRLYDEADFNARAAFTDPEVLRSSLASVILRMKSLKLDDIEQFPFVEAPPGRAVADGYHLLQELGAIELAAADDGDDASRTGASFVLTQTGHELAKLPVDPRIGRMILAAREHQCLAEMLIIASALSVQDARDRPMQEREAAEAAHAKFADDKSEFISFLKLWRWYGEQVQHKASQRKLVGLLRQNFLSPIRLREWHDVHTQLAALVGEQGWRVNQVEATYEQLHMALLSGLLGNIGFKSDEGGHYQGAREIRFHIHPGSRLVKKAGRWIVAAELVETTRLYARCVARIDPVWLEKVGAHLIRKNWSDPRWEKKAGQVVANERATLYGLTIYSGRRIQYGRVHPREARELFIRQALVPGEIDTRLAFVAHNRKLIAGIEKLEHQTRRPDILVDDELIYAFYDRQLPADISQTATLEKWVNGLDKAEAAKLLLTRDELMRHEAAGVTTDVFPKKVEWQGVSMALDYHFEPGSPRDGVTLAVPLFALNQIDPARCEWLVPGMLKEKVHLLLKSLPQKLRRHCVPLPDYAAGFYDRWFERLGDPQTGLVDALIADMWDQVQVRPAAADFKLETLPAHLFMNFRVVDEHGRMLAAGRNLAQLRAEFGKQAQATFQQLAASDTQVAQALAHENLTAWTFGPLPEIMEIKRRGQSVIGYPALVDRGAHCDLDVFDDPDEARKAHRAGLLKLFRLGLREQVKFLEKNLADLTKISMLYMTLGTQEELRDQIIDCALGQACLAEPWPVNEQQFEARRAEGKGRLGLLAQEVARLAGTILTEYATLQRKLPQAKPHAAAYADLQQQLGALIPKWFIRDTPYPQLSHFPRYLKAAVARIDKLRADPGRDAKLVAEMAPLVTQYQRARSALKGAPDPRLDEFRWLLEELRVALFAQELRTPMPVSVKRLMKSWESLQR
>NZ_LN890476.1|WP_049050958.1|22427_24161_-|ABC-transporter-permease-subunit
MFELFSTRTRPSASSRSSPNRWDWALLPLVLGVLAAMAYGASQMSRPFAVGEELPISLDPIYLPYYLLRTILRMFTALAFSLLFSFVFAAIAAKFRTAEKAMIPMLDILQSVPILGFQAIAIAPFIALFPGNLLGVECAAIFAIFTSQAWNMAFSLYQSMRTVPAELNEAARVFRLSGWQRFWRLELPYATPGLLWNMMMSMSGGWFFLVAAEAISVAGQDIKLPGIGSYIAVAIDAENGRAIAWAIGAMMAGILLYDQLFFRPLLAWADKFRFEESQADVAQQSWLLDWTRRSRWMQALSNMFWARMRRALGWFSVPYDGTSIRARAKAPDPRWTRIWDSLLAAAALLATYKLVVFVHQEVGWSEVLHVVGLGGITLARVMVLIGLASLIWVPIAVWIGLRPRYSQRVQAVAQFLAAFPVNLLFPAVVFVMVAFKLNPNIWLSPLIIFGTQWYILFNVVAGASTIPNELRLAAGNLGLKGWLLWRRVYLPAVFPSFITGAITASGGSWNASIVAEYVSWGNTSLVADGLGSYIKQMTEQGDFHRIALGIGVMSIFVMLLNRFFWRKLYLLAEDRGR
>NZ_LN890476.1|WP_006384041.1|21123_22419_-|AAA-associated-domain-containing-protein
MPSNFLIELHDVGKSFRAADGTARHVLEHVDFTLREGEIVALLGKSGSGKSTLLRIMAGLVNADQGTVTYRGQPVYGPAAGIAMVFQSFALFPWLTAQQNVELGLEAQGVAPAERARRADAVLDLMGLGGFGGALPRELSGGMRQRVGIARALVMNPDVLLMDEAFSALDVLTGETLRDDMLELWDESRISTKGILIVSHNIEEAVMMADRIIVFSSDPGRIRSQVQIGLPRPRNADSPQVRALIDEVYALMTQRPAHDMPTPRQQGLGYRFPHTEVERMEGVLDVLAEAPFNGRADLPKLAEEAEISDDDLLPACEALGLFGLAQIDKGDIYLTPLGQRYVQADQDQKQAIFGRQLLAHVPLAAHIRHSLEQEPAGELPERNFLDSLEEFLKPDEAERVLKIAVEWGRYGEIYGYDYHTGLLSLPERAAG
>NZ_LN890476.1|WP_006384040.1|20152_21052_+|lipid-A-hydroxylase-LpxO
MKWLIPGIWLAAILFAHFRGRVKLPLGRQLLDHSVLLAPVNAFMVLTSRVPSTPYLTTSEIAELKVLDDNWETIRDEALQMAELRRIKAADSHNDIGFNSFFKYGWKRFYLKWYDARHPSAEELCPKTVAILKTLPKVKAAMFAELPPGGKLNAHRDPFAGSLRYHLGLATPNDDRCHIIVDGESYSWRDGESVVFDETYVHEAYNHTDQNRIILFCDVERPLKWGWAEAFNRWFGRVVMSAASSPNDGGDQTGAINKLTHAHWVIDQKRKAFKAWNRNVYKATKYGLIILVIAGFIAL
>NZ_LN890476.1|WP_155866877.1|16531_20023_-|DNA-polymerase-III-subunit-alpha
MSEAVTTPSPFVHLRVHSEFSVVDGIVRIPDLIKRVAKLGQPAVALTDLSNLFGLIKFYKGARGAGIKPIAGCDVWLSNDDDPAKPFRVLLLVRNHQGYLNLCELLSRAFLTNQGKGRAEIRREWLQGQDGLIVLSGGRGGDVGQALDAGNAVSALALARQWAHMFPGSYYIELQRAGMDGDEAYTQAAMRLAAEAGLPVVATHPVQFLDEYEFQAHEARVCIAEGEILANPRRVRRFSKEQYLLSSEEMARRFADVPSALANTVEIAKRCNLSLVLGKPRLPNFPTPDGVSLDDYLVQLSEEGLEKRMAFLFPDEAERASKREQYYERLRWECKTIIQMGFPGYFLIVQDFINWGKNNGVPVGPGRGSGAGSLVAYALGITDLDPIRYDLLFERFLNPERVSMPDFDIDFCQDNRERVIDYVKEKYGRAAVSQIATFGTLGAKAVVRDAGRVLDMPYMFCDGLSKLIPFNPMDPWTLECTLKDEPAFKDRYEQEEEVRALVDLAKPLEGLTRNIGMHAGGVLIAPGKLTDFCPLYCQPGQENSAVSQFDKDDVEAAGLVKFDFLGLRNLTILDWAVRYVRQFNEDKRDFDVMALSLDDPAAYKILCDANTTAVFQLESRGMKELLKKLRPNTFEDIIAMLALYRPGPLESGMVDDFVNRKHGRAAVDYFHNDLESTLKSTYGVIVYQEQVMLISQIIGGYSLGGADLLRRAMGKKKPEEMAKHRELFEKGAKEKGHDPDLAVKLFDLMEKFAGYGFNKSHSAAYALISYQTAWLKAYHPTEFLAATMSSDMDDTDKVQIFCRDAQDNGVEVLPPDVNFSGYRFEPVADKHTEKGKPPRTMRYGLGAVKGTGQGAVEDILRARKEGGPFQNLFDFCRRVSKHAVNRRTIEALIKAGAFDTIEPNRAAMLASVPTAMEAAEQAARSANQSSLFGDDSSDVVAGELAKVAPWDLHKKLTEEKSALGYYYSGHLFDAWRDEVRQIVPMQLARVEPQRDLQWMCGVLASVRVMMTRRGKMVFAVLDDGTAQVEISVFNELYEKHRNRLREDQLVIVQGKVSNDDYSGGMRIVAEQLYDLQLAREARAKSLRVKLNGGADAARLRQMLNPFRAEPENGIPGVPVDIVYTKNNFLCTVRLGEEWRVRMADTLLENLNAWTKPNGVEVTY
>NZ_LN890476.1|WP_006384038.1|15440_16532_-|glycosyltransferase-family-4-protein
MRIVHSEAATSFGGQEGRIFKEMNAMRARGHHLEAICQPTALLAERLSDAGFTVHTLEMDGPVNYVKGVIAIRRILREGRFDVLNTHSRRDTVIAAAAGRLAGTPLIVRTRHLSNKVGSLWSYTRLPHRVTTVSDHVREHLIERGVPADHVATVYSPIVLPPPVEHSTLREELGLAADDVVVGCVAVMRATKGHKDLIDAIAPLMAARPKLHLVFVGGGSPVFEQTQAYVAERGLADRIHLMGMRRDVPNLLAGCDLFALATQQEASGTVYVEAQASGLPVIGTDVGGVSEMFRDGETGILVPPKDPAALTAALERLVDDAALRHRMGEAGRKMVWEEGVFSPARLAETTEAVYTRWLAERRG
>NZ_LN890476.1|WP_049050957.1|14595_15444_-|polysaccharide-deacetylase-family-protein
MNAPNVPVLMYHHVTPAGGMIAATPEVFEAQIARLARAGYQSLSTDQFAAYLAGASAPERSVLITFDDGYLNNWVHAHPVLARHGMRAVLFTITGWIGDGPARPHAGQGLPLPATPDHDACKKLIAAGRGDEAMLRWSEIEAMRAAGTFEFHSHTHTHTRWDKVCGADTEAKRAHIARELSDSRETLIQRLGQASDHLCWPQGYFDADYVAAARQAGFRHLYTTDPFGQNTPGADPGHIYRFAVRNQGGTWLNRRLWLSRDPFWGPRYHAWKAWKKRLRNRG
>NZ_LN890476.1|WP_006384047.1|32503_33229_-|phosphate-signaling-complex-protein-PhoU
MTEHTNKQFDADLESVRSQFLQMGGVVEAMIQEAIDALASGDLTLVEKVREREKEVNRHEVEIDESISRILARHQPTAIDLRMLMAVSKMLTDMERSGDEAEKVATVARRIHESEVRHIPVIELRHMAANVRTMLHQALDAFARLDPILAAAVVRSDKEVDKEWKGALRHLITYMIEDPRTISRAIDMIFIARALERIGDHAKNMSERVIYMVKGADVRHTGVKNTERLARGEEDTPGQDD
>NZ_LN890476.1|WP_049055496.1|33380_34061_-|ribose-5-phosphate-isomerase-RpiA
MLSQQELKQQAADAALELVEQVAGPDVIIGVGTGSTADLFIDGLARFKGRIGGTVASSERSAARLAGHGLKVLDLNDVTSMPIYVDGADEIDANLHMIKGGGGAQTREKIVASVADRFVCIVDESKLVEVMGKFPLPIEVIPMAREAVARAMTAMGGQPRLREGFVTDNGNIILDVAGLSITDAPGLEARVNNLPGVVTCGLFAIAGADVALLATQNGIRRLDRRA
>NZ_LN890476.1|WP_155866879.1|34097_35762_-|isovaleryl-CoA-dehydrogenase
MPSFVTHTVLNQVPPLEDYSLFETDPALREAAVREGAGAWLGDLGAHGAWLGRAQTLAAGVDANRYPPRLQAYDRTGHRIDHVDFHPAWQLLMSGIVARGLHSRAWVQPVPGAQVARAAAYLMQGQVEAGTLCPTTMTFAAVPLLQREPAGVIDYTGDWLPALYSREFDGADAPLAGKRGALIGMGLTEKQGGSDLRAVTTRAAPLGAIGRGCAYLLVGHKWFFSVPQADAHLVLAQTDEGLGCFLVPRWIPEGPRNAVRIRRLKDKLGNHSNASAEVEFEDAWGVMVGEPGRGLAVLLEMAATTRLDCVLGSAALLRQALVQSLHHACHRQAFGKPLLAQPLMRNVLGDLALESEAAQALALRLARAVDERGDAGARALARVGTPAAKLWVCKRAIAAVAECMEAWGGNGYVEEGPMPRLYRETPVNSIWEGSGNVMALDVLRALQREPEALPALEGEFAPALGRYREFDAALARWRALLADPAQAEFQARRIACGLACLWQAALLIRHAPGPVAQGFVGSRLAGVGGVFGELAGGLDVGTILARAWPAAAAC
>NZ_LN890476.1|WP_006384050.1|35816_37346_-|amidase
MGTADRVDSSSFDAMALGAEIAQGATTAQAAMQQAVERVAARNPSINAACGVQAELGLDLARALDDELATLTAEQRLALLRERPFLGVPTLLKDLGTAALGLPSAMGSVLYGQVEWNVDAEIVKRYRRAGLIPFGRSTSAELGLSPTSESPVYGAPTQNPWKAGHSAGGSSGGAGAALASGMVRIAHGSDGGGSIRIPASCCGVLGLKPSRGMMPLGPLKGEGWGGLATEHMMTLSVRDCAAALDISAGADVGAPYAAPARPGESYRDIVARVSADPRSSPRRRIAYINTTYEGEAIHPEVAAAVDEAARLFAGLGHELVVAAPPVGSEEVLSPMLPLIASAAANAIDSFVGARNRRLAADELQPTTLGAREYARAISGAQYVACVDTCHEITRRIGRFLHREGTQGHDLFLSPVLAQLPAPIGRYAMDNADYLAYRLGKKGVIGYSPFAPLANLTGMPAISIPFGLSADGLPIGIQVMGPLGSEAWLLELAAQVEALRPWQRVAPIAR
>NZ_LN890476.1|WP_155866880.1|37534_38914_-|DNA-recombination-protein-RmuC
MSNEVLLWVAAGGAILACLAALMAWLSRPARDDRLDALLDGLERTERALRADIAEGQRGLRAEFSESTRGLRQELAQSHGELRAALTRDAQAARVESAESLARFAAGFNEQLQGLIQINERRLMEVRETVDQRLQALQNDNSAKLDDMRRTVDEKLHATLEQRLGESFKQVSDRLEAVHKGLGEMQALAAGVGDLKRVLTNVKSRGTWGEVQLARLIEDNMTPEQYASNIKPVPGSDAVVEFAIRLPGRGDGGMPVWLPIDAKFPKEEYERLMDAQEAADAEGVKAAGAALAKAVELQARLIATKYVAPPHTTDFAIMFLPTESLYAEVLRRPGLLDRLQDLRINVAGPSNLAALLNSLQMGFRTLAIEQRSSEVWQVLRAVKTEFGKFGDALAGVKKTLDTASSKIGQTEVRTRAMLRNLKSVEALPEAEALRLLGGEGAADETAAEGDAPAAPASGA
>NZ_LN890476.1|WP_149894951.1|39852_40578_-|DNA-3-methyladenine-glycosylase
MAGKADKASRGAGKALPDAFFNRDARQLARELLGTVVRHRVDGLWLSARIIETEAYYLEEKGSHASLGYTHKRRALFMDGGVVYMYYARGGDSLNFSAGGPGNAVLIKSGYPWVDALSGPEALARMQALNPDAQGRPRLPARLCAGQTLLCRALGLKVPDWDARRFDPDALYVEDVGESPQALISTARLGIPPGRDEHLEYRYVDPAYAAWCTRNPLRRGQVAGRDYHWVDRQGAPLKQAP
>NZ_LN890476.1|WP_006384054.1|40582_40939_-|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein
MKQTTLYGLTKCSTCVKAREWLTAHGVDHQFIDYRDHPVPAATLKEWAGQLGGWEKLVNRASMTWRNLPDDRKTASTDAQWTKLIAEFPALVRRPVAVTPDGEVGVGFSEKRYGERFA
>NZ_LN890476.1|WP_006384055.1|40935_41745_-|ABC-transporter-permease-subunit
MNGPNKTLRAVVLGLGYFFLYVPIISLMVFSFNESPAVTSWTGFSFRWYHSLFNDDALLRAAWLSFRIAAMTATAAVIIGTWAGYVLGRMGRFRGFALYVGMLSAPLVIPEVVLGISLLLMFVELRGHLGWPAENGIFTIWVGHVTLCMAFVAVVIQTRIRDLDRSLEEAALDLGATPITVFFKITLPLIAPALASAWLLSFTLSLDDVVLASFLSGPSSSTLPMEVFSRVRLGLKPEINALATLFILAVGTCVILANRMQWRKESEPK
>NZ_LN890476.1|WP_006384056.1|41741_42662_-|ABC-transporter-permease-subunit
MSRFSPRDWLPSGRTLAVVPPFAWLVLFLLVPFLLVFKISFAELKFGIPPYTSLAEFKDEAVQFSLHLRGYILLFTDSLYFATYLSSVKIAAITTLACVLIGYPIAYYIARSSPRVRNLLLLGVILPFWTSLLLRVYAWVGILRNDGLLNNFLQWLGIISSPLEIYRTDLAVYIGMVYAYLPFFILPLYATLVKMDLRLLEAAYDLGARPWQAFWQITVPLSRQGVIAGAMLVFIPAVGEYVIPEMLGGANTLMMGRVMWNEFFNNTDWPMASAVTCVMVLLLLVPLALFQYNQVKQQELANGGRK
>NZ_LN890476.1|WP_006384057.1|42658_43786_-|polyamine-ABC-transporter-ATP-binding-protein
MSDSRYSAQHAADPDEFVRVADVVKIFGDVVAVRSVNLSVKRNEIFALLGSSGSGKSTLLRMLAGFEEATSGQILLDGEDITNVPPYRRPVNMMFQSYALFPHMTVEANVAFGLKQEGVDRAEIHDRVFEALDLVQMAGYSRRKPNQLSGGQQQRVALARSLVKRPKLLLLDEPMSALDKQIRQKTQIELVKILEQVGVTCIMVTHDQEEAMTMAHRLAVMTEGQIVQCGTPQDVYAFPNSRFVASFIGSTNMFTGTIVVDEPDHVAIESPELSRPLYVSHGVSEPLGMDVHVSIRPERMVVSREQPAGEYNWAHGMVSHMAWMGSYALYQIRLDSGAMVEASVPSLQLAQLDAPGIDEEIFVSWDADSATVLAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN890476_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890476_2

