CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LN890477	Achromobacter xylosoxidans isolate R8 chromosome BN2910	7 crisprs	DinG,cas3,DEDDh,csa3,WYL,PD-DExK	1	3	8	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LN890477_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890477_1

32332-32434

Orphan

Consensus_repeat	Method
CCCCTCGGGGGGCAGCGACCCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN890477_1

>merge|NZ_LN890477|1|32332-32434|CRISPRCasFinder
CCCCTCGGGGGGCAGCGACCCGCGCAGCGGCGAGCGTGGGGGGCTTTTTTTTGCCGCCGGGCCGCCCCAAGGCAAAAACGCCCCTCGGGGGCAGCGACCCGCG

>NZ_LN890477|1|1|32332-32434|CRISPRCasFinder
CCCCTCGGGGGGCAGCGACCCGCG	CAGCGGCGAGCGTGGGGGGCTTTTTTTTGCCGCCGGGCCGCCCCAAGGCAAAAAC
GCCCCTCGGGGGCAGCGACCCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890477.1\|WP_155871262.1\|35804_37334_-\|amidase	unknown	unknown	gnl\|CDD\|223232
NZ_LN890477.1\|WP_107316881.1\|21125_22421_-\|AAA-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|224041
NZ_LN890477.1\|WP_076411985.1\|22429_24163_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|227319
NZ_LN890477.1\|WP_006384054.1\|40568_40925_-\|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein	unknown	unknown	gnl\|CDD\|239333
NZ_LN890477.1\|WP_155874006.1\|24333_28245_-\|ATP-dependent-RNA-helicase-HrpA	unknown	unknown	gnl\|CDD\|273900
NZ_LN890477.1\|WP_006384055.1\|40921_41731_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182574
NZ_LN890477.1\|WP_006384038.1\|15441_16533_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_LN890477.1\|WP_049058827.1\|39067_39802_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378479
NZ_LN890477.1\|WP_024068303.1\|37522_38902_-\|DNA-recombination-protein-RmuC	unknown	unknown	gnl\|CDD\|224241
NZ_LN890477.1\|WP_049055496.1\|33368_34049_-\|ribose-5-phosphate-isomerase-RpiA	unknown	unknown	gnl\|CDD\|234816
NZ_LN890477.1\|WP_053498776.1\|34085_35750_-\|isovaleryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|183199
NZ_LN890477.1\|WP_054498492.1\|30297_32250_+\|phospholipase-C,-phosphocholine-specific	unknown	unknown	gnl\|CDD\|274561
NZ_LN890477.1\|WP_006384047.1\|32491_33217_-\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|182974
NZ_LN890477.1\|WP_070780632.1\|41727_42648_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182646
NZ_LN890477.1\|WP_006384037.1\|14596_15445_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|213026
NZ_LN890477.1\|WP_020924404.1\|20153_21053_+\|lipid-A-hydroxylase-LpxO	unknown	unknown	gnl\|CDD\|380241
NZ_LN890477.1\|WP_006384045.1\|29889_30162_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_LN890477.1\|WP_006384053.1\|39838_40564_-\|DNA-3-methyladenine-glycosylase	unknown	unknown	gnl\|CDD\|234840
NZ_LN890477.1\|WP_006384036.1\|13844_14600_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_LN890477.1\|WP_006384039.1\|16532_20024_-\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|235554

Protein	Function_ID	Function_description	E-value
NZ_LN890477.1\|WP_155871262.1\|35804_37334_-\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	2.84034e-96
NZ_LN890477.1\|WP_107316881.1\|21125_22421_-\|AAA-associated-domain-containing-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	3.37567e-110
NZ_LN890477.1\|WP_076411985.1\|22429_24163_-\|ABC-transporter-permease-subunit	gnl\|CDD\|227319	COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism].	7.73304e-173
NZ_LN890477.1\|WP_006384054.1\|40568_40925_-\|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein	gnl\|CDD\|239333	cd03035, ArsC_Yffb, Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC. The structure of Yffb and the conservation of the catalytic cysteine suggest that it is likely to function as a glutathione (GSH)-dependent thiol reductase. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from GSH via glutaredoxin, through a single catalytic cysteine.	6.45727e-47
NZ_LN890477.1\|WP_155874006.1\|24333_28245_-\|ATP-dependent-RNA-helicase-HrpA	gnl\|CDD\|273900	TIGR01967, ATP-dependent_RNA_helicase_HrpA, RNA helicase HrpA. This model represents HrpA, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterized, is about 800 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing. The HrpA/B homolog from Borrelia is 500 amino acids shorter but appears to be derived from HrpA rather than HrpB. [Unknown function, Enzymes of unknown specificity].	0
NZ_LN890477.1\|WP_006384055.1\|40921_41731_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182574	PRK10592, PRK10592, putrescine transporter subunit: membrane component of ABC superfamily; Provisional.	1.7753e-105
NZ_LN890477.1\|WP_006384038.1\|15441_16533_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	5.99363e-66
NZ_LN890477.1\|WP_049058827.1\|39067_39802_+\|hypothetical-protein	gnl\|CDD\|378479	pfam10707, YrbL-PhoP_reg, PhoP regulatory network protein YrbL. This is a family of proteins that are activated by PhoP. PhoP protein controls the expression of a large number of genes that mediate adaptation to low Mg2+ environments and/or virulence in several bacterial species. YbrL is proposed to be acting in a loop activity with PhoP and PrmA analogous to the multicomponent loop in Salmonella where the PhoP-dependent PmrD protein activates the regulatory protein PmrA, and the activated PmrA then represses transcription from the PmrD promoter which harbours binding sites for both the PhoP and PmrA proteins. Expression of YrbL is induced in low Mg2+ in a PhoP-dependent fashion and repressed by Fe3+ in a PmrA-dependent manner.	1.13519e-89
NZ_LN890477.1\|WP_024068303.1\|37522_38902_-\|DNA-recombination-protein-RmuC	gnl\|CDD\|224241	COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only].	3.07248e-95
NZ_LN890477.1\|WP_049055496.1\|33368_34049_-\|ribose-5-phosphate-isomerase-RpiA	gnl\|CDD\|234816	PRK00702, PRK00702, ribose-5-phosphate isomerase RpiA.	3.4245e-115
NZ_LN890477.1\|WP_053498776.1\|34085_35750_-\|isovaleryl-CoA-dehydrogenase	gnl\|CDD\|183199	PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provisional.	0
NZ_LN890477.1\|WP_054498492.1\|30297_32250_+\|phospholipase-C,-phosphocholine-specific	gnl\|CDD\|274561	TIGR03396, PC_PLC, phospholipase C, phosphocholine-specific, Pseudomonas-type. Members of this protein family are bacterial, phosphatidylcholine-hydrolyzing phospholipase C enzymes, with a characteristic domain architecture as found in hemolytyic (PlcH) and nonhemolytic (PlcN) secreted enzymes of Pseudomonas aeruginosa. PlcH hydrolyzes phosphatidylcholine to diacylglycerol and phosphocholine, but unlike PlcN can also hydrolyze sphingomyelin to ceramide ((N-acylsphingosine)) and phosphocholine. Members of this family share the twin-arginine signal sequence for Sec-independent transport across the plasma membrane. PlcH is secreted as a heterodimer with a small chaperone, PlcR, encoded immediately downstream. [Cellular processes, Pathogenesis].	0
NZ_LN890477.1\|WP_006384047.1\|32491_33217_-\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|182974	PRK11115, PRK11115, phosphate signaling complex protein PhoU.	3.54726e-72
NZ_LN890477.1\|WP_070780632.1\|41727_42648_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182646	PRK10683, PRK10683, putrescine transporter subunit: membrane component of ABC superfamily; Provisional.	1.44449e-127
NZ_LN890477.1\|WP_006384037.1\|14596_15445_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|213026	cd10969, CE4_Ecf1_like_5s, Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.	8.68408e-88
NZ_LN890477.1\|WP_020924404.1\|20153_21053_+\|lipid-A-hydroxylase-LpxO	gnl\|CDD\|380241	NF033391, lipid_A_LpxO, lipid A hydroxylase LpxO. Members of this family are LpxO, an enzyme that modifies one of the lipid chains in lipid A by hydroxylation, with resulting changes in resistance to the host immune response and to the antibiotic colistin. This family, as built, includes LpxO1 from Pseudomonas aeruginosa, but not its paralog LpxO2.	0
NZ_LN890477.1\|WP_006384045.1\|29889_30162_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	2.71711e-57
NZ_LN890477.1\|WP_006384053.1\|39838_40564_-\|DNA-3-methyladenine-glycosylase	gnl\|CDD\|234840	PRK00802, PRK00802, DNA-3-methyladenine glycosylase.	1.06237e-67
NZ_LN890477.1\|WP_006384036.1\|13844_14600_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.13404e-105
NZ_LN890477.1\|WP_006384039.1\|16532_20024_-\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|235554	PRK05673, dnaE, DNA polymerase III subunit alpha; Validated.	0

>NZ_LN890477.1|WP_054498492.1|30297_32250_+|phospholipase-C,-phosphocholine-specific
MKEDPSSASSSDLPPAIRRALAVAPDRKHGTLHDVRHVVILMQENRSFDHYFGSLPGVRGFADPHPVPTPAGDVLTQADGAERVRPYALQGEYASDTPVGYITPHTWDDAQRAWNDGRMDQWLAAKRRLGMGAYRPAEVPFQTALANAFTLCDAYHCSVQAGTNPNRLFLWTGTNDPLGRAGGPALVNTFDRLGPADQGYGWTTYPERLQAAGIDWRIYQDMADNFHDNPLAGFRQYRRQHEAGGADAPLRDRGLSTHTLDDLAHDVEQGTLPQVSWIIAPAADSEHPEVSSPRQGGAYTERVLEILTRNPAVWSGCVLLVTYDENDCFFDHMPPPAPPARETDGRSGGLSTVELDGEYHDTRHGPSAATPDDPAALHGRGFGMGPRVPMLVVSPWSRGGWVNSQVFDHTSVIRFLEARFGVAEPNISAWRRAVAGDLTSAFDFAGDRATLHADSVRHACALPYALEAVGRMTADGEHYRLTFRNPGTAGAVLHVYDRRALERAPRRYTVGAGARLDDGWRLDAEGAYDLWLLGPDGFHRRFRGDTRDAGLLETQLVPVTSGIRLRLINHGDTHLPVQIESRMGDGWRAMAHVQAGGALELKYAGCEGWYDLDVSAQGLPAFGRRLAGRINAGKSGVPDPRLCQGAELPL
>NZ_LN890477.1|WP_006384045.1|29889_30162_+|oxidative-damage-protection-protein
MARTVNCVKLKREAEGLDFPPYPGELGTRIWQSISKEAWEEWKQVQTRLVNENRLNLADARARKYLQQQMERFLFEDGSVEAQGYVPPSA
>NZ_LN890477.1|WP_155874006.1|24333_28245_-|ATP-dependent-RNA-helicase-HrpA
MPADGPTRGPRKPRADAAAPAARQAPRPERPIPAVTYPEDLPVSARRQEIARAIAGHQVVIVSGETGSGKTTQLPKICLELGRGRQKMIGHTQPRRLAATSVAKRIAEELNTPMGEVVGYQVRFNDRTGPNASIKLMTDGILLAESQRDPLLRRYDTIIIDEAHERSLNIDFLLGYLKQLLPRRPDLKVIITSATIDAERFARHFAASEDKPAPVIEVSGRLYPVEVRYRPVREEAAEDEAAPARPGRDRERMSGDEERDLIDAIVDAVDECARHGPGDVLVFLPGEREIRESAEALRKRHPAGTEVLPLYARLSQAEQEQIFHPRGNARRIVLATNVAETSLTVPGIRFVVDSGLARVKRYSWRNKVEQLRIEPVSRASANQRAGRCGRVGPGVCIRLYDEVDFNARAAFTDPEVLRSSLASVILRMKSLKLDDIEQFPFVEAPPGRAVADGYHLLQELGAIELAAADDGDDASRTGASFVLTQTGHELAKLPVDPRIGRMILAAREHQCLAEMLIIASALSVQDARDRPMQEREAAEAAHAKFADDKSEFISFLKLWRWYGEQVQHKASQRKLVGLLRQNFLSPIRLREWHDVHTQLAALVGEQGWRVNQVEATYEQLHMALLSGLLGNIGFKSDEGGHYQGAREIRFHIHPGSRLVKKAGRWIVAAELVETTRLYARCVARIDPVWLEKVGAHLIRKNWSDPRWEKKAGQVVANERATLYGLTIYSGRRIQYGRVHPREARELFIRQALVPGEIDTRLAFVAHNRKLIAGIEKLEHQTRRPDILVDDELIYAFYDRQLPADISQTATLEKWVNGLDKAEAAKLLLTRDELMRHEAAGVTTDVFPKKVEWQGVSMALDYHFEPGSPRDGVTLAVPLFALNQIDPARCEWLVPGMLKEKVHLLLKSLPQKLRRHCVPLPDYAAGFYDRWFERLGDPQTGLVDALIADMWDQVQVRPAAADFKLETLPAHLFMNFRVVDEHGRMLAAGRNLAQLRAEFGKQAQATFQQLAASDTQVAQALAHENLTAWTFGPLPEIMEIKRRGQSVIGYPALVDRGAHCDLDVFDDPDEARKAHRAGLLKLFRLGLREQVKFLEKNLADLTKISMLYMTLGTQEELRDQIIDCALGQACLAEPWPVNEQQFEARRAEGKGRLGLLAQEVARLAGTILTEYAALQRKLPQAKPHAAAYADLQQQLGALMPKWFIRDTPYPQLSHFPRYLKAAVARIDKLRADPGRDAKLVAEMAPLVTQYQRARSALKGAPDPRLDEFRWLLEELRVALFAQELRTPMPVSVKRLMKSWESLQR
>NZ_LN890477.1|WP_076411985.1|22429_24163_-|ABC-transporter-permease-subunit
MFELFSTRTRPSASSRSSPNRWDWALLPLVLVVLAAMAYGASQMSRPFAVGEELPISLDPIYLPYYLLRTILRMFTALAFSLLFSFVFAAIAAKFRTAEKAMIPMLDILQSVPILGFQAIAIAPFIALFPGNLLGVECAAIFAIFTSQAWNMAFSLYQSMRTVPAELNEAARVFRLSGWQRFWRLELPYATPGLLWNMMMSMSGGWFFLVAAEAISVAGQDIKLPGIGSYIAVAIDAENGRAIAWAIGAMMAGILLYDQLFFRPLLAWADKFRFEESQADVAQQSWLLDWTRRSRWMQALSNMFWARMRRALGWFSVPYDGTSIRARAKAPDPRWTRIWDSLLAAAALLATYKLVVFVHQEVGWSEVLHVVGLGGITLARVMVLIGLASLIWVPIAVWIGLRPRYSQRVQAVAQFLAAFPVNLLFPAVVFVMVAFKLNPNIWLSPLIIFGTQWYILFNVVAGASTIPNELRLAAGNLGLKGWLLWRRVYLPAVFPSFITGAITASGGSWNASIVAEYVSWGNTSLVADGLGSYIKQMTEQGDFHRIALGIGVMSIFVMLLNRFFWRKLYLLAEDRGR
>NZ_LN890477.1|WP_107316881.1|21125_22421_-|AAA-associated-domain-containing-protein
MPSNFLIELHDVGKSFRAADGTARHVLEHVDFTLREGEIVALLGKSGSGKSTLLRIMAGLVNADQGTVTYRGQPVYGPAAGIAMVFQSFALFPWLTAQQNVELGLEAQGVAPAERAGRADAVLDLMGLGGFGGALPRELSGGMRQRVGIARALVMNPDVLLMDEAFSALDVLTGETLRDDMLELWDESRISTKGILIVSHNIEEAVMMADRIIVFSSDPGRIRSQVQIGLPRPRNADSPQVRALIDEVYALMTQRPAHDMPTPRQQGLGYRFPHTEVERMEGVLDVLAEAPFNGRADLPKLAEEAEISDDDLLPACEALGLFGLAQIDKGDIYLTPLGQRYVQADQDQKQAIFGRQLLAHVPLAAHIRHSLEQEPAGELPERNFLDSLEEFLKPDEAERVLKIAVEWGRYGEIYGYDYHTGLLSLPERAAG
>NZ_LN890477.1|WP_020924404.1|20153_21053_+|lipid-A-hydroxylase-LpxO
MKWLIPGIWLAAILFAHFRGRVKLPLGRQLLDHSVLLAPVNAFMVLTSRVPSTPYLTTSEIAELKVLDDNWETIRDEALQMAELRRIKAADSHNDIGFNSFFKYGWKRFYLKWYDARHPSAEELCPKTVAILKTLPKVKAAMFAELPPGGKLNAHRDPFAGSLRYHLGLTTPNDDRCHIIVDGESYSWRDGESVVFDETYVHEAYNHTDQNRIILFCDVERPLKWGWAEAFNRWFGRVVMSAASSPNDGGDQTGAINKLTHAHWVIDQKRKAFKAWNRNVYKATKYGLIILVIAGFIAL
>NZ_LN890477.1|WP_006384039.1|16532_20024_-|DNA-polymerase-III-subunit-alpha
MSEAVTTPSPFVHLRVHSEFSVVDGIVRIPDLIKRVAKLGQPAVALTDLSNLFGLIKFYKGARGAGIKPIAGCDVWLSNDDDPAKPFRVLLLVRNHQGYLNLCELLSRAFLTNQGKGRAEIRREWLQGQDGLIVLSGGRGGDVGQALDAGNAVSALALARQWAHMFPGSYYIELQRAGMDGDEAYTQAAMRLAAEAGLPVVATHPVQFLDEYEFQAHEARVCIAEGEILANPRRVRRFSKEQYLLSSEEMARRFADVPSALANTVEIAKRCNLSLVLGKPRLPNFPTPDGVSLDDYLVQLSEEGLEKRMAFLFPDEAERASKREQYYERLRWECKTIIQMGFPGYFLIVQDFINWGKNNGVPVGPGRGSGAGSLVAYALGITDLDPIRYDLLFERFLNPERVSMPDFDIDFCQDNRERVIDYVKEKYGRAAVSQIATFGTLGAKAVVRDAGRVLDMPYMFCDGLSKLIPFNPMDPWTLERTLKDEPAFKDRYEQEEEVRALVDLAKPLEGLTRNIGMHAGGVLIAPGKLTDFCPLYCQPGQENSAVSQFDKDDVEAAGLVKFDFLGLRNLTILDWAVRYVRQFNEDKRDFDVMALSLDDPAAYKILCDANTTAVFQLESRGMKELLKKLRPNTFEDIIAMLALYRPGPLESGMVDDFVNRKHGRAAVDYFHNDLESTLKSTYGVIVYQEQVMLISQIIGGYSLGGADLLRRAMGKKKPEEMAKHRELFEKGAKEKGHDPDLAVKLFDLMEKFAGYGFNKSHSAAYALISYQTAWLKAYHPTEFLAATMSSDMDDTDKVQIFCRDAQDNGVEVLPPDVNFSGYRFEPVADKHTEKGKPPRTMRYGLGAVKGTGQGAVEDILRARKEGGPFQNLFDFCRRVSKHAVNRRTIEALIKAGAFDTIEPNRAAMLASVPTAMEAAEQAARSANQSSLFGDDSSDVVAGELAKVAPWDLHKKLTEEKSALGYYYSGHLFDAWRDEVRQIVPMQLARVEPQRDLQWMCGVLASVRVMMTRRGKMVFAVLDDGTAQVEISVFNELYEKHRNRLREDQLVIVQGKVSNDDYSGGMRIVAEQLYDLQLAREARAKSLRVKLNGGADAARLRQMLNPFRAEPENGIPGVPVDIVYTKNNFLCTVRLGEEWRVRMADTLLENLNAWTKPNGVEVTY
>NZ_LN890477.1|WP_006384038.1|15441_16533_-|glycosyltransferase-family-4-protein
MRIVHSEAATSFGGQEGRIFKEMNAMRARGHHLEAICQPTALLAERLSDAGFTVHTLEMDGPVNYVKGVIAIRRILREGRFDVLNTHSRRDTVIAAAAGRLAGTPLIVRTRHLSNKVGSLWSYTRLPHRVTTVSDHVREHLIERGVPADHVATVYSPIVLPPPVEHSTLREELGLAADDVVVGCVAVMRATKGHKDLIDAIAPLMAARPKLHLVFVGGGSPVFEQTQAYVAERGLADRIHLMGMRRDVPNLLAGCDLFALATQQEASGTVYVEAQASGLPVIGTDVGGVSEMFRDGETGILVPPKDPAALTAALERLVDDAALRHRMGEAGRKMVWEEGVFSPARLAETTEAVYTRWLAERRG
>NZ_LN890477.1|WP_006384037.1|14596_15445_-|polysaccharide-deacetylase-family-protein
MNAPNVPVLMYHHVTPAGGMIAATPEVFEAQIARLARAGYQSLSTDQFAAYLAGAPAPERSVLITFDDGYLNNWVHAHPVLARHGMRAVLFTITGWIGDGPARPHAGQGLPLPATPDHDACKKLIAAGRGDEAMLRWSEIEAMRAAGTFEFHSHTHTHTRWDKVCGADTEAKRAHIARELSDSRETLIQRLGQASDHLCWPQGYFDADYVAAARQAGFRHLYTTDPFGQNTPGADPGHIYRFAVRNQGGTWLNRRLWLSRDPFWGPRYHAWKAWKKRLRNRG
>NZ_LN890477.1|WP_006384036.1|13844_14600_-|glycosyltransferase-family-2-protein
MKLSVIVITKNEAANIAECLKSVAFADEFIVVDSGSTDGTVELARALGARVEVTSDWPGFGPQKNRALDLATGDWVLSIDADERVTPELAREIQDTLAAPRADTYEIARLSNFCGRDIRHSGWWPDYVLRLFKRGAARFNDAAVHERVVPANGQPPLQLKGYFHHYPYDNLDALVTKINRYSSDAAAMMYAKGRRTSVFGALGHSFWTFVRIYLIRRGFLDGRHGLVLAVTAAAGSFFRYSKLMFLAEKNK
>NZ_LN890477.1|WP_006384047.1|32491_33217_-|phosphate-signaling-complex-protein-PhoU
MTEHTNKQFDADLESVRSQFLQMGGVVEAMIQEAIDALASGDLTLVEKVREREKEVNRHEVEIDESISRILARHQPTAIDLRMLMAVSKMLTDMERSGDEAEKVATVARRIHESEVRHIPVIELRHMAANVRTMLHQALDAFARLDPILAAAVVRSDKEVDKEWKGALRHLITYMIEDPRTISRAIDMIFIARALERIGDHAKNMSERVIYMVKGADVRHTGVKNTERLARGEEDTPGQDD
>NZ_LN890477.1|WP_049055496.1|33368_34049_-|ribose-5-phosphate-isomerase-RpiA
MLSQQELKQQAADAALELVEQVAGPDVIIGVGTGSTADLFIDGLARFKGRIGGTVASSERSAARLAGHGLKVLDLNDVTSMPIYVDGADEIDANLHMIKGGGGAQTREKIVASVADRFVCIVDESKLVEVMGKFPLPIEVIPMAREAVARAMTAMGGQPRLREGFVTDNGNIILDVAGLSITDAPGLEARVNNLPGVVTCGLFAIAGADVALLATQNGIRRLDRRA
>NZ_LN890477.1|WP_053498776.1|34085_35750_-|isovaleryl-CoA-dehydrogenase
MPSFVTHTVLNQVPPLEDYSLFETDPALREAAVREGAGAWLGDLGAHGAWLGRAQTLAAGVDANRYPPRLQAYDRTGHRIDHVDFHPAWQLLMSGIVARGLHSRAWVQPVPGAQVARAAAYLMQGQVEAGTLCPTTMTFAAVPLLQREPAGVIDYTGDWLPALYSREFDGADAPLAGKRGALIGMGLTEKQGGSDLRAVTTRAAPLGAIGRGCAYLLVGHKWFFSVPQADAHLVLAQTDEGLGCFLVPRWIPEGPRNAVRIRRLKDKLGNHSNASAEVEFEDAWGVMVGEPGRGLAVLLEMAATTRLDCVLGSAALLRQALVQSLHHACHRQAFGKPLLAQPLMRNVLGDLALESEAAQALALRLARAVDERGDAGARALARVGTPAAKLWVCKRAIAAVAECMEAWGGNGYVEEGPMPRLYRETPVNSIWEGSGNVMALDVLRALQREPEALPALEGEFAPALGQYREFDAALARWRALLADPAQAEFQARRIACGLACLWQAALLIRHAPGPVAQGFVGSRLGGVGGVFGELAGGLDVGTILARAWPAAAAC
>NZ_LN890477.1|WP_155871262.1|35804_37334_-|amidase
MGTADRVDSSSFDAMALGAEIAQGATTAQAAMQQAVERVAARNPSINAACGVQAELGLDLARALDDELATLTAEQRLALLRERPFLGVPTLLKDLGTAALGLPSAMGSVLYGQVEWNVDAEIVKRYRRAGLIPFGRSTSAELGLSPTSESPVYGAPTQNPWKAGHSAGGSSGGAGAALASGMVRIAHGSDGGGSIRIPASCCGVLGLKPSRGMMPLGPLKGEGWGGLATEHMMTLSVRDCAAALDISAGADVGAPYAAPARPGESYRDIVARVSADPRSSPRRRIAYINTTYEGEAIHPEVAAAVDKAARLFAGLGHELVVAAPPVGSEEVLSPMLPLIASAAANAIDSFVGARNRRLAADELQPTTLGAREYARAISGAQYVACVDTCHEITRRIGRFLHREGTQGHDLFLSPVLAQLPAPIGRYAMDNADYLAYRLGKKGVIGYSPFAPLANLTGMPAISIPFGLSADGLPIGIQVMGPLGSEAWLLELAAQVEALRPWQRVAPIAR
>NZ_LN890477.1|WP_024068303.1|37522_38902_-|DNA-recombination-protein-RmuC
MSNEVLLWVAAGGAVLACLAALMAWLSRPARDDRLDALLDGLERTERALRADIAEGQRGLRAEFSESTRGLRQELAQSHGELRAALTRDAQAARVESAESLARFAAGFNEQLQGLIQINERRLMEVRETVDQRLQALQNDNSAKLDDMRRTVDEKLHATLEQRLGESFKQVSDRLEAVHKGLGEMQALAAGVGDLKRVLTNVKSRGTWGEVQLARLIEDNMTPEQYASNIKPVPGSDAVVEFAIRLPGRGDGGMPVWLPIDAKFPKEEYERLMDAQEAADAEGVKAAGAALAKAVELQARLIATKYVAPPHTTDFAIMFLPTESLYAEVLRRPGLLDRLHDLRINVAGPSNLAALLNSLQMGFRTLAIEQRSSEVWQVLRAVKTEFGKFGDALAGVKKTLDTASSKIGQTEVRTRAMLRNLKSVEALPEAEALRLLGGEGAADETAAEGDAPAAPASGA
>NZ_LN890477.1|WP_049058827.1|39067_39802_+|hypothetical-protein
MNTADFPTYCPPPVAFESIFGPLNLNDETPVAVGGDRHIFQHPHAPSLLVKVMDMQARAIYLEARPFKRWYKQYQRESAYRVYLNEITEYVTTTTRPSGVWQVPMARILGVAQTTLGLGLLVEKITDEAGNIAPTLADLAPQGTMDAALSAQLDEFIEDLADAHVVLHDLTASNIACGQNAEGRSGLFLIDGFGVLPLVPIYAWSKRINRRRIQRKYAEMRAGMAERARKAAQQAGTGGSGPQG
>NZ_LN890477.1|WP_006384053.1|39838_40564_-|DNA-3-methyladenine-glycosylase
MAGKADKASRGAGKALPDAFFNRDARQLARELLGKVVRHRVDGLWLSARIIETEAYYLEEKGSHASLGYTHKRRALFMDGGVVYMYYARGGDSLNFSAGGPGNAVLIKSGYPWVDALSGPEALARMQALNPDAQGRPRLPARLCAGQTLLCRALGLKVPDWDARRFDPDALYVEDVGESPQALISTARLGIPPGRDEHLEYRYVDPAYAAWCTRNPLRRGQVAGRDYHWVDRQGAPLKQAP
>NZ_LN890477.1|WP_006384054.1|40568_40925_-|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein
MKQTTLYGLTKCSTCVKAREWLTAHGVDHQFIDYRDHPVPAATLKEWAGQLGGWEKLVNRASMTWRNLPDDRKTASTDAQWTKLIAEFPALVRRPVAVTPDGEVGVGFSEKRYGERFA
>NZ_LN890477.1|WP_006384055.1|40921_41731_-|ABC-transporter-permease-subunit
MNGPNKTLRAVVLGLGYFFLYVPIISLMVFSFNESPAVTSWTGFSFRWYHSLFNDDALLRAAWLSFRIAAMTATAAVIIGTWAGYVLGRMGRFRGFALYVGMLSAPLVIPEVVLGISLLLMFVELRGHLGWPAENGIFTIWVGHVTLCMAFVAVVIQTRIRDLDRSLEEAALDLGATPITVFFKITLPLIAPALASAWLLSFTLSLDDVVLASFLSGPSSSTLPMEVFSRVRLGLKPEINALATLFILAVGTCVILANRMQWRKESEPK
>NZ_LN890477.1|WP_070780632.1|41727_42648_-|ABC-transporter-permease-subunit
MSRFSPRDWLPSGRALAVVPPFAWLVLFLLVPFLLVFKISFAELKFGIPPYTALAEFKDEAVQFSLHLRGYILLFTDSLYFATYLSSVKIAAITTLACVLIGYPMAYYIARSSPRVRNLLLLGVILPFWTSLLLRVYAWVGILRNDGLLNNFLQWLGIISSPLEIYRTDLAVYIGMVYAYLPFFILPLYATLVKMDLRLLEAAYDLGAKPWQAFWQITVPLSRQGVIAGAMLVFIPAVGEYVIPEMLGGANTLMMGRVMWNEFFNNTDWPMASAVTCVMVLLLLVPLALFQYNQVKQQELANGGRK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN890477_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890477_2

1137560-1137689

Orphan

Consensus_repeat	Method
GCTAGCTGCCCCCCGAGGGGGCGCTTTCCCCTTGGGGCGGCCCGGCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN890477_2

>merge|NZ_LN890477|2|1137560-1137689|CRISPRCasFinder
GCTAGCTGCCCCCCGAGGGGGCGCTTTCCCCTTGGGGCGGCCCGGCGGAGGATTAAGCCCCCACGCCGCGCCCACTGCGTGGGCTAGCTGCCCCCCGAGGGGGCTCTTTCCCCTTGGGGCGGCCCGGCGG

>NZ_LN890477|2|2|1137560-1137689|CRISPRCasFinder
GCTAGCTGCCCCCCGAGGGGGCGCTTTCCCCTTGGGGCGGCCCGGCGG	AGGATTAAGCCCCCACGCCGCGCCCACTGCGTGG
GCTAGCTGCCCCCCGAGGGGGCTCTTTCCCCTTGGGGCGGCCCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890477.1\|WP_054439563.1\|1140678_1141908_+\|spore-maturation-protein	unknown	unknown	gnl\|CDD\|225336
NZ_LN890477.1\|WP_155871626.1\|1150722_1151409_+\|NTP-transferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|133044
NZ_LN890477.1\|WP_020925086.1\|1134952_1135936_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|307807
NZ_LN890477.1\|WP_155871611.1\|1126444_1127899_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|185008
NZ_LN890477.1\|WP_006388863.1\|1129613_1130381_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181325
NZ_LN890477.1\|WP_155871624.1\|1147120_1149514_-\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|224369
NZ_LN890477.1\|WP_155871614.1\|1131563_1133702_+\|glycine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234925
NZ_LN890477.1\|WP_006388854.1\|1137735_1138269_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|237227
NZ_LN890477.1\|WP_024067776.1\|1149682_1150723_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|225719
NZ_LN890477.1\|WP_006388858.1\|1134237_1134966_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_LN890477.1\|WP_155871618.1\|1138256_1140530_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|236528
NZ_LN890477.1\|WP_024067788.1\|1133698_1134238_+\|D-glycero-beta-D-manno-heptose-1,7-bisphosphate-7-phosphatase	unknown	unknown	gnl\|CDD\|236354
NZ_LN890477.1\|WP_047992620.1\|1141984_1143427_-\|pyruvate-kinase	unknown	unknown	gnl\|CDD\|235619
NZ_LN890477.1\|WP_155871620.1\|1143533_1144676_+\|glycerate-kinase	unknown	unknown	gnl\|CDD\|376844
NZ_LN890477.1\|WP_155871622.1\|1144745_1145537_-\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	unknown	unknown	gnl\|CDD\|234708
NZ_LN890477.1\|WP_006388855.1\|1137136_1137532_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|272886
NZ_LN890477.1\|WP_047992622.1\|1145555_1147124_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|236758
NZ_LN890477.1\|WP_006388861.1\|1130651_1131563_+\|glycine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|236473
NZ_LN890477.1\|WP_006388864.1\|1128012_1129536_-\|fumarate-hydratase	unknown	unknown	gnl\|CDD\|224862
NZ_LN890477.1\|WP_155871616.1\|1135988_1137125_+\|2-aminoethylphosphonate--pyruvate-transaminase	unknown	unknown	gnl\|CDD\|184076

Protein	Function_ID	Function_description	E-value
NZ_LN890477.1\|WP_054439563.1\|1140678_1141908_+\|spore-maturation-protein	gnl\|CDD\|225336	COG2715, SpmA, Uncharacterized membrane protein, required for spore maturation in B.subtilis. [General function prediction only].	4.23134e-76
NZ_LN890477.1\|WP_155871626.1\|1150722_1151409_+\|NTP-transferase-domain-containing-protein	gnl\|CDD\|133044	cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family. This is a subfamily of nucleotidyl transferases. Nucleotidyl transferases transfer nucleotides onto phosphosugars. The activated sugars are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Other subfamilies of nucleotidyl transferases include Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase.	9.59189e-82
NZ_LN890477.1\|WP_020925086.1\|1134952_1135936_+\|M48-family-metallopeptidase	gnl\|CDD\|307807	pfam01863, DUF45, Protein of unknown function DUF45. This protein has no known function. Members are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C-terminus being the most conserved region, containing three conserved histidines. This motif is similar to that found in Zinc proteases, suggesting that this family may also be proteases.	5.61683e-74
NZ_LN890477.1\|WP_155871611.1\|1126444_1127899_+\|PAS-domain-S-box-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	1.05545e-49
NZ_LN890477.1\|WP_006388863.1\|1129613_1130381_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181325	PRK08252, PRK08252, crotonase/enoyl-CoA hydratase family protein.	4.50901e-157
NZ_LN890477.1\|WP_155871624.1\|1147120_1149514_-\|LPS-assembly-protein-LptD	gnl\|CDD\|224369	COG1452, Imp, Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane].	2.75044e-136
NZ_LN890477.1\|WP_155871614.1\|1131563_1133702_+\|glycine--tRNA-ligase-subunit-beta	gnl\|CDD\|234925	PRK01233, glyS, glycyl-tRNA synthetase subunit beta; Validated.	0
NZ_LN890477.1\|WP_006388854.1\|1137735_1138269_+\|peptide-deformylase	gnl\|CDD\|237227	PRK12846, PRK12846, peptide deformylase; Reviewed.	5.53299e-92
NZ_LN890477.1\|WP_024067776.1\|1149682_1150723_+\|phosphotransferase	gnl\|CDD\|225719	COG3178, COG3178, Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only].	4.50518e-106
NZ_LN890477.1\|WP_006388858.1\|1134237_1134966_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	1.0899e-48
NZ_LN890477.1\|WP_155871618.1\|1138256_1140530_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|236528	PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed.	0
NZ_LN890477.1\|WP_024067788.1\|1133698_1134238_+\|D-glycero-beta-D-manno-heptose-1,7-bisphosphate-7-phosphatase	gnl\|CDD\|236354	PRK08942, PRK08942, D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.	9.37329e-110
NZ_LN890477.1\|WP_047992620.1\|1141984_1143427_-\|pyruvate-kinase	gnl\|CDD\|235619	PRK05826, PRK05826, pyruvate kinase; Provisional.	0
NZ_LN890477.1\|WP_155871620.1\|1143533_1144676_+\|glycerate-kinase	gnl\|CDD\|376844	pfam02595, Gly_kinase, Glycerate kinase family. This is family of Glycerate kinases.	0
NZ_LN890477.1\|WP_155871622.1\|1144745_1145537_-\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	8.57855e-134
NZ_LN890477.1\|WP_006388855.1\|1137136_1137532_+\|lactoylglutathione-lyase	gnl\|CDD\|272886	TIGR00068, Lactoylglutathione_lyase, lactoylglutathione lyase. Lactoylglutathione lyase is also known as aldoketomutase and glyoxalase I. Glyoxylase I is a homodimer in many species. In some eukaryotes, including yeasts and plants, the orthologous protein carries a tandem duplication, is twice as long, and hits this model twice. [Central intermediary metabolism, Amino sugars, Energy metabolism, Other].	2.65547e-78
NZ_LN890477.1\|WP_047992622.1\|1145555_1147124_-\|peptidylprolyl-isomerase	gnl\|CDD\|236758	PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional.	4.08084e-92
NZ_LN890477.1\|WP_006388861.1\|1130651_1131563_+\|glycine--tRNA-ligase-subunit-alpha	gnl\|CDD\|236473	PRK09348, glyQ, glycyl-tRNA synthetase subunit alpha; Validated.	0
NZ_LN890477.1\|WP_006388864.1\|1128012_1129536_-\|fumarate-hydratase	gnl\|CDD\|224862	COG1951, TtdA, Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain [Energy production and conversion].	1.03444e-139
NZ_LN890477.1\|WP_155871616.1\|1135988_1137125_+\|2-aminoethylphosphonate--pyruvate-transaminase	gnl\|CDD\|184076	PRK13479, PRK13479, 2-aminoethylphosphonate--pyruvate transaminase; Provisional.	2.98742e-125