2636944-2637031

Orphan

Consensus_repeat	Method
CCGGTCTGCAGGTGTCGCCCCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN890476_2

>merge|NZ_LN890476|2|2636944-2637031|CRISPRCasFinder
CCGGTCTGCAGGTGTCGCCCCCTTGAGGGGGCGCGCGCGAGCGCGTACGGGGTGGATCTCGTTCTCCGGTCTGCAGGTGTCGCCCCCT

>NZ_LN890476|2|2|2636944-2637031|CRISPRCasFinder
CCGGTCTGCAGGTGTCGCCCCCT	TGAGGGGGCGCGCGCGAGCGCGTACGGGGTGGATCTCGTTCT
CCGGTCTGCAGGTGTCGCCCCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890476.1\|WP_024070579.1\|2633142_2633439_-\|YciI-family-protein	unknown	unknown	gnl\|CDD\|183800
NZ_LN890476.1\|WP_024070575.1\|2636113_2636842_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181044
NZ_LN890476.1\|WP_006390049.1\|2642887_2643601_+\|7-cyano-7-deazaguanine-synthase-QueC	unknown	unknown	gnl\|CDD\|284031
NZ_LN890476.1\|WP_038504502.1\|2645540_2646722_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NZ_LN890476.1\|WP_020926101.1\|2635280_2636063_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|131484
NZ_LN890476.1\|WP_155867591.1\|2632307_2633087_-\|3-oxoadipate-enol-lactonase	unknown	unknown	gnl\|CDD\|131480
NZ_LN890476.1\|WP_024070581.1\|2631263_2632304_-\|cyclase-family-protein	unknown	unknown	gnl\|CDD\|377240
NZ_LN890476.1\|WP_049053005.1\|2646718_2647264_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_LN890476.1\|WP_054515747.1\|2638588_2639524_-\|3-hydroxyacyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|235707
NZ_LN890476.1\|WP_053500344.1\|2639869_2642716_-\|phosphoenolpyruvate-carboxylase	unknown	unknown	gnl\|CDD\|234570
NZ_LN890476.1\|WP_054482075.1\|2648226_2649264_-\|2-isopropylmalate-synthase	unknown	unknown	gnl\|CDD\|235154
NZ_LN890476.1\|WP_053499537.1\|2649707_2650535_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_LN890476.1\|WP_024070582.1\|2630714_2631083_+\|phosphate-starvation-inducible-protein-precursor	unknown	unknown	gnl\|CDD\|183165
NZ_LN890476.1\|WP_006390029.1\|2630000_2630336_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890476.1\|WP_024070578.1\|2634420_2635110_-\|3-oxoacid-CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|131482
NZ_LN890476.1\|WP_020926099.1\|2633779_2634424_-\|CoA-transferase-subunit-B	unknown	unknown	gnl\|CDD\|188219
NZ_LN890476.1\|WP_006390043.1\|2637065_2638406_-\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NZ_LN890476.1\|WP_049053001.1\|2643904_2645563_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_LN890476.1\|WP_054471473.1\|2647388_2648279_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176112
NZ_LN890476.1\|WP_020926098.1\|2633451_2633727_-\|muconolactone-Delta-isomerase	unknown	unknown	gnl\|CDD\|213786