>NZ_LN890477.1|WP_006388855.1|1137136_1137532_+|lactoylglutathione-lyase
MRMLHTMLRVGNLDKSIDFYTNVLGMRVLRRNDYPDGKFTLAFVGYQDESEGAVIELTHNWDTDKYDLGTGYGHIALEVDNAYEACDKVKERGGKVTREAGPMKHGTTVIAFVEDPDGYKIEFIQKKGRVD
>NZ_LN890477.1|WP_155871616.1|1135988_1137125_+|2-aminoethylphosphonate--pyruvate-transaminase
MLLLIPGPVTTDARVKAAMAQDYAPWDNEFRALYRQVCADVLRVAEADANEHVALALPGCGHFAVEAAIRTLVPPGGRLLVPSTGAYAGRLQKLATEAGRVAVPLYVGARDRVDPLAVAQALEQDPSLTHVALVYSETGSGICHDVPELARIAHSLGRRVIVDAVSAFGALPLDMRALPAVDAVVLTANKCLEGLPGAAFVVGRRDSLEAARGNAGSWSLDLADIYQHTLAPNAGPRFTPPAPTLAALAVALELYHREGREARLARYTANMRALYDGVAGLGLSPYLPPALQGPIVVNVHAPDAPTWNLQLFVDAVKQRGFVLSNFTNTEPPTFRVGCIGAFGPDQMRLAVDAMGGALQDLGITGEPHVQGFPPPLIA
>NZ_LN890477.1|WP_020925086.1|1134952_1135936_+|M48-family-metallopeptidase
MPSTDQLELLFDVQDSDASTDASPLTASPAARPAPVATPPAPLFPPPAPSAPKPAGEPLLTLSPNAAARVPTPCPDPLPPGARWREVDTDPQPIGFVLLRSRRRSIGFVITDDGLRVTAPNWVTLAQIDDAVREKSRWIVAKLREWHTRKQQLAMAHTRWQAGGELPYLGKRIVLGVGGDSRQTRLSGDAEAPADGDTLWLALPADADQGRIRDAAQAWLQQRAGAWFGARLAHFLQISGLKIRRWRLSSAATRWGSCTSDGNIMLNWRLIHFAPAIIDYVIAHELAHLREMNHSQDFWREVGQILPDFEEAKNVLRRHDPASLPQF
>NZ_LN890477.1|WP_006388858.1|1134237_1134966_+|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MARLRSLLYFLFLAITVIPYAFACVLWAPLPLHLRYKLTVGWPRLAIWGAKVFCGIRWQVKGWENLPDGPAVLLSKHQSAWETLFFPAYMPREVCFVYKKELHMVPFFGWGLALLRMIAIDRSKGRDAFEQVVKQGQVRLDEGRWPLLFPEGTRVPPGKTARFKMGGALLASRTGAVVIPVAHNAGECWRRNAFVKYPGLVTLSIGPAIESKGISPEELNQKVQDWIEGEMRRLNPERYAQH
>NZ_LN890477.1|WP_024067788.1|1133698_1134238_+|D-glycero-beta-D-manno-heptose-1,7-bisphosphate-7-phosphatase
MKLIILDRDGVINQDSDAFVKNPDEWIALPGSLQAIARLTQADWTVVVATNQSGLARGLFDMDTLTAIHAKMRRELAAVGGSVDAVFMCPHGPDDDCTCRKPRPGMFEQIGHRYDVNLAGVPAVGDSLRDLQASSAAGCSPWLVLTGNGKKTLAKGGLPENTRVCDDLSAVADALLQDN
>NZ_LN890477.1|WP_155871614.1|1131563_1133702_+|glycine--tRNA-ligase-subunit-beta
MTTNIRPLLVELLTEELPPKALQKLGQAFAEGVRATLARHGLLADGCAVEPYATPRRLAVRLSAVLAQAPDQAYAEKLMPVKIGLTEDGKATPALQKKLAAKGLENIDLATLERESDGKQDYLVARGTAPGAALAVGLQEGIDAAIDGLPIPKVMRYQLADGETTVKFVRPAHGLIALFGADVVPVAALGLTAGRETLGHRYMSSGAIAIADADAYAATLAEKGRVVASFEGRRDEIQRQLLDHAGRLSATLGDDPEVAALLDEVTALVEHPTVYVGEFEEQFLQVPQECLILTMRLNQKYFPLFDPASGRLTHRFLIVSNMRTDNPVNIVEGNQRVVRPRLADAQFFFETDRKTPLAARVEQLGSIVYHNKLGTQLERVERVRAIARDVAGKLGGDVAAADRAALLAKADLGSNMVGEFPELQGIMGAYYAAGDGEPDSVVQALRTQYRNRYDTPVSQDDLTAATLFIAERAETLVGIWAIGLAPTGERDPFGLRRAALGLISAFEQLAAGGWLKLNQDGLLSLDGLLAATAATFPAGKIPADTLAEVRAFIYERYRNQLINEHDRNAVEAVIALAPPLHQVAERVRAAAAFAQMPEAASLAAANKRIGNLLKKAEGEIGAINDAALVEPAEKALAAAIAALRPQAEAQLAAGDFAANLRTLAQAREPVDAFFADVMVMAEDPAVRANRLALLGQLHTLMNQVADISRLAQ
>NZ_LN890477.1|WP_006388861.1|1130651_1131563_+|glycine--tRNA-ligase-subunit-alpha
MLTFQQIILTLQEYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDPTQHDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQDVQSVYDLVWTEGANGRRVLYRDVFHQNEVEQSTYNFEYSSAEMLFAHFNDYEAEAKRLMDVPLALPAYEATLKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYYDSRERLGFPMLGRDKAAGEAA
>NZ_LN890477.1|WP_006388863.1|1129613_1130381_-|crotonase/enoyl-CoA-hydratase-family-protein
MSDLIKVEVADGIQIITINRPEAKNAINLETAQAMAAALDQLDSRDDVRIGILTGAGGTFSSGMDLKAFAKSGQRPYVEGRGFAGLNEAPPKKPLIAAVEGYALAGGCEMALASDLIVAASNAKFGLPEVKRGLVAGAGGMLRLPRRLPYHIAMEVILTGDMLGAERAYGFGLVNRLTEPGGALAGALELARAIVENGPLSVQTAKSIVAQSGDWTQEEMFNRQRPLIAHIFSSADAKEGATAFAEKRKPVWQGK
>NZ_LN890477.1|WP_006388864.1|1128012_1129536_-|fumarate-hydratase
MSVLIKEEDFIQSIADGIQFISYYHPVDYIRHLARAYEREESPAARDAMAQILTNSRMCAEGKRPLCQDTGIVNVFLKVGMGVRFDTKRTLQELCDEGVRRGYLNPDNPLRASVLDDPLFARKNTRDNTPCILHVELVPGDKVDVQLASKGGGSENKSKFAMLNPSDSLVDWVLKTVPTMGAGWCPPGMLGIGVGGTAEKAMLMAKQSLMEDIDMYELLARGPQNKLEELRIELYEKVNALGIGAQGLGGLTTVLDVKINTFPTHAASKPVAMIPNCAATRHAHFELDGSGPARLDPPSLSEWPEVHWAPDYNKSKQVDLNTLTKEEVASWKPGQTLLLSGKMLTGRDAAHKRIQDMLAKGEPLPVDFTNRVIYYVGPVDPVRDEVVGPAGPTTATRMDKFTDMMLEQTGLIAMIGKSERGPVAIESIKKHGSAYLMAVGGAAYLVSKAIRGAKVLGFADLGMEAIYEFDVKDMPVTVAVDAQGTSVHTTGPKEWQARIGKIPVATA
>NZ_LN890477.1|WP_155871611.1|1126444_1127899_+|PAS-domain-S-box-protein
MPATRSFKRLFRRKRDTRNADLYGQIAAIHKAQAVIEFDLDGHVLMANQNFLDAMGYTLDELLGQHHRIFVAPDRRGSPEYQAFWDKLKRGEYDAGRYRRIHKDGSDVWLQASYNPILDESGRPFKVVKYATDVTEQQRRQADTEGQLAAISKVQGIIEFELDGTIIRANDLFLDAMGYREDELRGRHHSMLVLPEEVRSPAYKEFWRKLRGGEYDTGQYLRIGKNGRRVWIEASYNPIFDAEGRPFKVVKFATDITRRFTAAQTLRVAVQGLTENAERASQANTLARDACQVAEEGGKTVAGVVATMGTITESSRRISEIIGVMDGIAFQTNILALNAAVEAARAGPHGKGFAVVAAEVRSLAQNSASAAKEIKDLITTSVQQIGSGAEQVQSAGATMENIVTSSRRVTEIMGEVVEVSLAQSAKLGEVTEDITQMTAEAAHELQSAYEAQDRPEAARETASARAVAPRAPASSQSALEYVRY
>NZ_LN890477.1|WP_006388854.1|1137735_1138269_+|peptide-deformylase
MIHSILKMGDPRLLRVAPPVERFDTPELHALIEDMFETMAAAQGVGLAAPQIGVDLQLVIFGFDRNERYPDAPAVPQTILCNPVITPLSDDMEDGWEGCLSVPGLRGLVPRYRHIRYQGKDPYGRDIDREAEGFHARVVQHECDHLIGRLYPSRIQDFSKFGFTEILFPGMDPNQDD
>NZ_LN890477.1|WP_155871618.1|1138256_1140530_-|acyl-CoA-dehydrogenase
MDFNAWRRRRISEPAYRWARNAMPPLSATEREAIEAGDTWWEADLFTGNPDWRKLLDVPAAALTPDEQRFIDGPVAQLCAMLDEWDITWRRRDLPPEVWSFLKAQRFFGMIIPKRHGGLGFSPYAHSEVVRRISAYSITAGVTVMVPNSLGPGELLMQFGTQAQRDYWLPRLADGREVPCFGLTSPEAGSDAASMVDTGVVCRQVVDGRELIGVRLNWHKRYITLGPVATVLGLAFKMSDPDGILGGGPRDIGISVALVPTDAPGVEIGRRHLPAMQVFQNGPNRGRDVFVPLDALIGGVERAGHGWQMLMSALAAGRGISLPSLSAAACVMSAHATGMYARVREQFGIPVGKFEGVQEKLASLAGNAYLVEAARRLTCAALNQGVKPAVVSGIMKYHATERMRISVNDAMDVHAGRAVIDGPSNYLGALYRAVPIAITVEGANILTRNLIIFGQGAIRAHPYLMPEILALGNPDEERGMEVFHDVFWRHLRHTGMNTLRAIGRAWSGGVLAPSPVSGPTAGHYRRLGRYAAGFALLADAALARLGGGLKRRELLSARLGDILAELYLLSAVLKRWEDEGRKHDDLPLVRWCMEQGYAEIEKRMDQVLSNLPGRPLAWALRAAILPLRLARGPGDALTRECAELLLKPSPTHARLAADLQRSAGGGQGDDDPLALLTRAFAVVDAVQPIRDRLRQSGVRDWREAHRHGAITATQAAQLEEAEAIVSRVLQVDDFAPEELAPGQEPSPAPVPKDDQSS
>NZ_LN890477.1|WP_054439563.1|1140678_1141908_+|spore-maturation-protein
MLNKLWLGFFLTAAAAALYRWLAIGDPDVFRAMVASLFDMARVSVEVMVLLFGTLTLWLGFLRIAEGAGLVEKLARLLGPLFARLMPEVPRNHPAIGLITLNFAANGLGLDNAATPIGLRAMRELQSLNPKPDTASNAQILFLVLNASSLTLLPVTLFMFRAQQGAPDPTLVFLPILLATSASTLAGFLAVAACQRLRLVDPVVMLWLGGAALLLGGFMALLASMSASAIAALSSLMGNLALFGILLAFLIVGACKKVPVYEAFIEGAKEGFDIARSLLPYLVAMLCAVGVLRASGALDFLLDGIRWLAANAGWDTRFVDALPTALVKPFSGSAARAMMLETMTHFGVDSFPALLAAVVQGSTETTFYVLAVYFGSVGILRARHAVGCALVADLAGVLAAIGVCYWFFG
>NZ_LN890477.1|WP_047992620.1|1141984_1143427_-|pyruvate-kinase
MPVLRRTKIVATLGPSTSTPERIDAMIKAGLDVARLNFSHGSADDHRERARLVRESAARQGRFVAIMGDLQGPKIRIARFTDKLVQLQVGQPFTLSRVHPKDAGTASIVGIDYPELVTDCRVGDELLLDDGRVVLVVDSVAGDEVHTTVTVGGPLSNNKGINRRGGGLSAPSLTDKDRVDIKLAAEMQLDYVAVSFPRYGSDIDEARELLRAAGSEAWIIAKIERAEAVADDEALDALIRASDGVMVARGDLGVEVGDAELVGIQKRIIQHARTLNKVVITATQMMESMISSPMPTRAEVSDVANAVLDYTDAVMLSAESASGSYPVETVQAMARVCLGAEKHPTSTQSHHRLGETFTRCDETIALAAMYAANHFPGVKAIIALTESGHTPLIMSRIRSGVPIYCYSPHSVTQNRVTMFRGVYTIPFAPSDYEPADLSNAAIDELKKRNLVKEGDWVILTKGDFYRDSGGTNGMKILLVD
>NZ_LN890477.1|WP_155871620.1|1143533_1144676_+|glycerate-kinase
MKIVIAPDSFKESVSAPDAAAAIARGVKAACPGAHTVCIPMADGGEGTVEAVLAAAGGQARQRTVNDALGHKVDAVWGLLEDGTAVIEMAAAAGLELIAPSRRDPLRASSHGVGELILAALDAGAVRIILGLGGSATNDGGAGMLTALGLRLLDKDGRSLPPGGGALGQLASIDPRGLDSRLANTRIIIASDVDNPLCGPQGASHVFGPQKGATPEQVQTLDTMLGHFADICARQLGSDRRHDAGAGAAGGLGFAAKTFLNADFRPGVEIVAELGGLAQAMEGATLAFTGEGRMDAQTLRGKTPAGVARIAQQAGVPVVALAGSLGDGYEALHAGGISAAFSLAPGPITLQQALADAERLLHDRARDVMQLWMAAQKRML
>NZ_LN890477.1|WP_155871622.1|1144745_1145537_-|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA
MSQHQARKRFGQNFLTDESVVESIVRAVNPARGDTVVEIGPGLSALTRPLLERLDHLTAVEIDRDLAARLRKQFEEGRLTVVEADALTVDFSQFGAGLRVVGNLPYNISSPLLFHLMAWADHVRDQHFMLQREVIDRMVAQPGSGDFSRLSVMLQSRYRMHKLFDVPPEAFDPPPKVVSAIVRMVPLPAERLRPVSARAFESVVARAFSQRRKMLRRVLADWAPQVPWEALDIAPTARAEDISVDRYIRLSDALVEAGVLQGG
>NZ_LN890477.1|WP_047992622.1|1145555_1147124_-|peptidylprolyl-isomerase
MMRRLHSLRRFSGNALLLAVCAAFSAAHAAEPNGKGTKNAPAATQKSAPAPAGEQFVDGIAAVVDKDVITLRELRDASLRIAAELKTRGIQVPDDKALQHQVLQRLIMERVQRHEADRLGIRVTDAQVDQAITTIAGRNKISVAQLRAEIEKSGVSWDSYRKSLMDEIRSDRLRQRAVDSTIVISDAEVDAFLKDQRRNPAFAAAPQQAQPQPQPEAAPEQAAAPAGPMLYAVAQILVRVPEGSSPEQLAALRKKAEDLLARVKRGDDFASLAAASSDGPEALQGGVMGVRPLDGWPDLFAKAIANLQKGQVSGLLQSGNGFHILKVMDRGTAQPAPSRTARAPVPTPAPQPRPQPQAQAPQGPVEVMQTHARHILIKTSTVMSDEQARQRLEQVRQRLVAGDAKFDDMARQYSQDATAPQGGDLGWLNPGETVPPFEAAMNALKPGEISQPIQTPFGWHLIQVEERRQHDATDDLARMKARQTLFERRAQPAFEDWLDQLRAQAYIDNRLEKQDRINQNNR
>NZ_LN890477.1|WP_155871624.1|1147120_1149514_-|LPS-assembly-protein-LptD
MRKVRWLILSAISVAGAVQAQGSQGSASSATSITAAPELRTSPGLRMHRLPDGNIPAYMEADTIEGDPDSDLTLTGAAQVRRIDGVIKGDRINYRKDTGEVDVQGNARMMRDGTLVTGPNAKFNVDKYSGEVEKPNFWLGATGGFAVADKADIFSKSQMRLHTVTYSGCSCETPSWYIKANTVDIDFDENEGVARNGVLYFKDVPILASPYMTFPVKKERKSGFLMPTYGTTSKGGFDFSLPYYLNIAPNYDATLQPRYFSKRGLQLGGEFRYLGASYAGSVYGAYLPHDNVSGEDRWMYWWRHQQLLGNGFYADWDVAKVSDDDYFRDISQLGLNQASTTYLPQRARLGWASTYWSAYAQVYKYQTLQDPDALLTPPYDKQPELYLRGARYDWGGFDLDWTSTAVRFSKPLFLGNRNGPNGDRLQTYPTVSYPIVRPGWFVIPKAGVNYTQYQTDWYNGDWLGLNSGTANAGTSFGYPRSQSRTVPIMSLDAGLIFERDTTLFGKDSIQTLEPRLYYLRVPYRDQSKIPVYDTSLSDFSFSQAFDENIYSGGWDRISNANQLTAALTTRWLDASTGFERASVAVAQRLYFADQKVTLPGETPRENVRSDFLVGASAALTDTLTTDVAAQYNPYDNQWSRGLLSARWSPQRLTTVALAYRYQRDPQPGVLYQPQGQNQISLAVQWPFTKRWYGVGRVDYSLRNGPSSTVNGTTDSPRVTQAIAGLEYKGDCCWVGRMVFQRYAVSATDANTALFFQLELTGLGSLGTDPMNLLNRSIPGYSRITPPAPTGTTFERYE
>NZ_LN890477.1|WP_024067776.1|1149682_1150723_+|phosphotransferase
MKNDHDPRLEQIRAWLQGLPAALGLAVDTLRPASADASFRRYFRLDAAGRTLIVMDAPPQHEDCRPFLHVDQLLSDAGLNVPAVIEQDLAQGLLLLSDLGEQTYYQRIQDGVDDASLQSMYRDALAALVRLQQARTTGLAHYDSARLADELKLFPEWYVQKHHGATLDDKTAQALEKIFALLSASNGNQPTVLVHRDYHSPNLMVCDQPQYGPNPGVIDFQDALAGPITYDLASLVTDARTTWEEPQQLDWAIRYWEMARAAGLPVDADFAEFHRAYEWMGLQRNLRILGVFARLNHRDGKAHYLAHMPRVNGYVRQVAQRYGVFTPLLRLLDRLDDRQVSVGYTF
>NZ_LN890477.1|WP_155871626.1|1150722_1151409_+|NTP-transferase-domain-containing-protein
MRAMILAAGRGERMRPLTDRLPKPLLPVGGKPLIAWHLERLAAAGFRDVVINHAWLGHEIEGALADGAAFGLRIRYSPEAAALETAGGIAQALPLLGPDPFLVINGDIWCDWNPAAAPALATALPTGGAWLLMVDNPPQHPLGDFALDRDGRVRADGEPRLTFSGIGVYHPMLFAGVARGTAARLAPLLRQAMEHDHVRGARHTGRWVDVGTPQRLADLDAELGSSPV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN890477_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890477_3

1603531-1603625

Orphan

Consensus_repeat	Method
GCGATGCCGCCCGCCATGGACCATTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN890477_3

>merge|NZ_LN890477|3|1603531-1603625|CRISPRCasFinder
GCGATGCCGCCCGCCATGGACCATTCCTCCATGCCCGGCATGAGCCACGGCAGCACCAAGCCAAAGCCAGCGATGCCGCCCGCCATGGATCATTC

>NZ_LN890477|3|3|1603531-1603625|CRISPRCasFinder
GCGATGCCGCCCGCCATGGACCATTC	CTCCATGCCCGGCATGAGCCACGGCAGCACCAAGCCAAAGCCA
GCGATGCCGCCCGCCATGGATCATTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890477.1\|WP_006386852.1\|1613476_1613908_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319945
NZ_LN890477.1\|WP_155871762.1\|1601535_1603350_+\|copper-resistance-system-multicopper-oxidase	unknown	unknown	gnl\|CDD\|273649
NZ_LN890477.1\|WP_047993025.1\|1606402_1606927_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|182018
NZ_LN890477.1\|WP_054499567.1\|1612459_1613335_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176118
NZ_LN890477.1\|WP_006386863.1\|1595843_1596620_-\|bifunctional-demethylmenaquinone-methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol-methylase-UbiE	unknown	unknown	gnl\|CDD\|234689
NZ_LN890477.1\|WP_150101965.1\|1611778_1612387_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|372434
NZ_LN890477.1\|WP_155871766.1\|1606926_1607940_+\|FecR-domain-containing-protein	unknown	unknown	gnl\|CDD\|236622
NZ_LN890477.1\|WP_006386861.1\|1597492_1598800_+\|phosphate-regulon-sensor-histidine-kinase-PhoR	unknown	unknown	gnl\|CDD\|274368
NZ_LN890477.1\|WP_006386855.1\|1605023_1606223_+\|phosphoglycerate-dehydrogenase	unknown	unknown	gnl\|CDD\|236985
NZ_LN890477.1\|WP_020925380.1\|1601022_1601517_+\|cupredoxin-family-protein	unknown	unknown	gnl\|CDD\|259873
NZ_LN890477.1\|WP_006386860.1\|1598864_1599551_+\|heavy-metal-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|130454
NZ_LN890477.1\|WP_155871770.1\|1610571_1611747_+\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|377164
NZ_LN890477.1\|WP_026381992.1\|1599547_1600948_+\|heavy-metal-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|273593
NZ_LN890477.1\|WP_020925378.1\|1594667_1595666_-\|Tim44-domain-containing-protein	unknown	unknown	gnl\|CDD\|214950
NZ_LN890477.1\|WP_155871760.1\|1592277_1593831_-\|ubiquinone-biosynthesis-regulatory-protein-kinase-UbiB	unknown	unknown	gnl\|CDD\|235310
NZ_LN890477.1\|WP_049053064.1\|1613932_1614667_+\|5-oxoprolinase-subunit-PxpB	unknown	unknown	gnl\|CDD\|367142
NZ_LN890477.1\|WP_006386856.1\|1604400_1604877_+\|DUF411-domain-containing-protein	unknown	unknown	gnl\|CDD\|225564
NZ_LN890477.1\|WP_006386862.1\|1596781_1597480_+\|phosphate-regulon-transcriptional-regulator-PhoB	unknown	unknown	gnl\|CDD\|131209
NZ_LN890477.1\|WP_024067599.1\|1593834_1594473_-\|SCP2-sterol-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225706
NZ_LN890477.1\|WP_155871768.1\|1608190_1610572_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805

Protein	Function_ID	Function_description	E-value
NZ_LN890477.1\|WP_006386852.1\|1613476_1613908_+\|VOC-family-protein	gnl\|CDD\|319945	cd08357, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) familyprotein, glyoxalase I, and type I ring-cleaving dioxygenases. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	2.46103e-72
NZ_LN890477.1\|WP_155871762.1\|1601535_1603350_+\|copper-resistance-system-multicopper-oxidase	gnl\|CDD\|273649	TIGR01480, unnamed_protein_product, copper-resistance protein, CopA family. This model represents the CopA copper resistance protein family. CopA is related to laccase (benzenediol:oxygen oxidoreductase) and L-ascorbate oxidase, both copper-containing enzymes. Most members have a typical TAT (twin-arginine translocation) signal sequence with an Arg-Arg pair. Twin-arginine translocation is observed for a large number of periplasmic proteins that cross the inner membrane with metal-containing cofactors already bound. The combination of copper-binding sites and TAT translocation motif suggests a mechansism of resistance by packaging and export. [Cellular processes, Detoxification, Transport and binding proteins, Cations and iron carrying compounds].	0
NZ_LN890477.1\|WP_047993025.1\|1606402_1606927_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|182018	PRK09651, PRK09651, RNA polymerase sigma factor FecI; Provisional.	6.31418e-42
NZ_LN890477.1\|WP_054499567.1\|1612459_1613335_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176118	cd08427, PBP2_LTTR_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.28795e-71
NZ_LN890477.1\|WP_006386863.1\|1595843_1596620_-\|bifunctional-demethylmenaquinone-methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol-methylase-UbiE	gnl\|CDD\|234689	PRK00216, ubiE, bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE.	7.29121e-131
NZ_LN890477.1\|WP_150101965.1\|1611778_1612387_-\|HD-domain-containing-protein	gnl\|CDD\|372434	pfam13023, HD_3, HD domain. HD domains are metal dependent phosphohydrolases.	8.49136e-70
NZ_LN890477.1\|WP_155871766.1\|1606926_1607940_+\|FecR-domain-containing-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	2.37393e-72
NZ_LN890477.1\|WP_006386861.1\|1597492_1598800_+\|phosphate-regulon-sensor-histidine-kinase-PhoR	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	4.62285e-157
NZ_LN890477.1\|WP_006386855.1\|1605023_1606223_+\|phosphoglycerate-dehydrogenase	gnl\|CDD\|236985	PRK11790, PRK11790, phosphoglycerate dehydrogenase.	0
NZ_LN890477.1\|WP_020925380.1\|1601022_1601517_+\|cupredoxin-family-protein	gnl\|CDD\|259873	cd04211, Cupredoxin_like_2, Uncharacterized Cupredoxin-like subfamily. Cupredoxins contain type I copper centers and are involved in inter-molecular electron transfer reactions. Cupredoxins are blue copper proteins because they have an intense blue color due to the presence of a mononuclear type 1 (T1) copper site. Structurally, the cupredoxin-like fold consists of a beta-sandwich with 7 strands in 2 beta-sheets, which is arranged in a Greek-key beta-barrel. Some of these proteins have lost the ability to bind copper. Majority of family members contain multiple cupredoxin domain repeats; ceruloplasmin and coagulation factors V/VIII have six repeats; Laccase, ascorbate oxidase, and spore coat protein A, and multicopper oxidase CueO contain three repeats; and nitrite reductase has two repeats. Others are mono-domain cupredoxins, such as plastocyanin, pseudoazurin, plantacyanin, azurin, rusticyanin, stellacyanin, quinol oxidase and the periplasmic domain of cytochrome c oxidase subunit II.	8.22589e-56
NZ_LN890477.1\|WP_006386860.1\|1598864_1599551_+\|heavy-metal-response-regulator-transcription-factor	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	5.39101e-109
NZ_LN890477.1\|WP_155871770.1\|1610571_1611747_+\|PepSY-domain-containing-protein	gnl\|CDD\|377164	pfam03929, PepSY_TM, PepSY-associated TM region. The PepSY_TM family is so named because it is an alignment of up to five transmembranes helices found in bacterial species some of which carry a nested PepSY domain, pfam03413.	7.08654e-46
NZ_LN890477.1\|WP_026381992.1\|1599547_1600948_+\|heavy-metal-sensor-histidine-kinase	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	1.66876e-115
NZ_LN890477.1\|WP_020925378.1\|1594667_1595666_-\|Tim44-domain-containing-protein	gnl\|CDD\|214950	smart00978, Tim44, Tim44 is an essential component of the machinery that mediates the translocation of nuclear-encoded proteins across the mitochondrial inner membrane. Tim44 is thought to bind phospholipids of the mitochondrial inner membrane both by electrostatic interactions and by penetrating the polar head group region.	4.03066e-27
NZ_LN890477.1\|WP_155871760.1\|1592277_1593831_-\|ubiquinone-biosynthesis-regulatory-protein-kinase-UbiB	gnl\|CDD\|235310	PRK04750, ubiB, putative ubiquinone biosynthesis protein UbiB; Reviewed.	0
NZ_LN890477.1\|WP_049053064.1\|1613932_1614667_+\|5-oxoprolinase-subunit-PxpB	gnl\|CDD\|367142	pfam02682, CT_C_D, Carboxyltransferase domain, subdomain C and D. Urea carboxylase (UC) catalyzes a two-step, ATP- and biotin-dependent carboxylation reaction of urea. It is composed of biotin carboxylase (BC), carboxyltransferase (CT), and biotin carboxyl carrier protein (BCCP) domains. The CT domain of UC consists of four subdomains, named A, B, C and D. This domain covers the C and D subdomains of the CT domain. This domain covers the whole length of kipI (kinase A inhibitor) from Bacillus subtilis. It can also be found in S. cerevisiae urea amidolyase Dur1,2, which is a multifunctional biotin-dependent enzyme with domains for urea carboxylase and allophanate (urea carboxylate) hydrolase activity.	1.80472e-88
NZ_LN890477.1\|WP_006386856.1\|1604400_1604877_+\|DUF411-domain-containing-protein	gnl\|CDD\|225564	COG3019, COG3019, Predicted metal-binding protein [General function prediction only].	1.1634e-51
NZ_LN890477.1\|WP_006386862.1\|1596781_1597480_+\|phosphate-regulon-transcriptional-regulator-PhoB	gnl\|CDD\|131209	TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB. PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	7.41786e-143
NZ_LN890477.1\|WP_024067599.1\|1593834_1594473_-\|SCP2-sterol-binding-domain-containing-protein	gnl\|CDD\|225706	COG3165, COG3165, Uncharacterized protein conserved in bacteria [Function unknown].	4.25521e-22
NZ_LN890477.1\|WP_155871768.1\|1608190_1610572_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	3.78695e-93

>NZ_LN890477.1|WP_155871762.1|1601535_1603350_+|copper-resistance-system-multicopper-oxidase
MKTFPIPTRRRFVQGLAAGGALAALGGWRAASAGWRAASAGPRAAQAAAAPAELRGTEFHLEIGETPVNYTGAARIATTVNGQVPAPLLRWREGDTVTLHVTNRLREQTSIHWHGILLPTEMDGVPGLSFPGIDPGQTFTYRFDVRQSGTYWYHSHSGFQEQTGLYGAIVIDPKRPDPIAADRDYTVLLSDWTDEDPMRVFDKLKAMPDYYNRNQPSVESLIREAGEKGWRTALSERLMWEQMRMNPSDLADVSGATYTFLTNGATPAGNWTGLFKPGERVRLRFINGSAMTYFDVRIPGLKMTVVAADGQDVRPVDVEEFRIAVAETYDVIVEPAEDRAYTIFSQAMDRSGYARATLAPRPGMQAEVPAVDRVQLLGMMDMGMKHDMGGMDHGAAPEATAGAMAGMNHGAMPGMDHGSSHGGGAAQGGIVEVRHPYPEERGPGNSMLPDVVSTRLDDPGIGLRDNGRRVLTYADLRSIREPDDNRAPTREIELHLTGNMERYMWSFNGVKFSDAKPIVLRYGERVRFVLVNDTMMTHPIHLHGLWSDLESPDGAFQVRKHTLSLNPAQRLSYRVSADARGNWAYHCHLLYHMEAGMFRAVMVE
>NZ_LN890477.1|WP_020925380.1|1601022_1601517_+|cupredoxin-family-protein
MKGTLLRITQITALAALLGTGTAFAAGAHGEHAGHAMPAASAPIGTPGDAARVTRSIDIDMTDAMRFTPAQVQVKAGETVRFNVRNSGRIRHEMVLGTDADLQAHYAMMMKDPGMRHEEANAISLEGGKSGQIVWKFDRAGTVSFGCLEPGHYTAGMKGAVSVQ
>NZ_LN890477.1|WP_026381992.1|1599547_1600948_+|heavy-metal-sensor-histidine-kinase
MKPPRVRSMQARLTLLLGAIALLVSSLAGATLFWALKREVERQEITEVSGKLELINHLIDMQNNARGLHDLAATFDDMRAGQSQLGIWIVDAQGHPVYGGAIPETLQVLPDRQVLLQQADGSRLRGLRVAVDDRILPGAQLTVAVSTRTSSQFLYAYGTALALICALWVGATVVLAAWAVRRSMAPTRRLSEQAARIQPDNLAVRLPLRDTDRELHELVLSFNRTLERLQAAYQQMEGFNADVAHELRTPLATLINGTQVTLSSGRDAAELRDALESNLETLEDLKTLVNDMLFLARADRGERAADLAPVSLAAEARRVADFYEAALEDRGVTLRCDGDAIVAANPGLVRRALANLISNAIKATPRGGEIVLACQPRPAGARVEVRNPGAPIPAADLPRIFDRFFRSGQARAPRSEGHGLGLAIVRAIARMHGGEVDAASGADGTVVGITLRGSGPDTADGHITKK
>NZ_LN890477.1|WP_006386860.1|1598864_1599551_+|heavy-metal-response-regulator-transcription-factor
MRILVIEDEPKLADYLKKGLSEQSHVVDLARDGVNGLHLALEGAYDLIVLDVMLPGVDGFGILAAVRANKDTPILMLTARDAVEDRVRGLEGGADDYLIKPFAFSELLARVQALLRRGRSQEPTVFRLADLELDLARRKVARGGRRLDLTAKEFNLLALLLRRQGQVLSRTTLAEQVWDMNFDSDTNVIDVAVRRLRSKLDDPFEAKLLHTVRGMGYVLESRPEPARG
>NZ_LN890477.1|WP_006386861.1|1597492_1598800_+|phosphate-regulon-sensor-histidine-kinase-PhoR
MIWLRTLILVALWAAIALLAQWLIGDPAGWVLFSAALVVMLLWRSWRLHLVSHWARHPDTSPPASVGPWDDILAPLYRYTRARARELAETRDTMQGMLAAAQALPDGAVTLNEDFQIDWCNRMARQHLGLRLPADRGHNLLNLLRAPEFVEYAHRASWPDPILVRLGQNGQERLMMMQLTAYASNQRLLITRDVTQIERLETTRRDFVANVSHELRTPLTVLAGFLETLRDMPADALPPEQRAQYLDMMHEQAQRMQAIVEDLLTLSTLESSPGSDPRAVNMGALLQKARQQIEALSGGRHVIEWHIDETVDVLGAETELTSALSNLLTNAVRYTPDGGTITVRWEREADGGGRYSVQDTGIGIPARHIPRLTERFYRVDRGRSRAVGGTGLGLAITKHIAMRHDAELLISSEPGKGSLFALRFPPDRIAVDPSA
>NZ_LN890477.1|WP_006386862.1|1596781_1597480_+|phosphate-regulon-transcriptional-regulator-PhoB
MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDADQAQTLIRAELPDLILLDWMLPGTSGLAMARKLRNDERTRAVPVIMLTAKGSEQDKVDGLEAGADDYITKPFSPKELMARIKAVLRRRAPQLTDDVIDVGGLKLDPVTHRLSGNSQSLQIGPTEFRLLHFFMTHPERVFSRSQLLDQVWGDHVFVEERTVDVHIRRLRKALEPSGHDAHVETVRGSGYRFTAQVPAR
>NZ_LN890477.1|WP_006386863.1|1595843_1596620_-|bifunctional-demethylmenaquinone-methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol-methylase-UbiE
MQNPSESQHSADSASQSTHFGFQSVPESEKARKVAEVFHSVAQRYDIMNDFMSAGLHRVWKAFTIGRAAIRPGMKVLDIAGGTGDLAKAFAKRAGPTGEVWLTDINDSMLRVGRDRLADAGQLVPTAVCDAERLPFPTGYFDRVSVAFGLRNMTHKDRALAEMTRVLKPGGKLLVLEFSRIAKPLAPAYDWYSFNVLPWLGKTVAKDEASYRYLAESIRMHPDQETLADMLRTAGLERVQYFNLTAGIAALHEGVRLA
>NZ_LN890477.1|WP_020925378.1|1594667_1595666_-|Tim44-domain-containing-protein
MTKFCFSRFVAAALIAISGAALVTASFDAEARRAGGGSSVGRQSSNVTQQRQATTPPTAASNTAGATAAPAAAGAATAGAAGAAAKSGASRWLGPIAGIAAGLGIAALLSSMGLSGAFAEFLSSALLIALVVFAVMFIIRRLRGAAPRPATQGAFGGANNAPGQPQQQPMWREALKPTAPAAAPAAAAAAPAAVLPKAGDDNNWFVPGDFDTPNFLKQAKEQFVRIQAVWDSGSTDRLRDYLTDDLITELKPQLAERGAAPNKTEVVLLNAELLGIETVSDGHLASVRFSGMLRETPGAEAFRFEEVWNLFKPANGGWLLAGIQQIPVEYAS
>NZ_LN890477.1|WP_024067599.1|1593834_1594473_-|SCP2-sterol-binding-domain-containing-protein
MSPFSFLPTPARLAVGALNALLKREDWARERLARHAGKTVRFALGGFTLGLTIDSEGLAAQADAAVVPDVTLTVAPERLPLPRLGAGGETPDFAEATHISGDAALAQVVADLSKQLRWDPEDSLARLVGDIPALRIVGGLRAATGGARQAGQRLAENVSEYLAEENGMLLGRPALEQWRLDLAELNARADALARSAAALQSRLATAAGKRGA
>NZ_LN890477.1|WP_155871760.1|1592277_1593831_-|ubiquinone-biosynthesis-regulatory-protein-kinase-UbiB
MFPLLRLFRIILVSLRYGLDELVLSSLNHPLATCLLRVIRLGTRPRKPRGLRLRLALESLGPIFVKFGQVLSTRRDLIPADIANELALLQDRVPPFPSAQAAACIEAALGAPPEKLFAQFQVDPVASASIAQVHFAVLHDGREVAVKVLRPGMLSIIEKDLSLLRIVARIIERLGADGRRLKPREVVAEFDKYLHDELDLVREASNCSQLRRNFGPESGRGDMLMVPEVIWEYTASTVFTMQRMYGVPVGQVERMRAAGIDIPTLARTGVEIFFTQVFTDGFFHADMHPGNIYVSDRPETLGSYIALDFGIVGSLSEFDKNYLAQNFLAFFHRDYRRVAQLHIESGWVPPDTREEELEGAVRAVCEPYFDRPLSEISLGQVLLRLFQTSRRFNVEIQPQLVLLQKTLLNVEGLGRQLDPNLDLWKTAKPYLERWMRQRVGIKGLRQSLEKEAAQWSQMLPALPRLVHDHLNRPNLSPALLAEMAQLRRAQEQNNRLVAALVGVLALGIGVALWALTR
>NZ_LN890477.1|WP_006386856.1|1604400_1604877_+|DUF411-domain-containing-protein
MKTPLIPARRLLLAAALSLPLYAAPILAQAQSAPKVQVWKTPTCGCCEDWVKHMRDNGFEVTTHDVQDTGPVRRNAGMADYGSCHTAVVDGYAIEGHVPASDVRRLLLEKPDAAGLAAPGMPLGSPGMDGPEYGGRKTPHDVLLVDKRGGAKVFQAYR
>NZ_LN890477.1|WP_006386855.1|1605023_1606223_+|phosphoglycerate-dehydrogenase
MAHIVLFENIHPSARAVFEAAGYTDIVTHAAALPPAQLQDALRGAQVAGIRSRTHLDAALLSGNPDLRVVGCFCIGTNQVDLDTAMQRGIPVFNAPFSNTRSVAELVLGEAILLLRRIPEKNARVHLGHWDKSAAGAFETRGKTLGIVGYGNIGSQISTLAEGLGMRVIYHDVEAKLPLGNARPAGSLNDLLEQADVVTLHVPGGKSTENIMNAETIARMRRGAILINASRGTVVDIDALHAALKSGHLAGAALDVFPTEPKGADEPLASPLIGLPNVILTPHIGGSTQESQENIGREVAEKLVRFLQAGTTKGAVNFPELPYLEQAGATRILHVHRNAPGALGTLDNLMAQHGLNIVSQTLQTKGQIGYVITDVDGEVDDLVMTTLRDHPITVRCDRL
>NZ_LN890477.1|WP_047993025.1|1606402_1606927_+|sigma-70-family-RNA-polymerase-sigma-factor
MSAADLPVQQDLHALYSDHHGWLLGWLRRRLGNAADAADLAHDAFLRLIVRPAPDGFASAGAARAYLRTMAQGLCTDLWRRRQVEQAWLDSLAAQPEAYAPSPEHQALVIETLLEVGEWLGRLPGKTRTAFIQAQIHGLSSREIADQMGVSLRMVQKYLAQAMLHLALIDAGLN
>NZ_LN890477.1|WP_155871766.1|1606926_1607940_+|FecR-domain-containing-protein
MAAPRPAVTSGLSQADYESLKVAAEWYARLQNADIDARQRLAWQHWFDARPEHRSAWAHVEAVSRRFAVLRVDGERDAAEQAVQIASHRPSARRRAASRILALGGVGMLGWLGWLGWRFTPLPAVVTAWRSDYATGIGEQRQLVLDDGTRVWLNTRSAINVRLDETQRLLTLTGGEILTDTAKDARQRPFFVDTRFGRLQALGTRYTVRQEDHDILLAVYEGQVRIRTLSGQETLVRGGEQKRYTANTISEAAPADPAREAWSRGVILAENLPLDDLVAELGRYHVGHTGVDPRIAGLRVVGRYPASDLPRTLSMLERELPIRIQRTSPWWTTLEPK
>NZ_LN890477.1|WP_155871768.1|1608190_1610572_+|TonB-dependent-siderophore-receptor
MNRVLRETVLGTLLMTALAPAAHAQDAARAVSATHAYDVPAGPLAGALSRFAEQANILLSVPADMTAGKTSPGVRGAHSVDSAFRVLLANTGLEAVRRAEGGYALRPAPATSATILPAVVVSGASASALPEAYAGGEVARGARIGLLGNRDFLDTPFSATSYTAKLIEDQQAQNIGDVLVNDPSVRNTYSRGAGRDEFNVRGFTLFNYDVAYNGLYGISPRNATSLIGIERVEVLRGPNALLNGMAPFGSIGGSINLVPKRAGDEPLNRMTLSYIENNQFGAQADIARRFGEDDRTGVRLNVLRSGGDMNISGAGEDLGAVSLGLDYRGNRLRIDGDINYQNRVTDARSGLLFPPGGGQEIGQAPDPKRNFFPDWTYWKAKEWSGDVRAEYDLSDDWTVYGALGARKHDFESLQTTWLMLDSAGRIGSVPARLNERLLSKTGEVGIRGRFDTGPVKHEPTLSASFLDIDYSSARVRSSTVFSDLYDPVDLAKPNIAKPTDLGKTSETRLYSVALADTLSVMDGAVQLTAGLRQQRVQSVNYNPATGDRTSDYGKSAVTPAIALVVKPTHRLSLYGNYIEGLSQGGTAPAEAVNAGETFKPDVSKQYEIGAKYDFGTVAATLSAFQIEQPSAYVDPDTLRYQADGRQRNRGVEFLLQGELMPRVRLLGGVAYTNGVLTKTEGGLNDGRAAPAVPRWQFNAAAEWDTPFVQGLTLTARMLRTSTQYVDAANTQQLPGWTRFDVGARYAMNINRTPVTLRATVENVFNKHYWQSAAREGLTVAAPRTLLLSVTAEF
>NZ_LN890477.1|WP_155871770.1|1610571_1611747_+|PepSY-domain-containing-protein
MRPQARATPGARPPASSSRRAPAGRGKAWYRIHKWSSLACTLFLLVVCLSGLPLIFDEEIVTWLDPSPPWSTLAPGTPAPSLDAIIAAARARHRAHRVVDVEVLRDPPRITLGLAPGPQAAAWTPSLRLEFDARDGSPRAAIADSDEGLGSRIVTLMTRLHIDLYGGLPGQLFLGAMALLFSLAVISGVALYHPYMKKLPFGTVRVHRARRLKWLDLHNLLGIVTVVWALMMGLTGALHELAVPFFRHWLSTEVQVAISPRIDTPPASATAWASVQQAYATARAAVPGKQVESLRFPDSSLGLPRHYLLWAKGDTALGAHLFDAVLVDAPTGKLTAVPDMPWYLRALQFSRPLHYGDTAGLPLKLIWAALDLVVIVILGSGLYLWRRRAGQ
>NZ_LN890477.1|WP_150101965.1|1611778_1612387_-|HD-domain-containing-protein
MASTSLEKQLQFLREIDRLKTVVRQSPLLDRSRKENSAEHSWHLALYALVLSEYASGPVDTQRVMRMLLLHDVVEIDVGDFPIHGGSSAAWQAEQEDKAAQRLFGLLPSPQGDEFLALWREFEQAESEDARFAKALDRFQPLLINVFTGGGTWTENGVSREQVLARYGPVIQRGAPKLWEVCERWVAAHFAGVSLAAPDAVD
>NZ_LN890477.1|WP_054499567.1|1612459_1613335_-|LysR-family-transcriptional-regulator
MIKEFKTFIAVARDGTFTGAGAQLGLTQSAVSAQIKRLEDYLGVALFDRSARAAVLNDHGREMLPQAEELVAMAERMASSAGAGHVSGSLRIGAIASVQQDLLVRALGEFRAGYPDVRVRIVPGVSLSLLGQVDAGEVDMALLIRPPFALPPELGWQPLLREEVVLAMPAAMALAPWREVLAAQPFIRYDRASFGGRVVDLFLKKQRITVHEAVELDEIEAIANMVRHGLGVALLPRLRGLDTDGLRLVPLGDAAFHREIGLIGRLPFDAGSVRGKMAECLARAAGAALAP
>NZ_LN890477.1|WP_006386852.1|1613476_1613908_+|VOC-family-protein
MTAQTNLPPFHLAFPVRDLAEARAFYGEKLGCPEGRSSPEWIDFNFYGHQIVAHLAPSECGHKATSAVDSHNVPVRHFGAVLSMEQWEAMAKRLTDAGTEFVIEPYIRFKGEVGEQATMFFLDPSGNALEFKAFKNLDSLFAK
>NZ_LN890477.1|WP_049053064.1|1613932_1614667_+|5-oxoprolinase-subunit-PxpB
MNATPDPSSSAEATWRIQPQGDRCLIVSFGDRIDAAVGRTCLAAARKLRDAGLPGVTDVVPSFVAVAVHYRPDGLGHGPTYADLAERIEALLADGIAADNAAGREVDVPVCYGGEHGPDLDEVARAAGLTPDEVIALHSGPRSMVFMLGFAPGHAYLGVHDEKLNLPRRPSPRTAVPAGAVAIANRQTVIYPNRLPGGWHIIGTTPLTMFDPAREPAAYLQPGDSVRFVPISADEFARLRGNRP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN890477_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890477_4