Protein	Function_ID	Function_description	E-value
NZ_LN890476.1\|WP_024070579.1\|2633142_2633439_-\|YciI-family-protein	gnl\|CDD\|183800	PRK12863, PRK12863, YciI-like protein; Reviewed.	7.0573e-45
NZ_LN890476.1\|WP_024070575.1\|2636113_2636842_-\|SDR-family-oxidoreductase	gnl\|CDD\|181044	PRK07577, PRK07577, SDR family oxidoreductase.	1.12143e-68
NZ_LN890476.1\|WP_006390049.1\|2642887_2643601_+\|7-cyano-7-deazaguanine-synthase-QueC	gnl\|CDD\|284031	pfam06508, QueC, Queuosine biosynthesis protein QueC. This family of proteins participate in the biosynthesis of 7-carboxy-7-deazaguanine. They catalyze the conversion of 7-deaza-7-carboxyguanine to preQ0.	1.31463e-87
NZ_LN890476.1\|WP_038504502.1\|2645540_2646722_-\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.09979e-33
NZ_LN890476.1\|WP_020926101.1\|2635280_2636063_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|131484	TIGR02431, p-hydroxybenzoate_hydroxylase_transcriptional, beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family. Member of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU. [Regulatory functions, DNA interactions].	6.91897e-126
NZ_LN890476.1\|WP_155867591.1\|2632307_2633087_-\|3-oxoadipate-enol-lactonase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	8.6231e-106
NZ_LN890476.1\|WP_024070581.1\|2631263_2632304_-\|cyclase-family-protein	gnl\|CDD\|377240	pfam04199, Cyclase, Putative cyclase. Proteins in this family are thought to be cyclase enzymes. They are found in proteins involved in antibiotic synthesis. However they are also found in organisms that do not make antibiotics pointing to a wider role for these proteins. The proteins contain a conserved motif HXGTHXDXPXH that is likely to form part of the active site.	3.13699e-06
NZ_LN890476.1\|WP_049053005.1\|2646718_2647264_-\|N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	2.75759e-61
NZ_LN890476.1\|WP_054515747.1\|2638588_2639524_-\|3-hydroxyacyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|235707	PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydrogenase; Validated.	3.47499e-171
NZ_LN890476.1\|WP_053500344.1\|2639869_2642716_-\|phosphoenolpyruvate-carboxylase	gnl\|CDD\|234570	PRK00009, PRK00009, phosphoenolpyruvate carboxylase; Reviewed.	0
NZ_LN890476.1\|WP_054482075.1\|2648226_2649264_-\|2-isopropylmalate-synthase	gnl\|CDD\|235154	PRK03739, PRK03739, 2-isopropylmalate synthase; Validated.	0
NZ_LN890476.1\|WP_053499537.1\|2649707_2650535_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.46893e-40
NZ_LN890476.1\|WP_024070582.1\|2630714_2631083_+\|phosphate-starvation-inducible-protein-precursor	gnl\|CDD\|183165	PRK11505, PRK11505, phosphate starvation-inducible protein PsiF.	9.0957e-19
NZ_LN890476.1\|WP_054471473.1\|2647388_2648279_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176112	cd08420, PBP2_CysL_like, C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold. CysL, also known as YwfK, is a regular of sulfur metabolism in Bacillus subtilis. Sulfur is required for the synthesis of proteins and essential cofactors in all living organism. Sulfur can be assimilated either from inorganic sources (sulfate and thiosulfate), or from organic sources (sulfate esters, sulfamates, and sulfonates). CysL activates the transcription of the cysJI operon encoding sulfite reductase, which reduces sulfite to sulfide. Both cysL mutant and cysJI mutant are unable to grow using sulfate or sulfite as the sulfur source. Like other LysR-type regulators, CysL also negatively regulates its own transcription. In Escherichia coli, three LysR-type activators are involved in the regulation of sulfur metabolism: CysB, Cbl and MetR. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.51375e-51
NZ_LN890476.1\|WP_024070578.1\|2634420_2635110_-\|3-oxoacid-CoA-transferase-subunit-A	gnl\|CDD\|131482	TIGR02429, 3-oxoadipate_CoA-transferase_subunit_A, 3-oxoacid CoA-transferase, A subunit. Various members of this family are characterized as the A subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The B subunit represents a different clade in pfam01144, described by TIGR02428. The two are found in general as tandem genes and occasionally as a fusion.	1.72277e-130
NZ_LN890476.1\|WP_020926099.1\|2633779_2634424_-\|CoA-transferase-subunit-B	gnl\|CDD\|188219	TIGR02428, 3-oxoadipate_CoA-transferase_subunit_B, 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The A subunit represents a different clade in pfam01144.	1.4236e-113
NZ_LN890476.1\|WP_006390043.1\|2637065_2638406_-\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.48511e-138
NZ_LN890476.1\|WP_049053001.1\|2643904_2645563_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.74068e-61
NZ_LN890476.1\|WP_020926098.1\|2633451_2633727_-\|muconolactone-Delta-isomerase	gnl\|CDD\|213786	TIGR03221, muco_delta, muconolactone delta-isomerase. Members of this protein family are muconolactone delta-isomerase (EC 5.3.3.4), the CatC protein of the ortho cleavage pathway for metabolizing aromatic compounds by way of catechol. [Energy metabolism, Other].	6.49891e-56