3229980-3230056

Orphan

Consensus_repeat	Method
CCGACGGTGGCCTGGCGGCCGAA	CRISPRCasFinder

1 spacers

csa3,WYL

The CRISPR arrays of NZ_LN890477_4

>merge|NZ_LN890477|4|3229980-3230056|CRISPRCasFinder
CCGACGGTGGCCTGGCGGCCGAATTCGATCGTGCCCCAGGCGTCGTTGGCCAGTCCGATGGTGGCCTGGCGGCCGAA

>NZ_LN890477|4|4|3229980-3230056|CRISPRCasFinder
CCGACGGTGGCCTGGCGGCCGAA	TTCGATCGTGCCCCAGGCGTCGTTGGCCAGT
CCGATGGTGGCCTGGCGGCCGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890477.1\|WP_020926523.1\|3241210_3242110_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182228
NZ_LN890477.1\|WP_054507825.1\|3232102_3232894_-\|SURF1-family-protein	unknown	unknown	gnl\|CDD\|225883
NZ_LN890477.1\|WP_020926507.1\|3222865_3223231_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890477.1\|WP_026384122.1\|3226458_3227157_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238089
NZ_LN890477.1\|WP_049050733.1\|3239722_3241051_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|99735
NZ_LN890477.1\|WP_006387370.1\|3237270_3238605_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_LN890477.1\|WP_035183065.1\|3236002_3237046_-\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_LN890477.1\|WP_155872360.1\|3227195_3228362_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_LN890477.1\|WP_026384126.1\|3233293_3233935_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|131889
NZ_LN890477.1\|WP_155872362.1\|3230614_3231811_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_LN890477.1\|WP_006384571.1\|3222245_3222689_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890477.1\|WP_155872366.1\|3238661_3239678_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270410
NZ_LN890477.1\|WP_026384121.1\|3224993_3226319_-\|chromosome-partitioning-protein-ParB	unknown	unknown	gnl\|CDD\|319249
NZ_LN890477.1\|WP_155872364.1\|3233927_3235931_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_LN890477.1\|WP_054445762.1\|3221387_3222185_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890477.1\|WP_054437620.1\|3223250_3224255_-\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_LN890477.1\|WP_054505206.1\|3228452_3229241_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_LN890477.1\|WP_006387357.1\|3224371_3224980_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
NZ_LN890477.1\|WP_006387366.1\|3232898_3233297_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|225667
NZ_LN890477.1\|WP_155872358.1\|3220315_3220966_-\|response-regulator	unknown	unknown	gnl\|CDD\|182771

Protein	Function_ID	Function_description	E-value
NZ_LN890477.1\|WP_054507825.1\|3232102_3232894_-\|SURF1-family-protein	gnl\|CDD\|225883	COG3346, COG3346, Uncharacterized conserved protein [Function unknown].	3.34225e-77
NZ_LN890477.1\|WP_155872362.1\|3230614_3231811_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	1.13907e-63
NZ_LN890477.1\|WP_026384122.1\|3226458_3227157_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	1.21657e-21
NZ_LN890477.1\|WP_020926523.1\|3241210_3242110_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182228	PRK10082, PRK10082, hypochlorite stress DNA-binding transcriptional regulator HypT.	9.9853e-28
NZ_LN890477.1\|WP_006387370.1\|3237270_3238605_+\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.22848e-87
NZ_LN890477.1\|WP_035183065.1\|3236002_3237046_-\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	2.35645e-130
NZ_LN890477.1\|WP_155872360.1\|3227195_3228362_-\|MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.69768e-69
NZ_LN890477.1\|WP_026384126.1\|3233293_3233935_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|131889	TIGR02842, Cytochrome_bo3_ubiquinol_oxidase_subunit_3, cytochrome o ubiquinol oxidase, subunit III. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	1.79368e-104
NZ_LN890477.1\|WP_054437620.1\|3223250_3224255_-\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	4.97394e-50
NZ_LN890477.1\|WP_049050733.1\|3239722_3241051_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|99735	cd00610, OAT_like, Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase, alanine-glyoxylate aminotransferase, dialkylglycine decarboxylase, 4-aminobutyrate aminotransferase, beta-alanine-pyruvate aminotransferase, adenosylmethionine-8-amino-7-oxononanoate aminotransferase, and glutamate-1-semialdehyde 2,1-aminomutase. All the enzymes belonging to this family act on basic amino acids and their derivatives are involved in transamination or decarboxylation.	1.1854e-133
NZ_LN890477.1\|WP_026384121.1\|3224993_3226319_-\|chromosome-partitioning-protein-ParB	gnl\|CDD\|319249	cd16390, ParB_N_Srx_like, uncharacterized family distantly related to the N-terminal domain of the ParB/Srx superfamily. Uncharacterized proteins distantly related to the N-terminal domain of the ParB superfamily, primarily involved in bacterial and plasmid parABS-related partitioning systems. A small minority of proteins in this family include a C-terminal inorganic pyrophosphatase domain. Also within the ParB superfamily is sulfiredoxin (Srx), which is a reactivator of oxidatively inactivated 2-cys peroxiredoxins. Other families includes a putative regulator in the biosynthetic gene cluster and a family containing a Pyrococcus furiosus nuclease and putative transcriptional regulators SbnI (Staphylococcus aureus siderophore biosynthetic gene cluster ) and EdeB (Brevibacillus brevis antimicrobial peptide edeine biosynthetic cluster). Nuclease activity has also been reported in Arabidopsis Srx.	2.98344e-59
NZ_LN890477.1\|WP_155872364.1\|3233927_3235931_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_LN890477.1\|WP_155872366.1\|3238661_3239678_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270410	cd13692, PBP2_BztA, Substrate bindng domain of ABC glutamate/glutamine/aspartate/asparagine transporter; the type 2 periplasmic binding protein fold. BztA is the periplamic-binding protein component of ABC transporter specific for carboxylic amino acids, glutamine and asparagine. The BZtA domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.61367e-120
NZ_LN890477.1\|WP_054505206.1\|3228452_3229241_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.71986e-25
NZ_LN890477.1\|WP_006387357.1\|3224371_3224980_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	5.89798e-36
NZ_LN890477.1\|WP_006387366.1\|3232898_3233297_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|225667	COG3125, CyoD, Heme/copper-type cytochrome/quinol oxidase, subunit 4 [Energy production and conversion].	1.88727e-38
NZ_LN890477.1\|WP_155872358.1\|3220315_3220966_-\|response-regulator	gnl\|CDD\|182771	PRK10840, PRK10840, transcriptional regulator RcsB; Provisional.	5.29321e-51

>NZ_LN890477.1|WP_054505206.1|3228452_3229241_+|helix-turn-helix-transcriptional-regulator
MPIYTLPAVEDPDLVACPIVGMAIDTREHASDWHAHQRTQLLYQAEGGVTLYLADRVGQLAPLQAAWLPAGCVHRTAMQGTFAYRSLYFDVRAYPDLPREPAILDVNPLLRELIVRVTRWPSDAALDAPRQRLVGALLDELAAAPTAPLHLPMPRDRRLAPIARELLENPACPLSIDEWGRRVGASGRTLARVFLAETGLSFTRWRAQCRLLMARARLAEGASVTEVAHAVGYASDSAFIAMYRRAYGEPPGRRLRRRDPPP
>NZ_LN890477.1|WP_155872360.1|3227195_3228362_-|MFS-transporter
MSFPSSSSGPRALPPPWLVIALLALPQVAETILAPALPDLARHWRLDAAATQPVMGIFFVGFAAGVLLWGHLADTRGRRPAMLAGLALGLAGTLCALAAPAYPWLLAGRFLQALGLAACSVVTQTVLRDCLDGPRLTHYFVTLGTVLAWSPAVGPLTGQALADGHGYGGVLAAIAVVVALLLGAVAWRWRETRPAPTGAVPLAALARRMLTDGALRLAVQRVAGLNLLVFSFYAAGPFMTGSLPGLGFGWVGLGVALAGSLGAACNRRLPATAGAAIRVRHGLRCVALGAAAQALAMAWRPQPGWLWAAAALPVFIGYGLAIPNLLGPALRRYGHCLGRAGALFGLAYYSLLGLGLAATSWLPFDTPLPLSAAWLAVALWLLAARERD
>NZ_LN890477.1|WP_026384122.1|3226458_3227157_+|metalloregulator-ArsR/SmtB-family-transcription-factor
MTAPSVQPPLAAELAELARTLGNAHRLILLEHIAQGERPVERLAELSGLSVANASQHLQQLRRAGFVVTRREGKHVYYRLGSAPIAGLLNALDAVAQHNRGEMRRLVADSQDRRDGLEAISRDELLSRLGEGSMTLLDVRPADEFAQGHLPGAINIPADELLKRLEELPADHEIVAYCRGPFCVLSSDAVTALRAHGLRARRLDAGFPDWRAEGLAVEAPPARKGRRRPQTP
>NZ_LN890477.1|WP_026384121.1|3224993_3226319_-|chromosome-partitioning-protein-ParB
MSRMPSSDLLRPFTARWRPALRILALAALPLLLAACNGGGDDDDDEATSPPVAQNPAPPADTRNQAYLAAKAGDVIQVRIEELRPTQAAIGYDQIYYKLGRWQGDFNRATWAADPVKQLDYLNRTVGKKFSDYCEDMGATTSQAFTSIAQLRAARLDQPATFSCTAAMGADPANLKTVVVGWDGNLYLTDGHHTFSSLREIADGGPKLPVWVKVDANYSGVGTAAAFWQRMVDERKAWLRDGQNQPITVDQLPTRLGIANAQEAGGMQEDRYRSLVYFTRDIAYSNGNLPEFAEFLWGDWLRRQVAGGQLPGLDQYAMMAPSTPAQILTVSTLNASLASTGANDGYAAAVRNAALKMSALADSDIVFQDRTAASLGRIQLVAGAPSGSPTKKARDTLEELPRNDVKTDASPEGSPRGAGKLWFAVNYRACGKPAAGTCWGW
>NZ_LN890477.1|WP_006387357.1|3224371_3224980_+|glutathione-S-transferase-family-protein
MSIVFYWHPQSSASPIAAALAELQVPHERVKVDIRAGEQRRPEFLAINPNGKVPTLTVDGAPLFEALAIQLWLGEHWGVERGLWPAAGTPQRLAAMSWCAWSYVSYGAVLWRLFHLGHGDEGQRDPRQAERALADLDSLLAVLEGHLARQPWMLGAEYSLADLVVGSVIGYSAMLGAPIAAHPKVQAWLGKVQARPAMQVDR
>NZ_LN890477.1|WP_054437620.1|3223250_3224255_-|YafY-family-transcriptional-regulator
MLASSNRLLRLLSLLQTRRHWAGGELAQTLEIHPRTLRRDIDRLRELGYPIQASSGVAGGYAFRAGNALPPLLLDDDEALTVAITLRTAATGSVGGAEEAALRALVKLEQVMPARLRHKVDALRTALVPVPRAGPLIDASQLAVLAAACRDQLRVHFDYTDGRGQATSRQVEPQGLAHTGYRWYLVAWDPARADWRTFRLDRIAGPVTPGAHFAPRPPPDGGDLRAYVARSVGQAANGEEARIVLHATRAAMTARIPAAVGEIDALDDDRCLLRCPGQSLDALAYWLMALEVEFDVLAPAALALRLRTAAERVARMLQRRETAPGSVPDGPAGG
>NZ_LN890477.1|WP_020926507.1|3222865_3223231_+|hypothetical-protein
MIAVNASNAANRAGFRTSDAASGDAFRAAFTDAQQRGASALAGGVKGAAPVASAAEREFMDYASMSLQEKMFYAALASLGISKAEYDAMSAADKLKVAEKVSLVLQQLAKAEQARQVEHAG
>NZ_LN890477.1|WP_006384571.1|3222245_3222689_-|hypothetical-protein
MSLDTNPTSLPSASVAPPADVFLQFLVNLVNNGGQLKSIGVTLQMGGMLVSGSIVSGAEYFDRFAETFSDSLSDMDTQARQSVRTSLAELGDVFRLPQPAEPLPNYIHLVDALFFTADGTPIAGQPTLWRGRSSAVDGFILGRLQSE
>NZ_LN890477.1|WP_054445762.1|3221387_3222185_+|hypothetical-protein
MRDAARRWPPREESLFLRFQPVFTAQGQVHEYAVADSITPLRSGSPGLMAQRARLRAAVAFAAGLPAPLDLSFEHALTVPDGTDVARRLCADLDISVSRDHICLGPAAGNTPLQLATRRLTFSVPLFRRLLPQAHVLACHTEFRASLRARLLPASCGGKPVASGVMRVTGLTLRIPRGLGADRALQRRFDSLMECATAAKLQVTIDDIEDMHDFVWLRPRPGLLFRGTVLSAPISAQCLDVWLQADGDAWRSFHACTARPSWTER
>NZ_LN890477.1|WP_155872358.1|3220315_3220966_-|response-regulator
MQRLRIVIADDHPLVLMGMTDLLNKDLSFDVVATLASPTALVEHMKRDLPQVVITDYSMPGDEIYGDGIRLVKYLIRHFPGARIVVLTMVSNPMIISALYDAGAEAVVFKRDDLGEIVTALHALQLGRKYYPPGFQREGSLAARHKFIGERINSLSPKEFEVLRHFIRGESMMQVADSLKRSVKTVSGQKISAMRKLNVQTDQELVAFCVESGMFQ
>NZ_LN890477.1|WP_155872362.1|3230614_3231811_-|porin
MKKTLLAAAILTTFAGVAQAETSVTLYGIIDTGIGYNKVSGTEPGINLGTGKPQNVDVSGSRIGMINGVQSGSRWGLKGSEDLGDGLRAMFQLESGFDSGNGDTTLDRLFGRQATVGLANDAWGSVEFGRQATVGSNFLVEIDPFAASFTQANIGTGLSAANTMRWDNMIMYRSPWTDGFQFALGYSFNVDTDDGNQTGFRTADNARGITAGLRYVRGPLNVSLTYDQLNSSNKAYAVGKNGRPVFDDAGNRVALDNNITPRQYAVAVSYDLEVLKLAAAYGRTTDGWFVGQDLPEGSASNHFGTYRYAEGFKANSYMLGATLRLDGASNLFGSWQHVSPSNDLLTGDDAKMNIWSVGYTYDLSKRTSLYAYGSYGKNYAFIDGLKSTAGGVGMRHLF
>NZ_LN890477.1|WP_054507825.1|3232102_3232894_-|SURF1-family-protein
MAATKDSTHSGDTPRNPRSATTLVILGMVAVVLFAGLCALGTWQVHRLAWKQNLIAQVEQRAHAPATPAPARADWPGLTADNAEYRRVSASGAYQYDKQTLVQAATELGSGYWVMTPLQLADGGGTVLVNRGFVLPEWRKRQAAGQAEADAGPVKVDGLLRMGEPGNGFLRNNDPAANLWYSRDLPAIASARGLGEVAPYFIDADAAPGAGRDPTQAPVGGLTTLTFPNNHLVYAITWYALAAMIVLGAGIVAREERRLRARR
>NZ_LN890477.1|WP_006387366.1|3232898_3233297_-|cytochrome-o-ubiquinol-oxidase-subunit-IV
MNAHADHAGHGHDHGHHDDDDGAAHGTLKSYVTGFVLAAILTAIPFWLVMDRVFASSRTTALVILAFAVVQIVVHIIYFLHMDTKSESGWNMLALIFTLVLVVITLSGSIWIMYHLNSNMMPMSVHDMRNMP
>NZ_LN890477.1|WP_026384126.1|3233293_3233935_-|cytochrome-o-ubiquinol-oxidase-subunit-III
MSDTLAPTLPGGSAPPAEPVFHVAGEHHPKNGTLLGFWVYLMSDCLIFACLFATYGVLGRNYAAGPSGADLFDLPLVAVNTSLLLLSSITYGFAMLEMRRNRVGATQGWLAVTGVLGLGFLSLELYEFAHLIHIGAGPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTMMVQVRMHGLIPENRRRLMCLSMFWHFLDLIWVGVFTFVYLMGVLP
>NZ_LN890477.1|WP_155872364.1|3233927_3235931_-|cytochrome-o-ubiquinol-oxidase-subunit-I
MTDQPDLTKLIFGRLTWDAIPLHEPILLATFAMVAIGGIALLGAITYYRKWGYLWHEWFTSIDHKKIGIMYMILGLVMLLRGFADAIMMRLQQAVAFGDSTGYLPPHHYDQIFTAHGVIMIFFVAMPLVTGLMNYVVPLQIGARDVAFPFLNNFSFWMTTGGVVLVMMSLFVGEFARTGWLAYPPLSGIAHSPDVGVDYYIWALQIAGVGTLLSGVNLLVTIVKMRAPGMSLMRMPIFTWTALCTNVLIVAAFPVLTAVLALLSMDRYVGTNFFTADFGGNAMMYVNLIWIWGHPEVYILILPAFGIFSEVVATFCRKRLFGYASMVYATVVITVLSYLVWLHHFFTMGSGASVNSFFGITTMIISIPTGAKIFNWLFTMYRGRIRFEVPMLWTLGFMVTFVIGGMTGVLLAVPPADFALHNSLFLIAHFHNVIIGGVLFGLMAGITYWFPKAFGYKLDPFWGKCSFWFWLVGFYFAFMPLYVLGLMGVTRRVNHFEDMSLQIWFQVAAFGAFLIAIGIACFLIQLVVSYRRRDSLRDFSGDPWDGRTLEWSTSSPPPNYNFAFTPRIHDQDAWWQMKQHGYQRPQAGFIPIHMPKNTWAGIVLAAISVVMGFALIWHMWPLAVLSFAALVIVSIVHTFNYKREYYVPADEVVRTEDARTQLLAKHV
>NZ_LN890477.1|WP_035183065.1|3236002_3237046_-|ubiquinol-oxidase-subunit-II
MPSFPRLRGLLLFAALPLLSGCNAVLLSPSGDIALQQRNLIIISTGLMLLIIVPVIFLTFLFAWRYRASNRDAHYDPDWNHSTMLELLIWAAPLLIIIALGALTWVSTHQLDPYRPLARLSEGREVPPGTKPLVVEVVALDWKWLFLYPEQGVAAVNEMAAPVDRPIQFKITSSTVMNSFFIPALAGQIYAMPGMQTTLHAVINHPGEYEGLSANYSGAGFSGMRFRFHGLDQQGFDKWIADARASGATLGRDTYLKLEQPSERNPVQRYASVAPGLFDAIVNRCVEPNRMCMKDAMAIDAGGGMGIPGARNIASLDEATRERLGLADAPVRKYVGAMCTSAAELAL
>NZ_LN890477.1|WP_006387370.1|3237270_3238605_+|MFS-transporter
MATTTQYPGHASPLPSPGAAGATGSHAKVAPGEIAVGVVIGRASEYFDFFVFGIACVLVFPRVFFPFEPQLEGTLWAFVIFSFAFIARPIGTAVSMAIQRRWGRGTKLTIALFLLGTATVGMAFLPGYEAIGAHAIVLLAVFRCLQGLAFGGSWDGLPSLLALNAPPKRRGWYAMLGQLGAPIGFMIASALFLFLHVTLTEADFIEWGWRYPFFVAFAINVVALFARLRLVVTEEYTQLMEEGELEPISTGQMVREQGYNLFLGAFAALASYALFHLVTVFPLSWIAVSATQQIPDVLIVQIIGAGLGILGTIASGWIADRIGRRTTLGLLAALIGVFALFTPWLLGGSPKAQDAFILIGFALLGLSYGQASGTVTANFSKRFRYTGAALTTDMAWLVGAAFAPLVALGLSARFGLVAVSIYLLSGTACTLLALRINKALETRD
>NZ_LN890477.1|WP_155872366.1|3238661_3239678_-|transporter-substrate-binding-domain-containing-protein
MPIFRTAAGALALATVTGQAHAGPTLDTVKKRGYVQCGVSTGIQGFSSPDSKGNWQGLDVDMCRAIAATVFNDASKFRLTPLTTQARFTALQSGEVDVLTRNVTPTMARDTTLGLISTGVNYYDSQGVMVSARLGVRKLKELDGATICVQPGTVTELDLADWFRANGLKFKPVVIDKYDEIVRAFSAGRCDAFTSDKSQLAASRTTLEHPDNYVILDENIAKSPLGPMVRQGDDNWFNVVRWTLNAMLEAEEFGVTSANVDSQLKSTNPNVQRILGVTPGMGKNLGVDDKWAYNIVKQVGNYGESYERNLGMASAMKLPRGLNAQWRDGGQMYGWPVR
>NZ_LN890477.1|WP_049050733.1|3239722_3241051_-|aspartate-aminotransferase-family-protein
MDQTLRAAAREYLIRYGGDTFPNLFKSAKGTVVRDDTGREILDFTSGQMCATIGHNHPAIVDAVRRAGETAFHFFSGMIPEAVAQLAATMARDWMPAGMTKSIFVNTGSESNEIALRMAKMHKSGFEILAVGGSWHGVTSGAGSVSYASDRKGYGVPPAGVFVMPEPNSYRPYIAGLDAEQSALACLEIGLKMFDMASAGRPAAIIVEPVISAGGVLVPPKSYMQALRRAADARGMLLIFDEAQTAFGRLGCRTGSEHFGVTPDIISVSKTLGGGLPLAATITTPAIEQDVHEKGFTFYTSHVSDPLPATVGLAVLETLQREQLLERARRQGDYLRRGLLELQQRHEAIGDVRGLGLLLGVELVQDRDTREPYHALGALTTQRCFELGLSMNIRRRPERGSVWRIAPPLTVSNDEIDRAIAILDQALAESLDQIAKPRALSA
>NZ_LN890477.1|WP_020926523.1|3241210_3242110_+|LysR-family-transcriptional-regulator
MDTRWLQDFITLSELRNFTRAAEARNLSQAAFSRRIQSLENWAGARLIDRSAFPTQLTEAGERFRVAAIELVNQLVEARAGIAAVPARNQLRLATSYALATTHLPGWWRDWSAGQQLSCSLQTGNVHDTVSAFTSGAADLLICFHQVAQPLPLDLSRYDCLTLGRELIRPYAARGLVEREGLDLPGTMDRPVPLLMYSPSVYFARLIDAAIESGPEPLHGVRLFEAEMSDVLGDMAAQGLGVAWLADSALRRLGAADLAPLANRAWDIEVSILAFKDRSDARAAVEAVWRRMAAGAQPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN890477_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890477_5

5605855-5605968

Orphan

Consensus_repeat	Method
TTTTGCCTTGGGGCGGCCCGGCGGCAAAAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN890477_5

>merge|NZ_LN890477|5|5605855-5605968|CRISPRCasFinder
TTTTGCCTTGGGGCGGCCCGGCGGCAAAAGGTTGCCCCCACGCCGCGCCCGCTGCGCGGGCTAGCTGCCCCCCGAGGGGGCGATTTTGCCTTGGGGCGGCCCGGCGGCAAAAGG

>NZ_LN890477|5|5|5605855-5605968|CRISPRCasFinder
TTTTGCCTTGGGGCGGCCCGGCGGCAAAAGG	TTGCCCCCACGCCGCGCCCGCTGCGCGGGCTAGCTGCCCCCCGAGGGGGCGA
TTTTGCCTTGGGGCGGCCCGGCGGCAAAAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890477.1\|WP_102949866.1\|5607632_5608737_+\|peptide-chain-release-factor-2	unknown	unknown	gnl\|CDD\|234799
NZ_LN890477.1\|WP_020928314.1\|5614398_5615226_+\|YggS-family-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|143483
NZ_LN890477.1\|WP_020928313.1\|5613148_5614402_+\|benzoate/H(+)-symporter-BenE-family-transporter	unknown	unknown	gnl\|CDD\|281578
NZ_LN890477.1\|WP_049058060.1\|5606057_5607368_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_LN890477.1\|WP_155873433.1\|5608779_5609535_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180796
NZ_LN890477.1\|WP_150100672.1\|5603179_5604118_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226706
NZ_LN890477.1\|WP_110059104.1\|5615245_5615899_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380061
NZ_LN890477.1\|WP_053499191.1\|5594790_5595753_-\|siderophore-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238560
NZ_LN890477.1\|WP_038503894.1\|5598759_5600154_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|223715
NZ_LN890477.1\|WP_020928310.1\|5611084_5611408_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377101
NZ_LN890477.1\|WP_006384961.1\|5593764_5594754_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|226965
NZ_LN890477.1\|WP_173361377.1\|5592788_5593772_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|226964
NZ_LN890477.1\|WP_038503902.1\|5615895_5617050_-\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238383
NZ_LN890477.1\|WP_020928305.1\|5601768_5603049_-\|lipoprotein-releasing-ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|274034
NZ_LN890477.1\|WP_020928303.1\|5600206_5601022_-\|TatD-family-hydrolase	unknown	unknown	gnl\|CDD\|238635
NZ_LN890477.1\|WP_006384955.1\|5601086_5601776_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|131266
NZ_LN890477.1\|WP_006386141.1\|5604099_5605800_+\|single-stranded-DNA-specific-exonuclease-RecJ	unknown	unknown	gnl\|CDD\|182944
NZ_LN890477.1\|WP_006386145.1\|5609545_5611069_+\|lysine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234778
NZ_LN890477.1\|WP_054507257.1\|5611464_5612973_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_LN890477.1\|WP_020928301.1\|5598064_5598760_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816

Protein	Function_ID	Function_description	E-value
NZ_LN890477.1\|WP_102949866.1\|5607632_5608737_+\|peptide-chain-release-factor-2	gnl\|CDD\|234799	PRK00578, prfB, peptide chain release factor 2; Validated.	0
NZ_LN890477.1\|WP_020928314.1\|5614398_5615226_+\|YggS-family-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|143483	cd00635, PLPDE_III_YBL036c_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, YBL036c-like proteins. This family contains mostly uncharacterized proteins, widely distributed among eukaryotes, bacteria and archaea, that bear similarity to the yeast hypothetical protein YBL036c, which is homologous to a Pseudomonas aeruginosa gene that is co-transcribed with a known proline biosynthetic gene. YBL036c is a single domain monomeric protein with a typical TIM barrel fold. It binds the PLP cofactor and has been shown to exhibit amino acid racemase activity. The YBL036c structure is similar to the N-terminal domain of the fold type III PLP-dependent enzymes, bacterial alanine racemase and eukaryotic ornithine decarboxylase, which are two-domain dimeric proteins. The lack of a second domain in YBL036c may explain limited D- to L-alanine racemase or non-specific racemase activity.	1.05315e-112
NZ_LN890477.1\|WP_020928313.1\|5613148_5614402_+\|benzoate/H(+)-symporter-BenE-family-transporter	gnl\|CDD\|281578	pfam03594, BenE, Benzoate membrane transport protein.	1.15115e-121
NZ_LN890477.1\|WP_049058060.1\|5606057_5607368_-\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.15246e-112
NZ_LN890477.1\|WP_155873433.1\|5608779_5609535_+\|SDR-family-oxidoreductase	gnl\|CDD\|180796	PRK07023, PRK07023, SDR family oxidoreductase.	4.67854e-103
NZ_LN890477.1\|WP_150100672.1\|5603179_5604118_+\|hypothetical-protein	gnl\|CDD\|226706	COG4255, COG4255, Uncharacterized protein conserved in bacteria [Function unknown].	3.76405e-23
NZ_LN890477.1\|WP_110059104.1\|5615245_5615899_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|380061	pfam17932, TetR_C_24, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in family members such as HTH-type transcriptional repressor KstR2 as well as fatty acid metabolism regulator proteins. In Mycobacterium smegmatis, KstR2 is involved in involved in cholesterol catabolism, while YsiA in Bacillus subtilis is involved in fatty acid degradation.	7.61047e-19
NZ_LN890477.1\|WP_053499191.1\|5594790_5595753_-\|siderophore-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238560	cd01140, FatB, Siderophore binding protein FatB. These proteins have been shown to function as ABC-type initial receptors in the siderophore-mediated iron uptake in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	9.35437e-118
NZ_LN890477.1\|WP_038503894.1\|5598759_5600154_+\|HAMP-domain-containing-protein	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.65329e-50
NZ_LN890477.1\|WP_020928310.1\|5611084_5611408_+\|hypothetical-protein	gnl\|CDD\|377101	pfam03699, UPF0182, Uncharacterized protein family (UPF0182). This family contains uncharacterized integral membrane proteins.	0.00757161
NZ_LN890477.1\|WP_006384961.1\|5593764_5594754_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|226965	COG4606, CeuB, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	3.95086e-133
NZ_LN890477.1\|WP_173361377.1\|5592788_5593772_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|226964	COG4605, CeuC, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	1.78391e-117
NZ_LN890477.1\|WP_038503902.1\|5615895_5617050_-\|thiolase-family-protein	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	3.3852e-153
NZ_LN890477.1\|WP_020928305.1\|5601768_5603049_-\|lipoprotein-releasing-ABC-transporter-permease-subunit	gnl\|CDD\|274034	TIGR02212, releasing_system_transmembrane_protein_lolC., lipoprotein releasing system, transmembrane protein, LolC/E family. This model describes the LolC protein, and its paralog LolE found in some species. These proteins are homologous to permease proteins of ABC transporters. In some species, two paralogs occur, designated LolC and LolE. In others, a single form is found and tends to be designated LolC. [Protein fate, Protein and peptide secretion and trafficking].	1.02697e-163
NZ_LN890477.1\|WP_020928303.1\|5600206_5601022_-\|TatD-family-hydrolase	gnl\|CDD\|238635	cd01310, TatD_DNAse, TatD like proteins; E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.	6.28959e-83
NZ_LN890477.1\|WP_006384955.1\|5601086_5601776_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|131266	TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina. [Protein fate, Protein and peptide secretion and trafficking].	4.8558e-107
NZ_LN890477.1\|WP_006386141.1\|5604099_5605800_+\|single-stranded-DNA-specific-exonuclease-RecJ	gnl\|CDD\|182944	PRK11070, PRK11070, single-stranded-DNA-specific exonuclease RecJ.	0
NZ_LN890477.1\|WP_006386145.1\|5609545_5611069_+\|lysine--tRNA-ligase	gnl\|CDD\|234778	PRK00484, lysS, lysyl-tRNA synthetase; Reviewed.	0
NZ_LN890477.1\|WP_054507257.1\|5611464_5612973_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	4.22307e-136
NZ_LN890477.1\|WP_020928301.1\|5598064_5598760_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	2.18465e-71