>NZ_LN890476.1|WP_024070575.1|2636113_2636842_-|SDR-family-oxidoreductase
MSKPTAYLVTGGSAGIGAAIVRMLLDAGHKVVNIDYRLPEHPPAGLVSYQADLTDEARTKEVAAEVTAAYDIVGLVNNAGATRPGTADTATLADLDYVVNLHLRTALILVQAALPAMRAAGFGRIVNMSSRAALGKPDRVVYSATKAGLVGLTRTLAMELGGDGITVNAIGPGPIATDLFTKSNPAGAPQTERIINSIVVKRLGTPEDVARAAMFFLSPDNGFVTGQMLYVCGGTTLGVAPI
>NZ_LN890476.1|WP_020926101.1|2635280_2636063_+|IclR-family-transcriptional-regulator
MAEQATQQPSDSYVQSFARGLSVIRAFGPDRSQMTLSEVAAVTGLTRAGARRILLTLEHLGYVTVEDRKFALTPRILELGYAYLSGTPLWNLALPYMEEVAEQTRESCSVSVLEGADIVYILRLSTHKVMTINLAVGSRLPAWVTSMGRVLLAGLPAAELDRVLAMSQIQAYTKDTVTDIGALKAILAGVRADGYACVAQELEPGLQSVAVPIVDRSGRVIAAMNVSGHANRFSREEMLATFLPPLRHAADQINHALLRR
>NZ_LN890476.1|WP_024070578.1|2634420_2635110_-|3-oxoacid-CoA-transferase-subunit-A
MISKLVASAAAALADVPDGATVMIGGFGTAGQPMELIDALLEQGAKDLVIINNNAGNGTTGLAALLGANRVRKIICSFPRQVDSQIFDGLYRSGKIELELVPQGNLAERIRAAGAGIGAFFSPTGYGTPLADGKETREINGRQYVLEYPLHADYALIKAERGDRWGNLVYRKTARNFGPIMASAARVAVAQVREVVELGALDPETVVTPGIFVQRVVQIDAAQAAKEQQ
>NZ_LN890476.1|WP_020926099.1|2633779_2634424_-|CoA-transferase-subunit-B
MSTKLTRDQIAARVAQDIPEGAYVNLGIGLPTLVANHLPADREVILHTENGMLGMGPAPAKGEEDYDLINAGKQPVTELPGCSFFHHADSFAMMRGGHLDICVLGAFQVSQHGDLANWHTGAPDAIPAVGGAMDLAIGAKDVFVMMELQTREGQSKLVDACTYPLTGVRCVSRVYTDVAVFDIRADGVTVIDMFGETTADELLRLTGLPLKFSN
>NZ_LN890476.1|WP_020926098.1|2633451_2633727_-|muconolactone-Delta-isomerase
MLFMVQMQVNLPVDMPAAQADKLKADEKALAQQLQRDGKWKSLWRVVGRYANVSIFDVQDNDELHALLSSLPLFPYMDIQVTALARHPSAI
>NZ_LN890476.1|WP_024070579.1|2633142_2633439_-|YciI-family-protein
MPYIIETFDKPDHQAVRQQHRAAHLEYLDANKHLLLACGAKLQDDGKDLGGGLYIVDLDTREAAQQFIDADPFAQAQLFQRVTITRWRKAYVDGTCHL
>NZ_LN890476.1|WP_155867591.1|2632307_2633087_-|3-oxoadipate-enol-lactonase
MSYADLSQARLFYVIDGPADAPVLVLSNSLGTNADMWARQVPALSKHFRVLRYDTRGHGKSSIPDGEYSFAQLGNDVAELLAHLNIERAHFCGLSMGGPTGLWLALNRPELIGKLILCNTAARIGSAEGWSARIAAVAEQTLEKMAPTLVERWLTDGYRAAEPGLSQVLVDMLRRTSDAGYSGNCAALRDADFREQVSAITAPTLVISSTHDLAATPAQGQELAAAINGARYLELNTSHISNWEQPEAFTRAVVDFLTE
>NZ_LN890476.1|WP_024070581.1|2631263_2632304_-|cyclase-family-protein
MQRWTHRPEGSNWGDFGPDDQLGRLNLITEEQVLKGAREIRAGKTFCLSLPLDLPGGNVLNPRRHPPQLSPTRLADTPYLNFPLRNVNPDAVDVLSDDQVLLSMQYSTQWDALAHVGALFDADGDGQPELRYYNGFQAGVDVIGPADGDHTGCGCNSGGPSAALKLGVENLAQKGMQGRGVLLDLARHYGPGRTLVGHAEIMHVLKTDGIEIEPGDMLVLRTGYAEAVVAMAGKPDAEVLHTYGAALDGTDAALLQWITDSGIAAICADNYAVEAYPAREKTGPRAMLPLHHHCLFKLGLPLAELWYLKDLADWLRANGRHRFMLTAPPLRLPHAIGSPVTPIATV
>NZ_LN890476.1|WP_024070582.1|2630714_2631083_+|phosphate-starvation-inducible-protein-precursor
MLSRTSQLASAIVLSACFLGAVHAQTPAATPAPAKTPAPAATPAKTPTAQQQRMADCNKSAEGKKGDDRKTYMSACLKGEAPPPAKQLTPQQQKMKDCNAKAGEQKLTGDKRKTFMSTCLKG
>NZ_LN890476.1|WP_006390029.1|2630000_2630336_-|hypothetical-protein
MKTVLASLALLAGLTGAAHAQNLYGVTLGNIQAIRDANENVSTITGSLANQSARAVNYVMLTFVLYDEQGREIGRVRDDDIGPLAPGQIKMIRAITPLQFAKVTALDIRAR
>NZ_LN890476.1|WP_006390043.1|2637065_2638406_-|short-chain-fatty-acid-transporter
MNKLASFFTELMRKYLPDPFVFAIALTLLTVLLAMGIEGQGIGDVTRAWGKGFWSLLAFTTQMAVILAMGYVLATAPLTDRLLNRIVSHVHKPHTAIIVATLVGGIGSYLNWGFGLVIGGIVAKKLALKVKGVHYPLIIAAAYSGFTMYGLGLSASIPVLVATPGHPTAKQMGIIPLTETIFSVPMLITSLVIIVTLPLLNAWLHPKKGEKIVEVDPAIDRDANASNAAEDMLEKGTLASKLNNSRILSLLIGALGVAYVAFHFIDGGSLDLNLINFIILFLGIILLGTPAAYVAKLTEGIKTISGIILQYPFYAGIMAIMAASGLVTTISKVFVDVATPATLPFWGLISSFVINFFAPSAGGHWVIQGPFMIDAAREIGSALNQTTMAVMLGNAWNDLVQPFWILPALALSKLKLRDVMGYTVIMMLWVGVIHITAVLAWGYLTH
>NZ_LN890476.1|WP_054515747.1|2638588_2639524_-|3-hydroxyacyl-CoA-dehydrogenase-family-protein
MDTPLQNLAVIGAGAMGSGIAALFASKGLDVVLVDPMDGALDRARAVIERQLNVYAPGQVDAVMQRIRMAPGLDAAADCDLVIEAVPENLELKRGLFAQLDALCKPAAIFATNTSGLSINAIASAVARRDRFVGTHFFTPADVIPLVEVVRNDATSEDTVARVMATLRLGGKRPVLVRQDIPGFIANRIQHALAREAISLLEKGVASAEDIDEVVKWSLGIRLALSGPLEQRDMNGIDVHYAIASYLYKDLENRTEPSELLKSKVENGQLGAKSGQGFYTWSAERRERVLRDKSAALGELAAWLNAKAGDS
>NZ_LN890476.1|WP_053500344.1|2639869_2642716_-|phosphoenolpyruvate-carboxylase
MNASRPQSDSAEPLRHDIRLLGRLLGEVIAECEGKRVFDTIETLRRTAVKFRREGNAADGKLLEQRVKHLQGSDPNSVARAFSYFLHLSNIAEDRDQNRSQRARALAGDAPARGSLHDAVQTLGRQGVTPARIRRLLAEACVMPVLTAHPTEVQRKSTLDVHREIAAALTQRDQPLTPEELAELDAALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRVYGDLSKLLNRDAKPFGAPPAPLEPFLRMGSWIGGDRDGNPNVDADTLERALLRQATVLFEHYLQEVHALGAELSITTLLIAVDPALLALAEHSGDDSPHRSDEPYRRALVGVYARLAATALRLTGQNLARRSTVAAQPYDTPQELSADLAVIAASLAAHHGAPIGRLRLAGLQQAVEVFGFHLATVDLRQSSDVHERALAELFSRAGVTHAGQPLDYLALDEDARVALLRAELAQARPLASPWIAYSEDTTRELAVLRAAAAGRQRYGRQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQDIPPEDGLMVVPLFETIPDLQRGADIMAAWLDLPEIRERVKRAQNGAQEVMLGYSDSNKDGGFLTSNWSLYQAERALVDVFSSRHVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTEQGEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAEATSAEDAHMAHHGPAMSFMSEAAQRSYRGLVYDTPRFAEYFFAATPIAEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCRLMLTGWYGMGSAIEAYLETGAPGAPRSQRGRLAQLREMARDWPAFRTLLSNMEMVLAKSDLAIAARYAQLVPQRALREKIFGMISAEHARTLAMLKLLTRRELLADNPALQASLRERFAYIDPLNYLQVDLIRRHRAAQKSPAAEADERVQRAIHLTINGIAAGLRNSG
>NZ_LN890476.1|WP_006390049.1|2642887_2643601_+|7-cyano-7-deazaguanine-synthase-QueC
MLNHQRRALVLFSGGQDSTTCLAWALDRYAHVETVAFDYGQRHRIELDARLNVLRDIRARFPQWAPRLGEDHLLDLKVLGQVGDTAMTSDRAIEMQANGLPNTFVPGRNLLFLTLAAALGYRRQLDVLVGGMCETDFSGYPDCRDDTIKAQQVALGLGLGSRVTIETPLMWIDKSETWALARSLGGDALVETIVEESHTCYLGERGARHAWGYGCGECPACKLRRAGWDKWQAQGGA
>NZ_LN890476.1|WP_049053001.1|2643904_2645563_+|EAL-domain-containing-protein
MESGFTQGSIIMNRSRIILIFDNEFAKQGISDSLEQIGFVLNPVSLQEPAPACQAGEIQVHLCLPRDLDITIGQLRARFAHSTIIAIRHIESPAVRINALLAGADSCYGANISYSEVAAAIQSAQRKLTLCQPPAAVAPRRPDAPPDPAAAEKSWRLCDNEWTLVSPAGPGVSLTPMERAVLKGMHAHAERLIRRADFAVASLDIPGNGRALDLVISRLKRKGAAAGLSIPIRSLRGKGYSFSAALAQDSAAGDGREPAAPRKEGGPVSPLLAAIQGDRLQFHYQPIVAASDLEIVGAEALLRWRAAGGETLGIDGLLREAGAPEVAQALISWGIRTIASDQARWRQAARGCGPAVNINISPQSFARRDVVGVILRDIAVCGLAPRDIRIELTEEAALHAASADIRCMLEEFTSRGIQVWLDDFGKGYNNLEWLSTLPLAGLKLDKSIVWSAARQADAQKVLASICQLARDLDIVTVAEGVETEAHCRAAREAGCDLLQGFLFFRPGTADELATALNAQCQRRDDVAWARDRGAPATAVCDGGAPFSPVPGQ
>NZ_LN890476.1|WP_038504502.1|2645540_2646722_-|MFS-transporter
MIAARAVVCLGLTQLVGWGVTFYLIGALGPDMAADLGWNPATIYGGFSCAIVVMALVSPLAGRAVDRWGGHRIMPTGAVVAAAGCILLAAAHGPVAYFAAWTLLGLGMRLCLYDAAFASLARAAGPAARRPMSQITLFGGLASTVMWPVGHALSDWLGWRGAVLAYAALALATLPLYLALPRTRYAAPAQAPGQGGAGLARNARERRLAGALYATIAMLTNFLAAGNAAHLIPLLSGLGLAKALAVNVAALWGIGQFASRLADVALGSRLHPLTLTLAVAALLPLGFMLALFSGGHLAALAAYASLYGACNGLLTITRGTLPLALFDFRSYGAVTGALLMPSFLLTAAAPVAYAYVVQRHGAHAAMGMSAGVAGAILAAALALRWRFIARARG
>NZ_LN890476.1|WP_049053005.1|2646718_2647264_-|N-acetyltransferase
MPPSAAPILIRDSVDADLPAIKSIYAHHVQHGTASFELDPPSIQEMRQRRAGVLEKDMPYLVAEIDGEVVGYAYVTPYRPRPAYRHTVEDSVYVKAGRAGQGIGGRLLATLVERCTAAGWRQMLAVVGDSRNAASLAVHARQGFHPVGTLRSVGHKHGEWRDTVLMQRALGEGDGTPPQRP
>NZ_LN890476.1|WP_054471473.1|2647388_2648279_+|LysR-family-transcriptional-regulator
MRGLNLDALRTFAQVIELGSFSAAAERGGITQPAVSLQVRQLERRFGLKLVERVGRRAGPTAAGLELLNHIRAIDAALAQAEQAMTAHASQVTGRVRLGTGATACTYLLPPLLADLRRRFPALDVVASTGNTADMLRGLENNTLDIGLVTLPAPGRMIEATPVLEDEFVAIFPARGPLAIPDAVTPQALAALPLVLFEPGARTRRLVDDWFEEAGVAVKPVMELGSTEAMKEIVAAGLACAVLPRMAVSGAGQRGSLALRSLAPRLARTLAVVVRRDKPLSRGLRHLQEALLALRT
>NZ_LN890476.1|WP_054482075.1|2648226_2649264_-|2-isopropylmalate-synthase
MLDHPQHKYRPVQPFSRDYAERQWPTRRPSAPPIWMSTDMRDGNQALIEPMDAARKLRFFEQLVAVGLKEIEVAFPSASDTDFNFVRKLIEESRIPSDVTIEVLTQSRPDLIARTFESLRGAPRAIVHLYNPIAPQWRRIVFGMSRAEIKEIALAGTRQIRALADAHPETEWIYEYSPETFSLAELDFALEVCDAVSAIWRPTPARKMIINLPSTVECTTANVYADQIEWMHRRLARRDSIVLSVHPHNDRGTAVASAELAVLAGADRVEGCLFGNGERTGNVDLVTLALNLDQQGIASGLDFSDMAAVRDCVQACNQLPVDVFHPYAFTSAAPAMPPAGAAARG
>NZ_LN890476.1|WP_053499537.1|2649707_2650535_+|helix-turn-helix-transcriptional-regulator
MDKPKPPSRLAGSRKPADLDLFPYESSLRPVAALAVDYEDGHRVGRHRHRRSQLVYAISGVMVVDTDAGIWVVPPTRGVWVPAWVSHSIRMSGEPRMRTVFVEPGAASHLPTECCVLSISPLLRELMVAAAEVPLDWKPGTRDGRLMLLLLDELKQEPVLPLHLPQPSEPRLARICRAIVRHPERQAGAADWARELGVDPKTVHRLFLRHTGMTFGRWRQQARLLAAMERLARGERVLDVALDLGYESPSAFAAMFRKALGEPPSAFAARGAASA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN890476_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890476_3

6210626-6210728

Orphan

Consensus_repeat	Method
TTTTCATCGCCGAGCCGCCTCAAGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN890476_3

>merge|NZ_LN890476|3|6210626-6210728|CRISPRCasFinder
TTTTCATCGCCGAGCCGCCTCAAGATGAAAAATGCCCCCTCGGGGGGCAGCAAGCCGAAGGCGCGGCGTGGGGGCCCTTTTCATCGCCGAGCCGCCTCAAGAT

>NZ_LN890476|3|3|6210626-6210728|CRISPRCasFinder
TTTTCATCGCCGAGCCGCCTCAAGAT	GAAAAATGCCCCCTCGGGGGGCAGCAAGCCGAAGGCGCGGCGTGGGGGCCC
TTTTCATCGCCGAGCCGCCTCAAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890476.1\|WP_006387133.1\|6219737_6220940_+\|DUF2863-family-protein	unknown	unknown	gnl\|CDD\|371362
NZ_LN890476.1\|WP_024069793.1\|6210745_6211708_-\|DUF4892-domain-containing-protein	unknown	unknown	gnl\|CDD\|143586
NZ_LN890476.1\|WP_020928792.1\|6215483_6217013_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_LN890476.1\|WP_054445686.1\|6205629_6206517_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187627
NZ_LN890476.1\|WP_155869332.1\|6197754_6198522_+\|3-oxoacyl-ACP-reductase-FabG	unknown	unknown	gnl\|CDD\|235546
NZ_LN890476.1\|WP_020928784.1\|6206635_6207565_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_LN890476.1\|WP_054482989.1\|6214401_6215484_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|185090
NZ_LN890476.1\|WP_026383333.1\|6201069_6202044_-\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NZ_LN890476.1\|WP_155869329.1\|6196762_6197758_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176180
NZ_LN890476.1\|WP_024069797.1\|6217048_6217753_+\|siderophore-interacting-protein	unknown	unknown	gnl\|CDD\|99790
NZ_LN890476.1\|WP_006387147.1\|6198583_6200785_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_LN890476.1\|WP_155869939.1\|6204121_6205561_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236215
NZ_LN890476.1\|WP_173361869.1\|6212851_6214351_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_LN890476.1\|WP_006384576.1\|6217788_6218679_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_LN890476.1\|WP_020928781.1\|6203080_6204064_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_LN890476.1\|WP_155869345.1\|6220949_6222065_+\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	unknown	unknown	gnl\|CDD\|378385
NZ_LN890476.1\|WP_035182867.1\|6211860_6212754_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176149
NZ_LN890476.1\|WP_155869335.1\|6202161_6203070_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|184959
NZ_LN890476.1\|WP_024069798.1\|6218719_6219493_-\|dioxygenase	unknown	unknown	gnl\|CDD\|153375
NZ_LN890476.1\|WP_020928786.1\|6207869_6210575_+\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445