>NZ_LN890477.1|WP_006386141.1|5604099_5605800_+|single-stranded-DNA-specific-exonuclease-RecJ
MVSPRLTVRRADLAACHVLEASGIHPLLARLWAARGVVHPDQTRLAWPSLLPPAGLTHSTHAAGVLADAIQAGKKLLIVADYDCDGATACAVGLRALSAMGADVDFLVPNRFETGYGLSPAVVELACRHRAGKPDIIITVDNGIASVDGVAAANAAGIGVVITDHHLPGDTLPDALAIVNPNQPGCGFPSKNLAGVGVIFYMMLALRAELRRRGVYAPDGGPRLDALSDLVALGTVADVVKLDANNRLLVTQGLQRMRSGRLQPGLRALFAVAGREPRSANGFDLGFALGPRINAAGRLADMSLGIACLTTDDEAQALEMARELDNINRERRSIEAEMREQALAAMEAPDAAPGATVCVFDPGWHQGVVGLVASRLKEKFWRPTLAFAPAGDDEIRGSGRSIPDVHLRDVLDLVSKRHPNLIRKFGGHAMAAGLTLGRNDFPAFAPAFDAAVRELTGRDSFEPVIETDGSLESGYANAEVAGLLQQQVWGAGFAAPLFLDEFVVRNQRLVGEKHLKLSLERGQQRFDAIWFGHDQSLPERIQAAYRLEQNVWNGMVSVQLVIEHAA
>NZ_LN890477.1|WP_150100672.1|5603179_5604118_+|hypothetical-protein
MLIVIPGALPALPVAAELAKLLPQRAPTLHRWLQAGSARVQAHDIRTQGCTAFEAWQLRRAGYTPEAGLLPGAGLGPLLAAGQPADGPVWLAELVHLALGTDQATLLDPALMELRDDETAALLDTARPLFEDTGFAVQALSASRWRLRLPDGLRPATASPLAVAGQRLNDWWRQDAETRPWRRLLNEIQMSWHEHPANEARAARGLPPVNALWLYGGGTPWTMRPAGPEQVMTELDAAQRAGDWAAWLDALAALDRRLQALAGPKGLPDAPAELLLLGDDRSATLTLKPRGGLLGLLPAPKKNWSAWWSHPA
>NZ_LN890477.1|WP_020928305.1|5601768_5603049_-|lipoprotein-releasing-ABC-transporter-permease-subunit
MLKIPYELWIGARYAGLARIRQRRGRRDRFISFIAASSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHIELYIPGAAPERVLEQWQQFADAAKRNPEVKAGAPFVAAQGMLVRGQALRGVQVRGIDPATEGNVSDLPRQMVSGKLADLKPGGFGVVLGNELADGMGVKVGDTLLMLAPQGSISPAGFAPRMRQFTVVGVFSSGHYEYDSSLAFVDNEDAAKVFRDSGTAGVRLRIADMQKAPEVAAELRNVLPPYVMASDWSRNNRTWFAAVQTEKRMMFLILALIVAVAAFNLLSSLVMAVKDKQSDIAILRTLGAGPGEVARIFLVQGALIGVIGTLLGVAGGILIAYNVDVIVPFIERLLGVHFLPREIYFISALPSDPQVGDIVTIGVTSLVLSLLATLYPSWRASRLQPAQVLRHD
>NZ_LN890477.1|WP_006384955.1|5601086_5601776_-|ATP-binding-cassette-domain-containing-protein
MIDSLSPALQADDLVKIYDEGPARIEVLSNVSLSVARGEMVAIVGASGSGKSTLLHILGLLDVPTSGSVAVDGQLAVGLSEAKKSQVRNRSLGFVYQFHHLLPEFSALDNVAMPLIVRRENRDKARAAAREVLGLVGLAAREGHFPGQLSGGERQRVALARALVTRPVCVLADEPTGNLDRHTAHNMFELLTRVNRESGTAFAIVTHDPELAARADRQLLMENGRLVSG
>NZ_LN890477.1|WP_020928303.1|5600206_5601022_-|TatD-family-hydrolase
MLIDTHCHLDAAEFDADRPEVAAHALDSGVQAIVIPAIERANFAVVRDLAAQVAGGAYALGIHPLYVQRADDADLDALREAIRQALGDPRFVAIGEIGLDFFVPEIASGEPRARQERFYAAQLAMAAEFKLPVLLHVRKSQDILLKYLRRHDRIGGIAHAFNGSAQQAQAFVEQGFALGLGGAMTYERALQIRRHATDVDLRHLVLETDAPDIPPAWLHPPRRRNRPGELARIAQVLAELRGITPAQVAQATTANALRVLPRLSAAILADD
>NZ_LN890477.1|WP_038503894.1|5598759_5600154_+|HAMP-domain-containing-protein
MRWLPVRSLFWRAFLTFWGAMAVIMVCGMMLTAAVAWYRVDSLDGLNPGNLTRDAAQIARREGAEGLRRWVGAMDARYSALKIYIVDTQDRDILERRLPTRLDDWLAAFRASPDHGLIAAIDVPADPDALRVSWWDPQLLVLPDHSELLMLFLPFDSSHWEVLGLTPVTLGLLLFALAVTAPFCWALTRHVAAPLEQLRGAARSLAAGRLDTRTPAALPLRKDELGLLARDFDAMAGRLQALVDTREQLLRNIAHELRSPLARMRLGVELARRKDERQDLQLDRIERECERLDTLVGSTLRLARMGALPQPTTPLDLAEVVDEVVQDARFEAGERRIAIAWHRPAPLRIAADRDSLASAIENVLRNALRFAPAGGAIQARLLVDAGEACLEIEDNGPGVPEKELAYLFEPFYQGAPAAGAPAGGAGLGLSIARAAVAAHKGRISARNVAPHGLSVRIELPRVAA
>NZ_LN890477.1|WP_020928301.1|5598064_5598760_+|response-regulator-transcription-factor
MATRRILLIDDDVDLALMLREYLEPTHIELTLAHNSAQGLPLAMQECFDLVLLDLMLPDGNGLDLLRHLRRHSRRPVIMFTAHGGETDRVLGLELGADDYLTKPFGPRELKARIGAVLRRFEEKPEPAPPELSVGALSLDAASGRARLGAQEVLLTGAEQRILEVLMRTPGQVVPREQISLYALGRAADRYDRSIDTHISSLRRKLQLDQAGDAPAIRNLRGLGYVLAGAA
>NZ_LN890477.1|WP_053499191.1|5594790_5595753_-|siderophore-ABC-transporter-substrate-binding-protein
MTMNQAQAGRAGRWLARATVALALGAASALSVAQTMPVKHARGETAVPSNPAKTVVLDLAVLDTLHALGVDVTGVPSAAKLPPQLAQYADKRYLKVGSMFEPNYEVIHAAQPQVIFVAGRSAPKYDELAKLAPTVDLTVNAKDLVGSVTRNTETLAAIYGKQAVAKEKLDALRASIAALHGQAAKAGSALIVLTTGGKMSAYGPGSRFGVIHDAFGFAPAAKDLNVSNHGQAISFEFIAQTDPDWLFVIDRDAAIGREGTSAQRMLDNDLIRPTKAWKQQRVVYLNGYNWYLLGSAGLSAMQQNVDDIARALSAAKPAVK
>NZ_LN890477.1|WP_006384961.1|5593764_5594754_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MRAGGAITGWAGLAALLLLLLLLCAASIGLGAGSFSFAALAGGPDAERAWRLLLVSRVPRTLALLLAGMALAVAGLIMQMLVRNRYVEPTTAGTVESATLGILVVTLLAPDTPVIGKMLTATGFALAGSLLFLALLRRVPLRTPFIVPLIGLILGGVIHAVTTFVAYRYDLLQSLHAWTTGDFSGVLRGRYELLWIGFGLAAAAYLAADRYTVAGMGREFAANLGLNHARLTLVGLLIVSAISAVVVVTAGGIPFLGLIVPNAVSLVLGDNMRRSIPWVAMLGGVFVLACDIIGRLVIHPYEVPLGTVVGVVGSILFLCLLRSRGARRG
>NZ_LN890477.1|WP_173361377.1|5592788_5593772_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MAEFIARAVRLRSPQAWRLALLAVAALSCIVGFMALGANGQWAFVLPFRGAKLVAMLLVAYAVAVSSVLFQTVTHNRILTPAIMGFDALYLLIQSVVVFGFGQAAGAVNHPVAAFVLEVCAMTAFACLLFRWLFTDAVRSLHLMMLVGIIFGLLFRSLSSFVVRLIDPNEFLVLQDRLFANFNSVRTELLPIALAAVAAATLLVWRMRRRYDVLALGREIALNLGVDYRRTLLLTLAAIAVLVSVSTALVGPVTFFGLLVSNLAYQAMGSDRHRHTVPAAVLLSVIFLVGGQTLLERVLQLSTTVSVVIEFVGGVMFLALILRRGRQ
>NZ_LN890477.1|WP_049058060.1|5606057_5607368_-|MFS-transporter
MEHTMAPGVSPAIPAAEEDRIYRKVGWRLVPLLVVCYVVAYLDRVNVGFAKLQMLQELQFSETVYGLGAGIFFIGYFLFEIPSNIILHKVGARVWIARIMITWGIISACMMFVTSVHMFYFLRFLLGAAEAGFFPGIILYLTYWYPAARRGRITTFFMTAVPMSGLIGGPISGWIMNTFHGDHGLSGWQWLFLLEGIPSVIIGVLVLMYLDDRINKAKWLTASEKAVLIRNIAAEEQHKEDPPIRAALAHPRVWAMALIYFSFVMGLYGVGFWMPTLIKSTGVQSPLAIGLLTAVPNLFAVIGMILIARNSDRNRERRWHVAIPALCGALGLLFSAIWSGNTVLAILALTVANIGICTVLPLFWSLPTALLGGTAAAAGIALINSVGNLAGFVSPYLVGWLKDMTGTTNTGLYMLSACLVIGALVALAQPARLVNK
>NZ_LN890477.1|WP_102949866.1|5607632_5608737_+|peptide-chain-release-factor-2
MEAERQNQLAARLADYAEREQALRRYLDYDAKAERLQVVNAELEDPAVWNDPKHAQDLGREKKALEDVVETLTGLGTGLADSNELFELAAADNDDATLESIELDANGFQEKLESLEFRRMFSNPADPLNCFLDIQAGAGGTEAQDWASMLLRQYLKYAERKGFKAEVLEESEGEVAGIKSATIKLEGEYAFGYLRTETGVHRLVRKSPFDSSGGRHTSFASVFVYPEVDDSFEVEVNPADLRVDTYRASGAGGQHINKTDSAVRLTHIPTGIVVQCQNDRSQHRNRAEAMQMLKSKLYELEMRNRMAEQQKLEDSKTDVGWGHQIRSYVLDQSRIKDLRTNVEISNTQKVLDGDLDPFIQASLKQGV
>NZ_LN890477.1|WP_155873433.1|5608779_5609535_+|SDR-family-oxidoreductase
MSDTIAILTGASRGIGAAMARGLAKPGTRLITLARREDPELAAYARSQDAQLEQLSVDLSDLAAAEAAARRICDALPRDARRYLLINNAGTVHPVSGTDALIDGPAIAAAFNLNVTAVMLLTARFLAAVADLKADRRVLNISSGAGRNPNAGWGVYCATKAALDMYSRVVKQEQGENGARVVSLAPGIVDTDMQAAIRSSDPKSFPALAKFQDFHASGKLSSPANVASRILAYLDRDDFGTTEIDDIRNYD
>NZ_LN890477.1|WP_006386145.1|5609545_5611069_+|lysine--tRNA-ligase
MTDHTTAPATAQDENRLIAERRAKLAKLRETGVAYPNDFVPDARAAALHDKYDDQEQEALAAAPVTVKVAGRMMLKRVMGKASFATLQDSTGRIQIYLDRGTLGEDSYAAFKQWDIGDIIAVEGSVFKTNKGELSVHAATARLLSKSLRPLPDKFHGVADQELRYRQRYVDLIMTDATRRTFEARSKAMGSIRQFMLNAGFLEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEVNRNFRNEGVSPRHNPEFTMMEFYAAFADYRWLMDFTEELIRQAAISATGSAVLTYQERELDLSKPFDRLTICEAILKYAPGYTQAQLDDVAFVRAELKKLGADADGPVLARAGLGALQLALFEETAEAKLWNPTYIIDYPVEVSPLARASDTREGITERFELFMTGREIANGFSELNDPEDQAERFRSQVEAKDAGDEEAMYYDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPSIRDVILFPHLRRED
>NZ_LN890477.1|WP_020928310.1|5611084_5611408_+|hypothetical-protein
MILKILMLAAVVAALFYMVMQPRRARGGYHGAAAPVRRAPLFIALCLATALSITGALVTAVLWMGSVAGGVTGGGYHGEADFLLTIAGALLAIAVACGVGAFLKRKA
>NZ_LN890477.1|WP_054507257.1|5611464_5612973_-|PLP-dependent-aminotransferase-family-protein
MSKTFTLETLKIRMGDADLAPLDLHQRIQRALRALVLDGDLDPGVKLPATRALAQSLGVARDTVENAYVQLQRDGFIARRKGSGSYVSETIGTELRGSARRRALSRERRPASAQSITPAAGLSRRGRAIFDSGGVADQQSVQAFATGLPETRSFPLAVWERLQRQVLRDHRGHVLLHGDPQGAEPLRRAIATYLNLERGAKVRAEQIVVLSSTRQALFLCAQLLVDAGKPILLENPGYFGARKAFEFAEARVVPVDVDAQGIRTDLLRADRSGAACVYVTPSHQYPTGATLSLERRLELTRWAAEGGRWIIEDDYDSEFHYDGLPTACVQGLDKHGRTIYLGTFSKTLYPGLRMGYMALPEELVSAFTRARSIVDGHTPQILQLTLARFMADGHYNAHVRAMRKLYAARREAMLEAVGRHLAGVARALRPEGGLQVPCLLEPGWSEADTIRRAAAAGLALPGLGRLYAGTPALQGWLLGYASLSAHEIDLAMRRLAAALGGK
>NZ_LN890477.1|WP_020928313.1|5613148_5614402_+|benzoate/H(+)-symporter-BenE-family-transporter
MSSPSASPLLARDLLHPVVAGLISVIVNYGGTFILVFQAAKVAGLSPALTASWVWSVSIGVGVTGILLSWAAREPIITAWSTPAAAFLVTALATTPYAEAVGAYLISAAAFVALGLSGCFDKAIRLIPPGVAAGLLAGILLPFGIGAFGGMSLDPLLTGWLILAYVALKRYTARYAVVGILVSGLALLLLQDRVDLSGLRLEFATPVFTAPAFSLNGLLSVALPLFLITLTGQYMPGMLVLRNDGFKTSANPIVTLTGLGSLLMAPFGSHAFNVAAITAAICTGREAHDDPSKRWIAGIAAGLFYILVGVFGVTLAALFMALPATFITTLAGLALLGTIGGSLAGALADPKTREASLITFLAAAANIKLFGIGGAFWGLVIGLLAHAALNGRLPRRLRPPRYTDLPRPQATGKEMVK
>NZ_LN890477.1|WP_020928314.1|5614398_5615226_+|YggS-family-pyridoxal-phosphate-dependent-enzyme
MMTLPTDPAQAAPGGADTQTRHDQHGRYPQALSVEDFRHNLAAIHARMDAACRRVGRDPAGVRLLPVSKTMDESRIRLAHAAGCRLLGENKIQEAHRKWQNTADLPDLRWSVIGHLQTNKAKLMAQFASEFQALDSLRLAEALDRRLQAEGRALDVYVQVNTSGEPSKYGLAPDDVAAFIQALPAFSSLRVRGFMTLALFSSEAERVRQCFVLLRGLRDRLRQDAPAGISLDELSMGMSGDFEIAIEEGATVVRVGQAIFGARALPDSHYWPGAA
>NZ_LN890477.1|WP_110059104.1|5615245_5615899_-|TetR-family-transcriptional-regulator
MNRSGKAAAQAAPQGHEDGAESLRRAEVILTAARLFRKHGYERTTVRELARAVGLQSGSLFHHFRSKEEILVAVMNNGIQEVLDEGRQALDRYRTPADRLAALFRVHMWSMLHGAGGDAMNALVYEWRSLSASSQASVKALSDRYEAMWQEAVAAAVAAGVLRGDARVIKRCVLGAMNLTVQWYKPEGRLRPAAFIDEMLRASLPALPEGAGRWPVA
>NZ_LN890477.1|WP_038503902.1|5615895_5617050_-|thiolase-family-protein
MNEAVIVEAVRTPFGRRGGWWADKRPDDLLAEVIQGLLARAGLPGGQVDDVIAGCVSQAGEQGANIGRLSALLAGLPETVPGVALNRMCGSSQQAVHAAAQAIAAGDMRYVVAGGVESMSRVPMFLDVTLGQREFRGFESLNPGLLQRYPLIHQIESAERIAEQWQLGRAELDAWSMQSHARAWAAASAGRHSELLPGPAGTPARDEGIREHADPAKMAALAPALRPPGQGNVTAAQSSQLADGAAAVLLADRQAALADGLRPQARFRARVAIGSDPVLQLTGVIAATERALERAGLRLRDIDWIEINEAFASVVLAWLKTLDADPAKVNPWGGAIAHGHPLGATGAALMAKMLAGLRASGGQFGLQVMCIGHGMATATIVERL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN890477_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890477_6

6229782-6229884

Orphan

Consensus_repeat	Method
TTTTCATCGCCGAGCCGCCTCAAGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LN890477_6

>merge|NZ_LN890477|6|6229782-6229884|CRISPRCasFinder
TTTTCATCGCCGAGCCGCCTCAAGATGAAAAATGCCCCCTCGGGGGGCAGCAAGCCGAAGGCGCGGCGTGGGGGCCCTTTTCATCGCCGAGCCGCCTCAAGAT

>NZ_LN890477|6|6|6229782-6229884|CRISPRCasFinder
TTTTCATCGCCGAGCCGCCTCAAGAT	GAAAAATGCCCCCTCGGGGGGCAGCAAGCCGAAGGCGCGGCGTGGGGGCCC
TTTTCATCGCCGAGCCGCCTCAAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890477.1\|WP_155873771.1\|6219687_6221190_+\|fumarate-hydratase	unknown	unknown	gnl\|CDD\|377546
NZ_LN890477.1\|WP_020928792.1\|6234639_6236169_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_LN890477.1\|WP_165601333.1\|6232007_6233507_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_LN890477.1\|WP_024069793.1\|6229901_6230864_-\|DUF4892-domain-containing-protein	unknown	unknown	gnl\|CDD\|143586
NZ_LN890477.1\|WP_049052507.1\|6236204_6236909_+\|siderophore-interacting-protein	unknown	unknown	gnl\|CDD\|99790
NZ_LN890477.1\|WP_053497040.1\|6236944_6237835_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_LN890477.1\|WP_024069772.1\|6222079_6222934_-\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_LN890477.1\|WP_026383342.1\|6238893_6240096_+\|DUF2863-family-protein	unknown	unknown	gnl\|CDD\|371362
NZ_LN890477.1\|WP_054431974.1\|6223991_6224318_+\|UxaA-family-hydrolase	unknown	unknown	gnl\|CDD\|212158
NZ_LN890477.1\|WP_020928786.1\|6227025_6229731_+\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445
NZ_LN890477.1\|WP_054439982.1\|6233557_6234640_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|185090
NZ_LN890477.1\|WP_148318515.1\|6218694_6219675_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	unknown	unknown	gnl\|CDD\|270234
NZ_LN890477.1\|WP_049054347.1\|6217288_6218644_+\|adenylosuccinate-lyase-family-protein	unknown	unknown	gnl\|CDD\|176469
NZ_LN890477.1\|WP_082391843.1\|6237875_6238649_-\|dioxygenase	unknown	unknown	gnl\|CDD\|153375
NZ_LN890477.1\|WP_102949912.1\|6231016_6231904_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176149
NZ_LN890477.1\|WP_155874275.1\|6224785_6225673_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187627
NZ_LN890477.1\|WP_155873773.1\|6225791_6226721_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_LN890477.1\|WP_024069800.1\|6240105_6241221_+\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	unknown	unknown	gnl\|CDD\|378385
NZ_LN890477.1\|WP_053498358.1\|6221202_6222051_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_LN890477.1\|WP_054507129.1\|6222971_6223742_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187626

Protein	Function_ID	Function_description	E-value
NZ_LN890477.1\|WP_155873771.1\|6219687_6221190_+\|fumarate-hydratase	gnl\|CDD\|377546	pfam05681, Fumerase, Fumarate hydratase (Fumerase). This family consists of several bacterial fumarate hydratase proteins FumA and FumB. Fumarase, or fumarate hydratase (EC 4.2.1.2), is a component of the citric acid cycle. In facultative anaerobes such as Escherichia coli, fumarase also engages in the reductive pathway from oxaloacetate to succinate during anaerobic growth. Three fumarases, FumA, FumB, and FumC, have been reported in E. coli. fumA and fumB genes are homologous and encode products of identical sizes which form thermolabile dimers of Mr 120,000. FumA and FumB are class I enzymes and are members of the iron-dependent hydrolases, which include aconitase and malate hydratase. The active FumA contains a 4Fe-4S centre, and it can be inactivated upon oxidation to give a 3Fe-4S centre.	3.92968e-105
NZ_LN890477.1\|WP_020928792.1\|6234639_6236169_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.39588e-126
NZ_LN890477.1\|WP_165601333.1\|6232007_6233507_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	7.36189e-68
NZ_LN890477.1\|WP_024069793.1\|6229901_6230864_-\|DUF4892-domain-containing-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	3.6355e-40
NZ_LN890477.1\|WP_049052507.1\|6236204_6236909_+\|siderophore-interacting-protein	gnl\|CDD\|99790	cd06193, siderophore_interacting, Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one-electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and two electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).	1.78774e-39
NZ_LN890477.1\|WP_053497040.1\|6236944_6237835_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.14869e-47
NZ_LN890477.1\|WP_024069772.1\|6222079_6222934_-\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	9.98146e-109
NZ_LN890477.1\|WP_026383342.1\|6238893_6240096_+\|DUF2863-family-protein	gnl\|CDD\|371362	pfam11062, DUF2863, Protein of unknown function (DUF2863). This bacterial family of proteins have no known function.	0
NZ_LN890477.1\|WP_054431974.1\|6223991_6224318_+\|UxaA-family-hydrolase	gnl\|CDD\|212158	cd11613, SAF_AH_GD, Domains similar to fish antifreeze type III protein. Altronate dehydratase (EC 4.2.1.7) converts D-altronate into 2-dehydro-3-deoxy-D-gluconate and is part of a bacterial pathway for the degradation of D-galacturonate. D-galactarate dehydratase (EC 4.2.1.42) eliminates water from D-galactarate to yield 5-dehydro-4-deoxy-D-glucarate, initializing the degradation of D-galactarate. The function of the SAF domain in these enzymes is not clear. It may participate in dimerization.	1.81196e-26
NZ_LN890477.1\|WP_020928786.1\|6227025_6229731_+\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0
NZ_LN890477.1\|WP_054439982.1\|6233557_6234640_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|185090	PRK15136, PRK15136, multidrug efflux MFS transporter periplasmic adaptor subunit EmrA.	8.14522e-103
NZ_LN890477.1\|WP_148318515.1\|6218694_6219675_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.17526e-116
NZ_LN890477.1\|WP_049054347.1\|6217288_6218644_+\|adenylosuccinate-lyase-family-protein	gnl\|CDD\|176469	cd01597, pCLME, prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like. This subgroup contains pCLME and related proteins, and belongs to the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. CMLE catalyzes the cyclization of 3-carboxy-cis,cis-muconate (3CM) to 4-carboxy-muconolactone in the beta-ketoadipate pathway. This pathway is responsible for the catabolism of a variety of aromatic compounds into intermediates of the citric cycle in prokaryotic and eukaryotic micro-organisms.	0
NZ_LN890477.1\|WP_082391843.1\|6237875_6238649_-\|dioxygenase	gnl\|CDD\|153375	cd07363, 45_DOPA_Dioxygenase, The Class III extradiol dioxygenase, 4,5-DOPA Dioxygenase, catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine. This subfamily is composed of plant 4,5-DOPA Dioxygenase, the uncharacterized Escherichia coli protein Jw3007, and similar proteins. 4,5-DOPA Dioxygenase catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine (4,5-DOPA). The reaction results in the opening of the cyclic ring between carbons 4 and 5 and producing an unstable seco-DOPA that rearranges to betalamic acid. 4,5-DOPA Dioxygenase is a key enzyme in the biosynthetic pathway of the plant pigment betalain. Homologs of DODA are present not only in betalain-producing plants but also in bacteria and archaea. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.	2.11468e-120
NZ_LN890477.1\|WP_102949912.1\|6231016_6231904_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176149	cd08460, PBP2_DntR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.2876e-69
NZ_LN890477.1\|WP_155874275.1\|6224785_6225673_-\|SDR-family-oxidoreductase	gnl\|CDD\|187627	cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR. TTER is a peroxisomal protein with a proposed role in fatty acid elongation. Fatty acid synthesis is known to occur in the both endoplasmic reticulum and mitochondria; peroxisomal TER has been proposed as an additional fatty acid elongation system, it reduces the double bond at C-2 as the last step of elongation. This system resembles the mitochondrial system in that acetyl-CoA is used as a carbon donor. TER may also function in phytol metabolism, reducting phytenoyl-CoA to phytanoyl-CoA in peroxisomes. DECR processes double bonds in fatty acids to increase their utility in fatty acid metabolism; it reduces 2,4-dienoyl-CoA to an enoyl-CoA. DECR is active in mitochondria and peroxisomes. This subgroup has the Gly-rich NAD-binding motif of the classical SDR family, but does not display strong identity to the canonical active site tetrad, and lacks the characteristic Tyr at the usual position. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	3.01342e-109
NZ_LN890477.1\|WP_155873773.1\|6225791_6226721_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.54681e-56
NZ_LN890477.1\|WP_024069800.1\|6240105_6241221_+\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	gnl\|CDD\|378385	pfam10093, EarP, Elongation-Factor P (EF-P) rhamnosyltransferase EarP. This entry includes family members such as EarP enzymes which are essential for post-translational activation of elongation factor P(EF-P). It was identified as EF-P arginine R32 specific rhamnosyl transferase in Shewanella oneidensis using dTDP-beta-L-rhamnose as donor substrate. This was further confirmed for Pseudomonas aeruginosa, Pseudomonas putida, and Neisseria meningitidis. As for S. oneidensis and P. aeruginosa, EarP enzyme acts as an inverting glycosyltransferase, thus mediating the formation of an alpha-L-rhamnosidic linkage. Structural analysis show that EarP is composed of two opposing domains with Rossmann folds, thus constituting a B pattern-type glycosyltransferase (GT-B) and provide basis for arginine glycosylation by EarP. Mutational analysis of efp and earP genes, resulted in a substantial decrease in the production of rhamnolipids and pyocyanin (important factors for colonization and invasion during infection) of P. aeruginosa. Collectively this indicates that EarP and EF-P are essential for P. aeruginosa pathogenicity.The protein family is also annotated in the CaZy Database as GT104.	4.19896e-175
NZ_LN890477.1\|WP_053498358.1\|6221202_6222051_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	3.40118e-50
NZ_LN890477.1\|WP_054507129.1\|6222971_6223742_-\|SDR-family-oxidoreductase	gnl\|CDD\|187626	cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs. Human DHRS6, and similar proteins. These proteins are classical SDRs, with a canonical active site tetrad and a close match to the typical Gly-rich NAD-binding motif. Human DHRS6 is a cytosolic type 2 (R)-hydroxybutyrate dehydrogenase, which catalyses the conversion of (R)-hydroxybutyrate to acetoacetate. Also included in this subgroup is Escherichia coli UcpA (upstream cys P). Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Note: removed : needed to make this chiodl smaller when drew final trees: rmeoved text form description: Other proteins in this subgroup include Thermoplasma acidophilum aldohexose dehydrogenase, which has high dehydrogenase activity against D-mannose, Bacillus subtilis BacC involved in the biosynthesis of the dipeptide bacilysin and its antibiotic moiety anticapsin, Sphingomonas paucimobilis strain B90 LinC, involved in the degradation of hexachlorocyclohexane isomers...... P).	8.85666e-115

>NZ_LN890477.1|WP_020928786.1|6227025_6229731_+|aconitate-hydratase-AcnA
MPHNTLDTLKNFKIGNKSCQYYSLPALGKALGIDVQRLPVSIRIVLESVLRNCDGKKVTEEHVRQLANWQANAKREDEIPFVVARVVLQDFTGVPLLADIAAMRSVADKMGKSPKSIEPLVPVDLVVDHSVMIDYFGTKNALDLNMKLEFKRNQERYQFMKWGMQAFDTFGVVPPGFGIVHQVNLEYLARGVHQDKKNNVYYPDSLVGTDSHTTMINGIGVVGWGVGGIEAEAGMLGQPVYFLTPDVVGVELKGKLRGGVTATDLVLTITEMLRREKVVGKFVEFCGEGTASLSVAERATIGNMAPEYGATMGFFPVDGRTIDYFRGTGRTEDEIAAFEAYFKAQDMFGVPAAQDINYTKLLTLDLSTVAPSLAGPKRPQDRIEIGNVKSTFIDLFSKPVAENGFNQPAEKLQQTFTTSTGTKVKNGDILIAAITSCTNTSNPSVLLAAGLLAKKAVEAGLKVPKHIKTSLAPGSRVVTEYLTKTGLLPYLEKLGFDVAAYGCTTCIGNAGDLTPDLNEVITSNDLVCSAVLSGNRNFEARIHPNIKANFLASPPLVVAYALAGTVTRDLMTEPVGRGKNGDIWLGDIWPTTEEVEALLKYALDPKAFEANYGQVKSNPGKLWENIKGVTGETYNWPDSTYIAEPPFFEGFGMTPGAMPTVKNARALGVFGDSVTTDHISPAGSIKETSPAGKWLKENGVMKADFNSYGSRRGNHEIMMRGTFANVRIKNLMIPARPDGSRFEGGETLFQPTGEQMSIYDAAMKYVAAGTPTVVFGGEEYGTGSSRDWAAKGTQLLGVKAVITRSFERIHRSNLVGMGVLPLQFKGSDSVQSLGITGEETYDISGLENGIKPMQDVTLTITRKDGSKQDVTLLLRIDTPIEVDYYQHGGILPFVLRQLLAA
>NZ_LN890477.1|WP_155873773.1|6225791_6226721_+|LysR-family-transcriptional-regulator
MTTPPALDLNLIQLFVTIVEAGTLSEAALRQGVTRSHVSRNLQKLERAFGAQLIRRTTRRLELTHEGSVLYDHGARMAREVESARHALQKLGAEPTGHVRLSLPTGLGELDMLRPLLVRFALEHPSLSLRVLFSNRVSDLISSEIDVALRAISVPPQDYVARELGRIKWHLCAAPEYLARMGMPAHPRDLGRFDLLGPPDPRPQATLRLRGKGQPHEVKLATRLQSEYFPFLAQAAREGAGVALLPAYIVRPDLEAGRLLQVLPAYQAEGPGDKLYILTSPTPYPSSAQRALVDFLKRELEPLLRTFLA
>NZ_LN890477.1|WP_155874275.1|6224785_6225673_-|SDR-family-oxidoreductase
MFRADLFKGQRILITGGGTGLGYAMARQLAALGATVHLCGRRLAVLEQAAQALRGESGGQVHVHPVDIRDAGAVDAMVARIWDQHGGLDALVNNAAGNFISPTEKLSERGFNAIADTVFRGTLYMTQAVGKRWIGSGASGAVVSIVVTWVWTGSPFVVPSAMSKAGIDAMTKSLAVEWGRRGIRLNAIAPGVIPTEGASARLRPNDSGTDALVKQNPMQRLGQGQDIGELAAFLLAPGNDWINGQTIALDGGDYLANGAYFKQYFDWSDDDWAAARAAIEARTAADKAQRSAGQA
>NZ_LN890477.1|WP_054431974.1|6223991_6224318_+|UxaA-family-hydrolase
MTRQATLDPQLLLISPEDNCLIVRHALPAGARVQLEDGSAVIAAPLGLGHKLARHAMPAGEKILKYGAIIGSLTAAVAAGDHIHTHNLDSDYTPTYTLEEGRAFTDRH
>NZ_LN890477.1|WP_054507129.1|6222971_6223742_-|SDR-family-oxidoreductase
MTLRLQDKRALVTAAGNGIGRASALAMAREGAQVWATDINEAALADLAKEAREAGLDGLRTRVLNVRDGAAVADCARETGAVDVLFNCAGFVHAGSVLDCDEADWDFSMDLNVKTMYRTIRAYLPLMLERGGSVINMASAASSVKGVPNRFVYGASKAAVIGLTKAVAADFVARGIRCNAICPGTVESPSLRERIAAQARQQGSDEAAVRAAFVARQPIGRVGRVEEVAALVVYLASDESGFTTGTIQVIDGGWSN
>NZ_LN890477.1|WP_024069772.1|6222079_6222934_-|fumarylacetoacetate-hydrolase-family-protein
MKLVRYGQPGQEKPGLIDAQGALRDLSGVVADIDTAAIAPAELARLAKLDPASLPRVDGAVRYGCPVNGVGKIVCVGLNYADHAAESGLPVPAEPVLFLKPSSSLSGPNDPVIIPRGSVKTDWEVELGVVIGKKASYVEESEAMDYVAGYTVVNDVSEREYQIERGGQWDKGKGCDTFAPVGPWLVTRDEIADPQNLDMWLEVNGHRFQNGSTRTMVFGVKTLVSYISRFMSLMPGDIISTGTPPGVGLGQKPPVYLKAGDEMRLGIAGLGEQRQALQAWVRAE
>NZ_LN890477.1|WP_053498358.1|6221202_6222051_-|IclR-family-transcriptional-regulator
MTASKIPVPDPATPEADAADSPGAQRYAAPALEKGLDILEALAASPAGYTLAELAQKIGRSVSEIFRMAVTLQRRGFVQVDDNDRYTLTLKMFELAHRQQPLKSLVSVALPLLRELANRARQSCHLAVYQAGRVVVIAQVDSPERWSFGLKVGVMMGLTDTSSGHVLLAFRDEVERTRMLAAHIKVEGELESDPGELFPILADVRKNGCACMPSRQIRGITNVAYPVMGVGNQVIAAINVPHIERIDRKESPSIAQVQEIVGNVAQRLSTLMGYSGYLPEQA
>NZ_LN890477.1|WP_155873771.1|6219687_6221190_+|fumarate-hydratase
MRVLLASDIETSIAQALQAVSHTHPPDFVRALKAAHDRETAPAARHALLQLLVNSKLSARARRPVCQDTGVAHVYARLGMDARIRADGPGPTPTLQALADRAVARAYGCAANPLRASMVRDPLGLRRNTRDNTPAVLHVELVEGDGLELTVVAKGGGGDVKARYAMLNPSDSVADWVVAQLPGMGAGWCPPGVLGLGVGGSPEQAMALAKRALFMPIDMPELLARGAQDPVERLRIEVHQRVNALRIGAQGLGGDTTVLDVKVATAASHAALLPVALLPNCAATRFVTFTMPDNGPAVLPPPDPAAWDGIPDALPDSAGRRVDLDSLTRAEVASWQAGETLLLSGRLLTGRDAAHKRMDELLGRGEPLPVPLQGRALYYVGPVDPVAGEAVGPAGPTTAARMDKFMPRLLADSGLLVTIGKAERGPLAVQAIQSHGGAYLSAVGGAAYLVSQAVRAARVVAFADLGMEAIYEFEVRDMPVTVAIDARGRSVHAVIPIQAA
>NZ_LN890477.1|WP_148318515.1|6218694_6219675_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD
MKNWLAAITATAAFALTPGAHAQDTYPNRAITWIVPFAAGGPTDAMARNIANRVAQELKQTILIENVGGAGGTIGAAKAAKSTPDGYTFLVGHIGYMAAAPSLYPRLPYDPTRDFQAVFRFPDTPLVLLVGESSPYKSVSELIAFGKQHPGKLNFSNAGVGSTSHLVAAMFASQAGMEITPIAYKGAGPALNDLMGNQVDAMFDQTNTALPQTRGGKVRALGLTSAGAMAQFPNVAPMGEQALPGFQVSTWYGLYAPKGTPDAVVQTLYQAWQKALADKDFTGKMVEQGIQLLPEGQYAPAAFQQFTADEGKRWAGVIKQAGITLQ
>NZ_LN890477.1|WP_049054347.1|6217288_6218644_+|adenylosuccinate-lyase-family-protein
MPVSVLESALFKDMFGTAAMRAVFDDAATVRRYVETEVALARVQGRLGVIPAEAARAIEARADAAALDMALLREETEIVGYPILPLVHQLSRQCGPEGEYLHWGATTQDIMDTATVLQVREALDLVDADLQALDGILDGLAGQYRDTPMAGRTHLQHALPITFGYKAAVWLLMLRRHRERLAQLRPRVLIGQFGGAAGTLASLGEQGLAVHGALMDELGLGAAPVTWHVARDGLAETVQFLALVCGSLGKIAVDIMLMMTNELGEAFEPFVKGRGASSTMPQKRNPISCELMWAASKTVRQHAGLALDAMLQDFERATGPWHIEWSAVPEAFVLTAGSLRQARFMLGGLEVDAARMARNLDLSGGLIVAEAVMMGLAPHIGRQTAHDVVYDACREAATSRRRLADVLREDARVAQRLGADQIERLCDPAHYLGAAPRMVDRMRAHLNPGAA
>NZ_LN890477.1|WP_024069793.1|6229901_6230864_-|DUF4892-domain-containing-protein
MKAHIVKVASLAIVAATLTASPAWAEDVEGSRDHPALTRFEGAEIRAYEHKDYDEALMPDRPVARESEAKGLTLEGKLTRIAYRIDGKKSALEVYRNYQGALQAGGFKTVFECKGDEQCGGDFQSFVLNSGKVSQPGQGDAAFGGKYYVVLAKKEAPTGDIYVFLDVMEDSSNNITPVFQQVIETKPMQTGQVKVLDMAAMQKSLAESGRVAVYGVYFDTDKAEVKAESKAALDEMGKLLNANPKLKVYVVGHTDNQGTLAGNLELSQKRADAVVKALEAGYKIPAARLSARGVASLAPVAANDAEAGRAKNRRVELVAQ
>NZ_LN890477.1|WP_102949912.1|6231016_6231904_-|LysR-family-transcriptional-regulator
MNLLVALDALLAEGSVTGAAERLQLSVPAMSRTLERIRRMMGDPLFVRAGRGLVPTPRAEALREPVRALVAQARELLAQDAAFDLKTLRRVFTIRADDGAVSTLGPALLDTLAKEAPRVTVRFISQGKQDVLSLREGAIDLDIGVIEDMGPEIVRQRLFPDRFVAVFRPANPLARHRKLTPERFARARHATVSRRGVLSGPVDIELGKVGLARHISAVTHSFAEALAITRKSDLVATVPDLLTLHLRDDLQMRALPFDTPAVTISQAWHPRFNEDPAHRAIRQMVHRISLAISGR
>NZ_LN890477.1|WP_165601333.1|6232007_6233507_+|efflux-transporter-outer-membrane-subunit
MIHSKRYRPDARPARRMRLRHAPLAAALAALVAVAGCASHDGLHPAGKPLDLAALDAGRDIAAAVRDTADDAAPWWRAWGDDQLDRLMADALRQAPGVRAAQARLGQAEAVFGSVDANLQPTLDGSATITADRYPGHYTYGAPYADNTGGSGSLLASLRLRLDIWGKWRALADAARLDAEGAALAHADAQLALQQGIAAAYLRLDAAFRLHELARQQRERQRQALELHQTRRQAGLGSDAPVADARGRLARMDAEVERLDREIARQRHALAALAGQAPGYGDALRRPRLALRADPALPAALPARLLGLRPDVLAQRKRLDAADRRIEAAKAEFYPDIDLKAFAGLQSLGLSHLLQGNSLAAGIGPALTLPIFDGGRLRAGLRDRIAGYDLAVADYDATVVRALQEVADGLAGMAQARARRDAARVSLREAGTLARLQAVRASRGLSARQDEIDTDLERLRADSELAAADLDLGLARTALAGALGGRWSPSQSSDNEALK
>NZ_LN890477.1|WP_054439982.1|6233557_6234640_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MLAGGATLLAGAGWAAWTFLAGAATQTTDNAYVNGHVVAITPQVGGAVSAIWADNADRISAGQTLVEVDPADTQIALAGARADLARARRRVQALFASRDQAGAEVARRQAELDRAQADVSARRGIAAQGAITSEEARHAADALNAARAALAVAQAAERAAQAQVDGVTPDTHPDVTLAQERLRAAALDAQRTTIRAPVGGMVAQRSVQLGKHVAIGDKLMAVVPLDQMWIDANFKEIQLAGICPGQPAVVTVDAHGAKVRYRGRVGDVMAGSGSAFALLPSQNATGNWIKVVQRVPVRINLDPKELADHPLRIGLSAEVTVDTARCDPAQAGAARGETTDIYRQQRQAADTLAQAGQGLQ
>NZ_LN890477.1|WP_020928792.1|6234639_6236169_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MSAAPRPIEPMTGLPRVVAAVAISLASFMAVVDITIANVSVPTISGNLGVSPEIGEWAITFFAIANSICIPLTGWLSRRLGQVRLFVLSVAAFTLASVLCGVAQNFESLLAFRVLQGMVSGPIVPLSQALLVAIFPPDKRTLALSMWAMTNMAGPVAGPVLGGWLTDDFSWPWIFLVNAPVGIAVVAVTATMFRGRDTPSTRLPVDLRGLILLAVAIGCLQLTLDRGRTLDWFASPFIVTTALLSALGFVFLVIWELGEAHPIVDLSLFRHRNFAMGTLAVAVGFGLYFAALVLIPLWLQTDMRYTATWAGLATAPMGVFGILLAPLLGRWVQRGDARVFASLAFVAWSLVAWWRASMTTDVGVGLISLACLLQGIGIGLFLTPLVSLSLAGLPPERIAAASGLQTAIRMMAGSLVASLASTYWDERSRYYQNVLVDSATPARPAVQDTLNALAGAGLDEPQSWGVIWNGLKTQADMLALNDFFLWSSLAFALSIALVWLARHPRAAKA
>NZ_LN890477.1|WP_049052507.1|6236204_6236909_+|siderophore-interacting-protein
MQPFSLPRRDVPCIVLRVRDVARDMRRLTLGGPELSAWLARPGVDQPGAWVKVFPPGVPGRAYTLRGIDFEASSVEIDFVVHGDAPGTVSEWARRARPGDAVSIAGPRDGGFSLLADTRWVWLGADASAWPAASRIIESLPGGIQVLGVRHPAGDDDWPAIASARAPQWAARSLPPGGDEPSAPAPDGPGQVWLAGQAAWVKAWRAHWLQRLRFDPARLSAKGYWKAGEQDYKE
>NZ_LN890477.1|WP_053497040.1|6236944_6237835_+|LysR-family-transcriptional-regulator
MKKELDRMRDMALFVQVAALGSLTRAAESTGVPASTLSRRISEFESQIGVKLLHRSTRRLALTDIGQRYLERITDVVDRARAISGELEEEMGRPTGHLRVCAPVDFNAYFPEAALADYCASHPGVRFELHCSAQLPDLATEPYDICIATTEPPRASRMVRRRIGMAEYQLYAAPAYLRAYGVPAHPAELARHRCVVMPDSESGLALTDGNASAQVALAPLLVLNNQLAVENLLRDGLGIGPLTRGRADALVREGALAPVLPGWTLPPRPILALTASRALPARVRGFIDLLVARVVT
>NZ_LN890477.1|WP_082391843.1|6237875_6238649_-|dioxygenase
MRWPTLFVSHGSPMLAVEPGATGPALAAWSRSLGRKPGAILVVSPHWMGHGLALSTRDRQVAWHDFGGFPPELYTLQYAAPGSPELAARVQALLAEGGIAADRDPRRPLDHGAWVPLRYLYPEVDVPVVQLSLDMGRDAAGQLELGRALAPLRDEDVLIIGSGSLTHNLRDVRMPQEAPPAPYVPAFQAWYADRLAAHDVPALLDWQARAPGAAQAHPHDDHLMPLYVALGAGGARATRLTDEISYGALAMDAYAFD
>NZ_LN890477.1|WP_026383342.1|6238893_6240096_+|DUF2863-family-protein
MARSRSQSAPRLTRDATRLITLAQSLNRSGSRVEDVYWENQLGEAIPKLLKAGQDAPLEAALDHLAQGDVGAYEVLIEQAETLSESMKIDKNGVRYDILLIVAPVVAWTRYAIPTGPVPAGAQQALLAQLHGHVLSSQARSALMPHLVSVDQMPRTFSETWQWLQRLGSQALGAETTKPALNTEVETANMLADTRYIVAAVAVPEFAPVFRWQEQIGEADASRDACLAQWAAQAQPTLAGLLPGCGFEALLPDAYYVSNREADRRVRPLSLRAAISWLEGAVSLDASQLRAVIAGCGESRVDEYRVSFTARNSNDVYYGCVWPLYGREEDLPADEGQPDVVDEIAALLKEYGVSDVRRIPGVLPPEYCEDCGAPYFPNPLGELVHAELPEDAEAAPAKFH
>NZ_LN890477.1|WP_024069800.1|6240105_6241221_+|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP
MQADIFCRVVDNYGDIGVCWRLARRLAHGHGWEVRLWVDDLASFARIQPGIDAGLARQAFNGVDIVRWSDAPDPALGARDVVIEAFACDPPEPFLDSMRQRHPAWINLEYLSAEAWVESCHGLPSQRPDGLVKHFYFPGFTPATGGLLREPGLSAERDAFQADTAAQDTFLRGLGVAEAHLSLRHNGARTMSLFCYPDAPVDGLARALAADPRPALLLAPEGVAPGLEAACAMPGGPAVARLPFVAQPDFDRVLWCADLNFVRGEDSFVRAAWAARPLVWQIYPQDENIHLEKLDAWLARYPAPETATALMRAWNQPGAGAATAAALAAALAPPAWQAWARAARDWDAAQAARPDLAENLAGFCAELAKKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LN890477_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LN890477_7

6518209-6518363

Orphan

I-E

Consensus_repeat	Method
CATCGGTCCATCCCCGCTCACGCGGGGAACAC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_LN890477_7

>merge|NZ_LN890477|7|6518209-6518363|CRISPRCasFinder
CTTCGGTTCATCCCCGCTCGCGGGGGGAGACACGCCCAGCACTGCATCATCCCGGCCGACGCCATCGGTCCATCCCCGCTCACGCGGGGAACACTTGTAGATGGCCGCAATTTCTGTGCGGTTCATCGGTTCATCCCCGCTCACGCGGGGAACAC

>NZ_LN890477|7|7|6518209-6518363|CRISPRCasFinder
CTTCGGTTCATCCCCGCTCGCGGGGGGAGACA	CGCCCAGCACTGCATCATCCCGGCCGACGC
CATCGGTCCATCCCCGCTCACGCGGGGAACAC	TTGTAGATGGCCGCAATTTCTGTGCGGTT
CATCGGTTCATCCCCGCTCACGCGGGGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LN890477.1\|WP_054473153.1\|6528705_6529977_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NZ_LN890477.1\|WP_006387591.1\|6525222_6525651_-\|PaaI-family-thioesterase	unknown	unknown	gnl\|CDD\|239527
NZ_LN890477.1\|WP_155873929.1\|6506739_6508434_+\|flagellin-FliC	unknown	unknown	gnl\|CDD\|236140
NZ_LN890477.1\|WP_155873936.1\|6518453_6518780_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890477.1\|WP_054473159.1\|6514064_6514838_+\|cyclase-family-protein	unknown	unknown	gnl\|CDD\|377240
NZ_LN890477.1\|WP_108913913.1