Protein	Function_ID	Function_description	E-value
NZ_LN890476.1\|WP_006387133.1\|6219737_6220940_+\|DUF2863-family-protein	gnl\|CDD\|371362	pfam11062, DUF2863, Protein of unknown function (DUF2863). This bacterial family of proteins have no known function.	0
NZ_LN890476.1\|WP_024069793.1\|6210745_6211708_-\|DUF4892-domain-containing-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	3.6355e-40
NZ_LN890476.1\|WP_020928792.1\|6215483_6217013_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.39588e-126
NZ_LN890476.1\|WP_054445686.1\|6205629_6206517_-\|SDR-family-oxidoreductase	gnl\|CDD\|187627	cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR. TTER is a peroxisomal protein with a proposed role in fatty acid elongation. Fatty acid synthesis is known to occur in the both endoplasmic reticulum and mitochondria; peroxisomal TER has been proposed as an additional fatty acid elongation system, it reduces the double bond at C-2 as the last step of elongation. This system resembles the mitochondrial system in that acetyl-CoA is used as a carbon donor. TER may also function in phytol metabolism, reducting phytenoyl-CoA to phytanoyl-CoA in peroxisomes. DECR processes double bonds in fatty acids to increase their utility in fatty acid metabolism; it reduces 2,4-dienoyl-CoA to an enoyl-CoA. DECR is active in mitochondria and peroxisomes. This subgroup has the Gly-rich NAD-binding motif of the classical SDR family, but does not display strong identity to the canonical active site tetrad, and lacks the characteristic Tyr at the usual position. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	4.78824e-110
NZ_LN890476.1\|WP_155869332.1\|6197754_6198522_+\|3-oxoacyl-ACP-reductase-FabG	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	1.86752e-89
NZ_LN890476.1\|WP_020928784.1\|6206635_6207565_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.04852e-56
NZ_LN890476.1\|WP_054482989.1\|6214401_6215484_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|185090	PRK15136, PRK15136, multidrug efflux MFS transporter periplasmic adaptor subunit EmrA.	2.24506e-103
NZ_LN890476.1\|WP_026383333.1\|6201069_6202044_-\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	1.48298e-36
NZ_LN890476.1\|WP_155869329.1\|6196762_6197758_+\|zinc-binding-dehydrogenase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_LN890476.1\|WP_024069797.1\|6217048_6217753_+\|siderophore-interacting-protein	gnl\|CDD\|99790	cd06193, siderophore_interacting, Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one-electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and two electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).	7.80577e-39
NZ_LN890476.1\|WP_006387147.1\|6198583_6200785_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	3.73232e-108
NZ_LN890476.1\|WP_155869939.1\|6204121_6205561_-\|AMP-binding-protein	gnl\|CDD\|236215	PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_LN890476.1\|WP_173361869.1\|6212851_6214351_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	3.19804e-66
NZ_LN890476.1\|WP_006384576.1\|6217788_6218679_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.94943e-47
NZ_LN890476.1\|WP_020928781.1\|6203080_6204064_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.22068e-127
NZ_LN890476.1\|WP_155869345.1\|6220949_6222065_+\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	gnl\|CDD\|378385	pfam10093, EarP, Elongation-Factor P (EF-P) rhamnosyltransferase EarP. This entry includes family members such as EarP enzymes which are essential for post-translational activation of elongation factor P(EF-P). It was identified as EF-P arginine R32 specific rhamnosyl transferase in Shewanella oneidensis using dTDP-beta-L-rhamnose as donor substrate. This was further confirmed for Pseudomonas aeruginosa, Pseudomonas putida, and Neisseria meningitidis. As for S. oneidensis and P. aeruginosa, EarP enzyme acts as an inverting glycosyltransferase, thus mediating the formation of an alpha-L-rhamnosidic linkage. Structural analysis show that EarP is composed of two opposing domains with Rossmann folds, thus constituting a B pattern-type glycosyltransferase (GT-B) and provide basis for arginine glycosylation by EarP. Mutational analysis of efp and earP genes, resulted in a substantial decrease in the production of rhamnolipids and pyocyanin (important factors for colonization and invasion during infection) of P. aeruginosa. Collectively this indicates that EarP and EF-P are essential for P. aeruginosa pathogenicity.The protein family is also annotated in the CaZy Database as GT104.	1.15892e-174
NZ_LN890476.1\|WP_035182867.1\|6211860_6212754_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176149	cd08460, PBP2_DntR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.41728e-69
NZ_LN890476.1\|WP_155869335.1\|6202161_6203070_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|184959	PRK14997, PRK14997, LysR family transcriptional regulator; Provisional.	2.50171e-63
NZ_LN890476.1\|WP_024069798.1\|6218719_6219493_-\|dioxygenase	gnl\|CDD\|153375	cd07363, 45_DOPA_Dioxygenase, The Class III extradiol dioxygenase, 4,5-DOPA Dioxygenase, catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine. This subfamily is composed of plant 4,5-DOPA Dioxygenase, the uncharacterized Escherichia coli protein Jw3007, and similar proteins. 4,5-DOPA Dioxygenase catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine (4,5-DOPA). The reaction results in the opening of the cyclic ring between carbons 4 and 5 and producing an unstable seco-DOPA that rearranges to betalamic acid. 4,5-DOPA Dioxygenase is a key enzyme in the biosynthetic pathway of the plant pigment betalain. Homologs of DODA are present not only in betalain-producing plants but also in bacteria and archaea. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.	1.79369e-120
NZ_LN890476.1\|WP_020928786.1\|6207869_6210575_+\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0

>NZ_LN890476.1|WP_020928786.1|6207869_6210575_+|aconitate-hydratase-AcnA
MPHNTLDTLKNFKIGNKSCQYYSLPALGKALGIDVQRLPVSIRIVLESVLRNCDGKKVTEEHVRQLANWQANAKREDEIPFVVARVVLQDFTGVPLLADIAAMRSVADKMGKSPKSIEPLVPVDLVVDHSVMIDYFGTKNALDLNMKLEFKRNQERYQFMKWGMQAFDTFGVVPPGFGIVHQVNLEYLARGVHQDKKNNVYYPDSLVGTDSHTTMINGIGVVGWGVGGIEAEAGMLGQPVYFLTPDVVGVELKGKLRGGVTATDLVLTITEMLRREKVVGKFVEFCGEGTASLSVAERATIGNMAPEYGATMGFFPVDGRTIDYFRGTGRTEDEIAAFEAYFKAQDMFGVPAAQDINYTKLLTLDLSTVAPSLAGPKRPQDRIEIGNVKSTFIDLFSKPVAENGFNQPAEKLQQTFTTSTGTKVKNGDILIAAITSCTNTSNPSVLLAAGLLAKKAVEAGLKVPKHIKTSLAPGSRVVTEYLTKTGLLPYLEKLGFDVAAYGCTTCIGNAGDLTPDLNEVITSNDLVCSAVLSGNRNFEARIHPNIKANFLASPPLVVAYALAGTVTRDLMTEPVGRGKNGDIWLGDIWPTTEEVEALLKYALDPKAFEANYGQVKSNPGKLWENIKGVTGETYNWPDSTYIAEPPFFEGFGMTPGAMPTVKNARALGVFGDSVTTDHISPAGSIKETSPAGKWLKENGVMKADFNSYGSRRGNHEIMMRGTFANVRIKNLMIPARPDGSRFEGGETLFQPTGEQMSIYDAAMKYVAAGTPTVVFGGEEYGTGSSRDWAAKGTQLLGVKAVITRSFERIHRSNLVGMGVLPLQFKGSDSVQSLGITGEETYDISGLENGIKPMQDVTLTITRKDGSKQDVTLLLRIDTPIEVDYYQHGGILPFVLRQLLAA
>NZ_LN890476.1|WP_020928784.1|6206635_6207565_+|LysR-family-transcriptional-regulator
MTTPPALDLNLIQLFVTIVEAGTLSEAALRQGVTRSHVSRNLQKLERAFGAQLIRRTTRRLELTHEGSVLYDHGARMAREVESARHALQKLGAEPTGHVRLSLPTGLGELDMLRPLLVRFALEHPSLSLRVLFSNRVSDLISSEIDVALRAISVPPQDYVARELGRIKWHLCAAPEYLARMGMPAHPRDLGRFDFLGPPGPRPQATLRLRGKGQPHEVKLATRLQSEYFPFLAQAAREGAGVALLPAYIVRPDLEAGRLLQVLPAYQAEGPGDKLYILTSPTPYPSSAQRALVDFLKRELEPLLRTFLA
>NZ_LN890476.1|WP_054445686.1|6205629_6206517_-|SDR-family-oxidoreductase
MFRADLFQGQRILITGGGTGLGYAMARQLAALGATVHLCGRRLAVLEQAAQALRGEAGGQVHVHPVDIRDAGAVDAMVARIWDQHGGLDALVNNAAGNFISPTEKLSERGFNAIADTVFRGTFYMTQAVGKRWIGSGASGAVVSIVVTWVWTGSPFVVPSAMSKAGIDAMTKSLAVEWGRRGIRLNAIAPGVIPTEGASARLRPNDSGTDALVKQNPMQRLGQGQDIGELAAFLLAPGNDWINGQTIALDGGDYLANGAYFKQYFDWSDDDWAAARAAIEARTAADKAQRSAGQA
>NZ_LN890476.1|WP_155869939.1|6204121_6205561_-|AMP-binding-protein
MRRGEQVAAGLAAMGIGQGDVVAVLLRNGMPYLEIIQACKRLGCYYCPINWHYTPDEVAYLVRDSGARLLIAEEDLWQAARAALPADLPSRRVGAAAVSEDYASWREAQAPYDGPVVAPRGHMAYTSGTTGRPKGVVRAPFPLDQLAQRLAAVEAVVEQAYGLRPGCRALLPAPVYHSAPSVFAQVALRVCETLVLAPRFDPLEVLRLIERHRIDTVYLVPIMYVRLLKLDPAQRAAFDLSSLRFVASTGAPCAPALKRAMIDWLGPVIHETYASSEAGMVTVIDSHEALARPGSAGRPIGGAQIRIYGDDGALCAPGQIGRIHVRQPAYADFTYRNNPQARSRIERDGLIGLGDLGYLDDDGYLFVCDRESDMVISGGVNIYPAEIEHHLTQYPGVADCAVFGVPDDEFGERLLALVQPAADTALAPEEVLRWLSTRVARYKVPRELRLRQTLPRDDNGKIAKRRLRDAFWAERDRKV
>NZ_LN890476.1|WP_020928781.1|6203080_6204064_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MFMRNFGIGRAAAALLLCMAAASPAQAAFPERPVKLVVPYTPGGAADLLSRVLAERLSQELAQPVVVENKPGANTMIAATQVARAQPDGYTLFLASNASMVLNPMLYRKISYDAQRDFRVLSVVAELPLVVVANNSVPASTLAQFVDYARARPGKLNYASVGIGNPLQLATELLKSRTGIDVAHVPYNGSAPALSSLMANDTQLMVDVISTSLPLVRENKIKALAVTGAQRLPVLPDVPTVAESGFAGFRAATWFGVAVPRGTPPAEADRLREAVAAVMRQADFRDRFQAQGLVIQAPRGQAEVDAYLAEDRERWNGVIQANHIRLD
>NZ_LN890476.1|WP_155869335.1|6202161_6203070_+|LysR-family-transcriptional-regulator
MHSYIHHLDDLLLFTEVVEKGGFSAAARVLNMQRSKLSRRVAELEARLGLRLLQRNTRRVSLTPMGEQIYVHALAMAREARSAFDLAAAMGDTPSGLLRMTAPSALAVTLLGELVARFCLQHPGVRVLLDTRDQVIDLVGEGYDLAFRAQGASLTDSRLVARELAPVPLILVAAPAMALAAPRHPRDLNALPLLAHATQDSPQSWHFVGPAGEAESIEFRPRCLSSNLAALREMARAGLGVALLPHYLCAGSLAKGDLAQLLPAWRAAPARIYAVMPARRGAPLALRRFLDFAAAEMPALLA
>NZ_LN890476.1|WP_026383333.1|6201069_6202044_-|pirin-family-protein
MTIRLSPPVARPFEPEGDICSYRHFRHSDFPQGMSPLVLVDHFIMTGPAVAPHPHAGISTVTLLLEDTQGGLRIRDSLDNEHEARAGDLHWTVAGRGIVHGHELVGAARLNGLRLYVNLPARLKSMPPSATLVRGWEMPVLQSDAGRVRVVSGRYDGWDAPLATPEPLLILDGWLRPGASRLVPLPAGWNAWLYAAQGELGVRARHETTPPPRPPVEAAPVIPAARFRPAGRAATTGRRAADPDFAVLPPGAALTATADRDGFLQLLAAGAPAHFILVAGAAIDEPVIQRGPFVMTDARALAQAVAAYEAGDFGQLRQESGVPG
>NZ_LN890476.1|WP_006387147.1|6198583_6200785_-|TonB-dependent-receptor
MKIRTLACVVAALPYTAIVHAQSAAPAADGSVVSMEAIKVEASADASAGGLAQPYAGGQVARGGRVGVLGTQDIMSTPFSVTSYTNELIQDKQARSVGDVLQNDAGVRVARGFGNFQESYFIRGFILSSDDVAYNGLYSLLPRQYIATELFERVEVLRGASAFLTGAAPSGGGIGGVINLVPKRAPNEPLTRFTTGVSSGGQFSVSTDIARRFGPDDSTGIRLNVANRSGDTGIDDEHSRTSLVSLGLDWRSADTRLSADIGWQENKLKRARPNVTLRGVTSVPDAPDASSNYAQPWSYSNERDVFGTVRAEHDFSDKLTGWAAFGMRRSDEANSLGNVTVTNGSTGDGNFYRFDNTREDSVNTGELGLRAKVRTGPVGHEFVASASFFDLKKKNAYVMDYLNTFPTNIYDPVSYDRPAYGSKALFGNDLDDPALQGRTRLSSYAFGDTMSFLDDKVLLTLGIRHQRLSQRDYAYNTGKEQSAYDASRNSPAAGIVFKVAPSVSLYANYIEALVAGDTAPQTANGKPVPNAGQSLQPYVSKQKEIGVKYDGGGLGAGLALFSTDKPRAAYNASNAFTASGKDRHQGIELTVFGEPVNRVRVLGGMTFLDAKQRSTGNSAIDGNRVIGVPRFQANLGAEWDIPGVQGLTVDGRVVYTGASYADDANTLKVPGWTRFDAGLRYMMDVDGHVVTLRARVENIANRNYWSSVGGYPGNGYLVLGGPRTFSLSASMDF
>NZ_LN890476.1|WP_155869332.1|6197754_6198522_+|3-oxoacyl-ACP-reductase-FabG
MSARFQDQVIIVTGAVGGIGSAIVEGFLAEGGKVGLIDFNSQGGQAYEKELKKRGHAVSFVHADVSHFDQCQAAYERITRDLGPATILVNNVGISPKTDGRALKVWEMTPGEWDKVVAVNLNSVFYMTHLATPHMVRQRQGRVINMSSVAGKAYCDIVAAHYAATKAALLGLTRHWAAELGEHDVTVNGLAPGRISTPLLKSVPKEINDAVAEVTALRRLGTPGEVADACLFFASDQARFVTGQVLDVAGGWLMT
>NZ_LN890476.1|WP_155869329.1|6196762_6197758_+|zinc-binding-dehydrogenase
MSLRCTFIDHGTGGAPDCLRLAEREMAAPAGRQVLIEVAYAGVNRPDVLQRSGSYPPPPGASPYLGLEVAGTVVAVGPEATRWQVGDQVCALTPGGGYAQYCLADERHCLPVPRGLDLLSAAAIPENYFTVWTNVFERARLAAGEKFLVHGGSSGIGLTAIQLARAFGAEVWTTVGNQEKAEACLKAGAHHAVLYRDTDFEADIRQATGGQGVDVILDMVGGAYINKNIRLLAVNGRLVQIAFLDGSKAEIDALPIMTKRLSFTGSTLRPRSDEDKGAIARALADKVLPLMEQGRCLPLIHQVFPLEQAAQAHALMESSKHIGKIMLKVRA
>NZ_LN890476.1|WP_024069793.1|6210745_6211708_-|DUF4892-domain-containing-protein
MKAHIVKVASLAIVAATLTASPAWAEDVEGSRDHPALTRFEGAEIRAYEHKDYDEALMPDRPVARESEAKGLTLEGKLTRIAYRIDGKKSALEVYRNYQGALQAGGFKTVFECKGDEQCGGDFQSFVLNSGKVSQPGQGDAAFGGKYYVVLAKKEAPTGDIYVFLDVMEDSSNNITPVFQQVIETKPMQTGQVKVLDMAAMQKSLAESGRVAVYGVYFDTDKAEVKAESKAALDEMGKLLNANPKLKVYVVGHTDNQGTLAGNLELSQKRADAVVKALEAGYKIPAARLSARGVASLAPVAANDAEAGRAKNRRVELVAQ
>NZ_LN890476.1|WP_035182867.1|6211860_6212754_-|LysR-family-transcriptional-regulator
MDLNLLVALDALLAEGSVTGAAERLQLSVPAMSRTLERIRRMMGDPLFVRAGRGLVPTPRAEALREPVRALVAQARELLAQDAAFDLKTLRRVFTIRADDGAVSTLGPALLDTLAKEAPRVTVRFISQGKQDVLSLREGAIDLDIGVIEDMGPEIVRQRLFPDRFVAVFRPANPLARHRKLTPERFARARHATVSRRGVLSGPVDIELGKVGLARHISAVTHSFAEALAITRKSDLVATVPDLLTLHLRDDLQMRALPFDTPAVTISQAWHPRFNEDPAHRAIRQMVHRISLAISGR
>NZ_LN890476.1|WP_173361869.1|6212851_6214351_+|efflux-transporter-outer-membrane-subunit
MIHSTRYRPDARPARRMRLRHAPLAAALAALVAVAGCASHDGLRPAGKPLDLAALDAGQDIAAAVRDTADDAAPWWRAWGDDQLDRLMADALRQAPGVRAAQARLGQAEAVFGSVDAKRQPTLDGSATITADRYPGHYTYGAPYADNTGGSGSLLASLRLRLDIWGKWRALADAARLDAEGAALAHADAQLALQQGIAAAYLRLDAAFRLHELARQQRERQRQALELHQTRRQAGLGSDAPVADARGRLARMDAEVERLDREIARQRHALAALAGQAPGYGDALRRPRLALRADPALPAALPARLLGLRPDVLAQRKRLDAADRRIEAAKAEFYPDIDLKAFAGLQSLGLSHLLQGNSLAAGIGPALTLPIFDGGRLRAGLRDRIAGYDLAVADYDATVVRALQEVADGLAGMAQARARRDAARVSLREAGTLARLQAVRASRGLSARQDEIDTDLERLRADSELAAADLDLGLARTALAGALGGRWSPSQSSDNEALK
>NZ_LN890476.1|WP_054482989.1|6214401_6215484_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MLAGGATLLAGAGWAAWTFLAGAATQTTDNAYVNGHVVAITPQVGGAVSAIWADNADRISAGQTLVEVDPADTQIALAGARADLARARRRVQALFASRDQAGAEVARRQAELDRAQADVSARRGIAAQGAITSEEARHAADALNAARAALAVAQAAERAAQAQVDGVTPDTHPDVTLAQARLRAAALDAQRTTIRAPVGGMVAQRSVQLGKHVAIGDKLMAVVPLDQMWIDANFKEIQLAGICPGQPAVVTVDAHGAKVRYRGRVGDVMAGSGSAFALLPSQNATGNWIKVVQRVPVRINLDPKELADHPLRIGLSAEVTVDTARCDPAQAGAARGETTDIYRQQRQAADTLAQAGQGLQ
>NZ_LN890476.1|WP_020928792.1|6215483_6217013_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MSAAPRPIEPMTGLPRVVAAVAISLASFMAVVDITIANVSVPTISGNLGVSPEIGEWAITFFAIANSICIPLTGWLSRRLGQVRLFVLSVAAFTLASVLCGVAQNFESLLAFRVLQGMVSGPIVPLSQALLVAIFPPDKRTLALSMWAMTNMAGPVAGPVLGGWLTDDFSWPWIFLVNAPVGIAVVAVTATMFRGRDTPSTRLPVDLRGLILLAVAIGCLQLTLDRGRTLDWFASPFIVTTALLSALGFVFLVIWELGEAHPIVDLSLFRHRNFAMGTLAVAVGFGLYFAALVLIPLWLQTDMRYTATWAGLATAPMGVFGILLAPLLGRWVQRGDARVFASLAFVAWSLVAWWRASMTTDVGVGLISLACLLQGIGIGLFLTPLVSLSLAGLPPERIAAASGLQTAIRMMAGSLVASLASTYWDERSRYYQNVLVDSATPARPAVQDTLNALAGAGLDEPQSWGVIWNGLKTQADMLALNDFFLWSSLAFALSIALVWLARHPRAAKA
>NZ_LN890476.1|WP_024069797.1|6217048_6217753_+|siderophore-interacting-protein
MQPFSLPRRDVPCIVLRARDVARDMRRLTLGGPELSAWLARPGVDQPGAWVKVFPPGVPGRAYTLRGIDFEASSVEIDFVVHGDAPGTVSEWARRARPGDAVSIAGPRDGGFSLLADTRWVWLGADASAWPAASRIIESLPGGIQVLGVRHPAGDDDWPAIASARAPQWAARSLPPGGDEPSAPAPDGPGQVWLAGQAAWVKAWRAHWLQRLRFDPARLSAKGYWKAGEQDYKE
>NZ_LN890476.1|WP_006384576.1|6217788_6218679_+|LysR-family-transcriptional-regulator
MKKELDRMRDMALFVQVAALGSLTRAAESTGVPASTLSRRISEFESQIGVKLLHRSTRRLALTDIGQRYLERITDVVDRARAISGELEEEMGRPTGHLRVCAPVDFNAYFPEAALADYCASHPGVRFELHCSAQLPDLATEPYDICIATTEPPQASRMVRRRIGMAEYQLYAAPAYLRAYGVPAHPAELARHRCVVMPDSESGLALTDGNASAQVALAPLLVLNNQLAVENLLRDGLGIGPLTRGRADALVREGALAPVLPGWTLPPRPILALTASRALPARVRGFIDLLVARVVT
>NZ_LN890476.1|WP_024069798.1|6218719_6219493_-|dioxygenase
MRWPTLFVSHGSPMLAVEPGATGPALAAWSRSLGRKPGAILVVSPHWMGHGLALSTRDRQVAWHDFGGFPPELYTLQYAAPGSPELAARVQALLAEGGIAADRDPRRPLDHGAWVPLRYLYPEVDVPVVQLSLDMGRDAAGQLELGRALAPLRDEDVLIIGSGSLTHNLRDVRMPQDAPPAPYVPAFQAWYADRLAAHDVPALLDWQARAPGAAQAHPHDDHLMPLYVALGAGGARATRLTDEISYGALAMDAYAFD
>NZ_LN890476.1|WP_006387133.1|6219737_6220940_+|DUF2863-family-protein
MARSRSQSAPRLTRDATRLITLAQSLNRSGSRVEDVYWENQLGEAIPKLLKAGQDAPLEAALDHLAQGDVGAYEVLIEQAETLSESMKIDKNGVRYDILLIVAPVVAWTRYAIPTGPVPASAQQALLAQLHGHVLSSQARSALMPHLVSVDQMPRTFSETWQWLQRLGSQALGAETTKPALNTEVETANMLADTRYIVAAVAVPEFAPVFRWQEQIGEADASRDACLAQWAAQAQPTLAGLLPGCGFEALLPDAYYVSNREADRRVRPLSLRAAISWLEGAVSLDASQLRAVIAGCGESRVDEYRVSFTARNSNDVYYGCVWPLYGREEDLPADEGQPDVVDEIAALLKEYGVSDVRRIPGVLPPEYCEDCGAPYFPNPLGELVHAELPEDAEAAPAKFH
>NZ_LN890476.1|WP_155869345.1|6220949_6222065_+|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP
MQADIFCRVVDNYGDIGVCWRLARRLAHGHGWEVRLWVDDLASFARIQPGIDAGLARQTFNGVDIVRWSDAPDPALGARDVVIEAFACDPPEPFLDSMRQRHPAWINLEYLSAEAWVESCHGLPSQRPDGLVKHFYFPGFTPATGGLLREPGLSAERDAFQADTAAQDTFLRGLGVAEAHLSLRHNGARTMSLFCYPDAPVDGLALALAADPRPALLLAPEGVAPGLEAACAMPGGPAVARLPFVAQPDFDRVLWCADLNFVRGEDSFVRAAWAARPLVWQIYPQDENIHLEKLDAWLARYPAPETATALMRAWNQPGAGAATAAALAAALAPPAWQAWARAARDWDAAQAVRPDLAENLAGFCAELAKKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

93256 : 103605

Burkholderia_phage(71.43%)

tail,integrase

attL 87879:87898|attR 109148:109167

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
87879:87898	attL	NA	NA	NA	NA
WP_155866886.1\|93256_94279_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JE37	uncultured_Caudovirales_phage	3.7e-24	32.3
WP_155866887.1\|94281_94632_-\|tail	phage tail protein	NA	NA	NA	NA
WP_155866888.1\|96388_97054_-	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	5.6e-74	60.6
WP_024068267.1\|97055_98237_-	putative bacteriophage protein	A9YX12	Burkholderia_phage	5.8e-130	62.6
WP_020924456.1\|98233_98587_-	hypothetical protein	A9YX11	Burkholderia_phage	6.1e-35	66.7
WP_076411901.1\|98595_99339_-	hypothetical protein	A9YX06	Burkholderia_phage	1.5e-83	63.5
WP_155866889.1\|99373_100384_-	hypothetical protein	A9YX04	Burkholderia_phage	6.3e-77	50.9
WP_006388474.1\|100403_100703_-	hypothetical protein	NA	NA	NA	NA
WP_026384173.1\|100712_101312_-	hypothetical protein	NA	NA	NA	NA
WP_155866890.1\|101304_102978_-\|tail	phage tail protein	NA	NA	NA	NA
WP_024068262.1\|103155_103605_-	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	1.1e-17	36.5
109148:109167	attR	NA	NA	NA	NA

DBSCAN-SWA_2

809623 : 859152

Escherichia_phage(27.27%)

transposase,integrase

attL 842286:842345|attR 846851:847671

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023103875.1\|809623_811567_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0U1UNT3	Pseudomonas_phage	2.1e-97	48.2
WP_020924940.1\|811604_812573_-	Dyp-type peroxidase	NA	NA	NA	NA
WP_023106332.1\|812691_813345_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_009459591.1\|813464_813758_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023103878.1\|813780_814671_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023093406.1\|815155_816370_-	glutathione-independent formaldehyde dehydrogenase	NA	NA	NA	NA
WP_028698648.1\|816836_817778_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024086516.1\|818226_819207_+\|transposase	IS5-like element ISPa26 family transposase	A0A077K814	Ralstonia_phage	3.2e-94	56.7
WP_023835768.1\|819459_819891_+	DUF488 domain-containing protein	NA	NA	NA	NA
WP_028690943.1\|820266_822243_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_023103881.1\|822393_823299_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023103882.1\|823453_823861_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_028690944.1\|823862_824471_+	GNAT family acetyltransferase	NA	NA	NA	NA
WP_028690945.1\|824467_825358_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_028690946.1\|825640_825916_+	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_011871467.1\|825975_827085_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.9e-35	30.4
WP_023103885.1\|827128_827527_+	VOC family protein	NA	NA	NA	NA
WP_023464791.1\|827709_829044_+	DUF3422 family protein	NA	NA	NA	NA
WP_023464790.1\|829102_829933_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_028690947.1\|829951_831259_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_028690948.1\|831310_832624_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.3e-77	40.2
WP_028690949.1\|832684_834550_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	3.4e-52	37.1
WP_028690950.1\|834575_837227_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	5.2e-155	33.9
WP_028690951.1\|837307_839152_-	TraI domain-containing protein	NA	NA	NA	NA
WP_023657212.1\|839471_840098_+	hypothetical protein	NA	NA	NA	NA
WP_028690952.1\|840110_840743_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_028690953.1\|840827_841193_+	DUF3742 family protein	NA	NA	NA	NA
WP_000480968.1\|841316_842153_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
842286:842345	attL	NA	NA	NA	NA
WP_001067855.1\|842349_843054_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000015696.1\|843411_843690_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_071533317.1\|843715_843901_+	hypothetical protein	NA	NA	NA	NA
WP_002310911.1\|843897_844236_-	hypothetical protein	NA	NA	NA	NA
WP_001297013.1\|844139_845330_-	tetracycline efflux MFS transporter Tet(C)	A0A2H4UVM2	Bodo_saltans_virus	8.1e-07	24.0
WP_001038045.1\|845422_846082_+	tetracycline resistance transcriptional repressor TetR(C)	NA	NA	NA	NA
WP_001067855.1\|846914_847619_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_015059047.1\|848719_849052_+	quaternary ammonium compound efflux SMR transporter QacL	E5E3Y9	Acinetobacter_phage	3.5e-08	34.3
846851:847671	attR	NA	NA	NA	NA
WP_173361806.1\|849838_850504_+	dihydropteroate synthase	NA	NA	NA	NA
WP_000480968.1\|854157_854994_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_000480968.1\|857414_858251_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001067855.1\|858447_859152_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0

DBSCAN-SWA_3

2708417 : 2725469

Burkholderia_virus(41.67%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155867612.1\|2708417_2709875_+	DUF1254 domain-containing protein	M1IA53	Paramecium_bursaria_Chlorella_virus	2.7e-65	35.8
WP_149895562.1\|2709927_2710623_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_049055147.1\|2710847_2711489_+	hypothetical protein	NA	NA	NA	NA
WP_006385689.1\|2711738_2712206_+	hypothetical protein	NA	NA	NA	NA
WP_054497360.1\|2712211_2712685_+\|tail	phage tail protein	A4JX08	Burkholderia_virus	1.8e-26	44.4
WP_006385691.1\|2712684_2712975_+	DUF4035 domain-containing protein	S4TND7	Salmonella_phage	9.1e-13	50.0
WP_049055149.1\|2713032_2714331_+\|tail	phage tail tape measure protein	A0A1W6JP49	Morganella_phage	5.7e-14	29.4
WP_080684394.1\|2714327_2714672_+\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	4.8e-21	38.4
WP_155867614.1\|2714668_2716630_+\|tail	tail fiber domain-containing protein	A0A0K0KVF1	Prochlorococcus_phage	8.7e-14	36.2
WP_155867616.1\|2716632_2717361_+\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	2.9e-71	58.3
WP_054482521.1\|2717363_2718143_+	C40 family peptidase	A4JX14	Burkholderia_virus	5.0e-66	49.0
WP_006385697.1\|2718139_2718745_+\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	1.0e-50	55.7
WP_155867618.1\|2718870_2722374_+	DUF1983 domain-containing protein	A4JX16	Burkholderia_virus	1.9e-261	45.2
WP_054439116.1\|2722379_2722751_+	hypothetical protein	NA	NA	NA	NA
WP_054448635.1\|2722731_2722968_+	hypothetical protein	NA	NA	NA	NA
WP_006385701.1\|2722964_2723561_+\|tail	tail assembly protein	C7BGD3	Burkholderia_phage	1.9e-49	53.0
WP_020926165.1\|2723702_2724632_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006385703.1\|2724650_2725469_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.4e-10	49.3

DBSCAN-SWA_4

3742827 : 3802412

Pseudomonas_phage(32.35%)

integrase,terminase,capsid,tail,protease,plate

attL 3739517:3739533|attR 3763763:3763779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3739517:3739533	attL	NA	NA	NA	NA
WP_024068352.1\|3742827_3744132_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_024068353.1\|3744150_3745053_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_024068354.1\|3745310_3746468_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_006387864.1\|3746544_3747840_+	adenylosuccinate synthase	A0A0B5J049	Pandoravirus	3.8e-58	31.4
WP_006387865.1\|3747923_3748466_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_006218592.1\|3748950_3749163_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_155868065.1\|3749182_3751246_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	7.1e-67	43.2
WP_024068358.1\|3752029_3754297_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.2e-36	30.1
WP_155869748.1\|3755176_3756319_+	glycosyltransferase	NA	NA	NA	NA
WP_006387914.1\|3756420_3757341_-	glycosyl transferase	NA	NA	NA	NA
WP_155868067.1\|3757468_3758647_-	acyltransferase family protein	A0A1R3Y5Q6	Salmonella_virus	4.3e-08	31.4
WP_155868069.1\|3759199_3760168_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8E5	uncultured_Caudovirales_phage	3.7e-66	42.9
WP_080944967.1\|3760094_3760325_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_131728078.1\|3760388_3760694_+	hypothetical protein	NA	NA	NA	NA
WP_155868071.1\|3760780_3761572_-	ParB N-terminal domain-containing protein	C7BGF1	Burkholderia_phage	1.9e-81	61.1
WP_155868073.1\|3761609_3761975_-	hypothetical protein	NA	NA	NA	NA
WP_155868075.1\|3762068_3763091_-	recombinase RecT	Q858E1	Salmonella_phage	5.1e-58	50.0
WP_131728079.1\|3763087_3764065_-	YqaJ viral recombinase family protein	Q858E0	Salmonella_phage	7.2e-62	37.4
3763763:3763779	attR	NA	NA	NA	NA
WP_054446203.1\|3764067_3764265_-	hypothetical protein	NA	NA	NA	NA
WP_054446204.1\|3764359_3764737_-	hypothetical protein	NA	NA	NA	NA
WP_155868077.1\|3764738_3765086_-	hypothetical protein	NA	NA	NA	NA
WP_054446206.1\|3765258_3765546_+	hypothetical protein	NA	NA	NA	NA
WP_054446207.1\|3765574_3765952_-	helix-turn-helix transcriptional regulator	A0A1W6JTC8	Pseudomonas_phage	1.1e-07	44.6
WP_070783428.1\|3766045_3766333_+	hypothetical protein	NA	NA	NA	NA
WP_155868079.1\|3766425_3766767_-	hypothetical protein	NA	NA	NA	NA
WP_155868081.1\|3766856_3767198_+	hypothetical protein	NA	NA	NA	NA
WP_131728081.1\|3767163_3767433_-	hypothetical protein	NA	NA	NA	NA
WP_131728082.1\|3767690_3768182_-	hypothetical protein	J7HXA3	Pseudomonas_phage	4.3e-23	43.1
WP_155868083.1\|3768335_3769652_-	HNH endonuclease	NA	NA	NA	NA
WP_155868085.1\|3769826_3770489_-	hypothetical protein	NA	NA	NA	NA
WP_155868087.1\|3770630_3771734_+	DUF1376 domain-containing protein	H2BD69	Pseudomonas_phage	8.5e-43	51.9
WP_155868089.1\|3771730_3772210_+	hypothetical protein	NA	NA	NA	NA
WP_155868091.1\|3772521_3773148_-	hypothetical protein	NA	NA	NA	NA
WP_155868092.1\|3773384_3773753_+	hypothetical protein	NA	NA	NA	NA
WP_155868094.1\|3774122_3774329_+	hypothetical protein	NA	NA	NA	NA
WP_155868096.1\|3774599_3775178_+	hypothetical protein	NA	NA	NA	NA
WP_155868098.1\|3775328_3775553_+	hypothetical protein	NA	NA	NA	NA
WP_155868100.1\|3776225_3776915_-	DUF4145 domain-containing protein	M1PSB6	Streptococcus_phage	1.1e-32	36.5
WP_155868102.1\|3776984_3777458_+	DUF2280 domain-containing protein	A0A125RNL6	Pseudomonas_phage	1.6e-35	58.1
WP_173361834.1\|3777408_3778992_+\|terminase	phage terminase large subunit	B5AX37	Iodobacteriophage	2.1e-111	46.0
WP_155869756.1\|3778991_3780272_+	DUF1073 domain-containing protein	E5D056	Escherichia_phage	9.6e-30	29.3
WP_155869753.1\|3780363_3781053_+\|capsid	minor capsid protein	I3PGT9	Xanthomonas_phage	1.9e-32	41.8
WP_155868104.1\|3781063_3782146_+	DUF2213 domain-containing protein	E5AGA6	Erwinia_phage	4.7e-54	39.9
WP_155868106.1\|3782145_3782598_+	hypothetical protein	NA	NA	NA	NA
WP_049054451.1\|3782665_3783625_+	DUF2184 domain-containing protein	A0A0N9SG07	Pseudomonas_phage	1.5e-56	38.3
WP_155868108.1\|3783624_3784011_+	hypothetical protein	NA	NA	NA	NA
WP_155868110.1\|3784013_3784388_+	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_155868112.1\|3784377_3784830_+	hypothetical protein	A0A2K9V3I1	Faecalibacterium_phage	7.8e-11	32.8
WP_049054455.1\|3784834_3785248_+	hypothetical protein	NA	NA	NA	NA
WP_049054456.1\|3785375_3785834_+	hypothetical protein	NA	NA	NA	NA
WP_155868114.1\|3785899_3787258_+	DUF3383 family protein	A0A0N9SJA3	Pseudomonas_phage	2.2e-80	39.2
WP_045953074.1\|3787273_3787702_+	DUF3277 family protein	A0A0N7GFC4	Pseudomonas_phage	2.5e-19	38.2
WP_049054458.1\|3787701_3788211_+	hypothetical protein	NA	NA	NA	NA
WP_155868116.1\|3788353_3790816_+	tape measure protein	A0A2H4JHR1	uncultured_Caudovirales_phage	6.8e-16	33.1
WP_049056870.1\|3790829_3791450_+	hypothetical protein	I3PGV3	Xanthomonas_phage	2.2e-08	28.2
WP_049052495.1\|3791454_3791787_+	hypothetical protein	A0A0N9SG14	Pseudomonas_phage	7.2e-14	42.5
WP_155868118.1\|3791773_3792691_+	hypothetical protein	E5AGC0	Erwinia_phage	2.1e-39	32.2
WP_054449334.1\|3792687_3793386_+	hypothetical protein	A0A2H4J8H6	uncultured_Caudovirales_phage	1.1e-11	30.6
WP_054449335.1\|3793385_3793754_+	hypothetical protein	A0A218MAM6	Escherichia_phage	9.8e-12	35.3
WP_049056872.1\|3793775_3795227_+\|plate	baseplate J/gp47 family protein	A0A0N9SH53	Pseudomonas_phage	4.2e-74	36.0
WP_020926979.1\|3795226_3795892_+	DUF2612 domain-containing protein	D4N460	Pseudomonas_phage	2.0e-15	31.2
WP_155868119.1\|3797231_3797681_+\|tail	phage tail protein	Q9ZXK5	Pseudomonas_virus	7.2e-25	45.8
WP_054446237.1\|3797780_3798224_+	hypothetical protein	A0A0A1IVG1	Pseudomonas_phage	2.0e-11	35.0
WP_155868121.1\|3798226_3798718_+	hypothetical protein	I6NSS1	Burkholderia_phage	2.6e-44	58.6
WP_155868123.1\|3798720_3798987_+	hypothetical protein	NA	NA	NA	NA
WP_173361835.1\|3799294_3799714_+	hypothetical protein	NA	NA	NA	NA
WP_155868127.1\|3800890_3801553_-	Arc family DNA-binding protein	A0A0P0IVR2	Acinetobacter_phage	1.9e-05	42.0
WP_155868129.1\|3801653_3802412_+	phage antirepressor	E7DUM4	Liberibacter_phage	2.8e-37	38.8

DBSCAN-SWA_5

3939412 : 3949549

uncultured_Mediterranean_phage(14.29%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155868211.1\|3939412_3940054_+	hypothetical protein	A0A1B1ITG1	uncultured_Mediterranean_phage	3.0e-24	33.0
WP_155868213.1\|3940057_3940447_+	hypothetical protein	NA	NA	NA	NA
WP_054481154.1\|3940448_3940982_+	hypothetical protein	NA	NA	NA	NA
WP_054496579.1\|3940994_3941456_+	hypothetical protein	NA	NA	NA	NA
WP_155868215.1\|3941459_3942716_+	hypothetical protein	A0A0B5A596	Achromobacter_phage	2.4e-49	43.6
WP_155868217.1\|3942715_3943123_+	hypothetical protein	NA	NA	NA	NA
WP_024069265.1\|3943158_3943506_+	Prophage membrane protein	E5E3W4	Burkholderia_phage	7.3e-17	45.4
WP_155868219.1\|3943507_3943816_+\|holin	phage holin family protein	A0A0U4J8T9	Pseudomonas_phage	7.9e-07	46.2
WP_155868221.1\|3943848_3945474_+	hypothetical protein	A0A2R2Z356	Escherichia_phage	1.6e-50	28.3
WP_155868223.1\|3945476_3946646_+	hypothetical protein	Q08J79	Stx2-converting_phage	2.0e-18	38.4
WP_104414103.1\|3946645_3946936_+	hypothetical protein	NA	NA	NA	NA
WP_155868225.1\|3946936_3947581_+	hypothetical protein	NA	NA	NA	NA
WP_155868227.1\|3947602_3947890_+	hypothetical protein	NA	NA	NA	NA
WP_155868229.1\|3947886_3948360_+	hypothetical protein	NA	NA	NA	NA
WP_155868231.1\|3948370_3949549_+	hypothetical protein	A0A248SL32	Klebsiella_phage	1.3e-33	33.2

DBSCAN-SWA_6

4539659 : 4547594

Moraxella_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006388149.1\|4539659_4540247_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.2e-19	36.8
WP_006388150.1\|4540280_4540655_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	1.9e-10	27.8
WP_006388151.1\|4540852_4541875_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_155868444.1\|4542253_4542610_+	VOC family protein	NA	NA	NA	NA
WP_155868446.1\|4542694_4543987_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.9e-65	36.5
WP_155868448.1\|4544095_4545127_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.1e-92	51.6
WP_006388155.1\|4545196_4545838_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_020927471.1\|4546026_4546785_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.5e-67	51.6
WP_006388157.1\|4546829_4547594_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.3e-31	45.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LN890476

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection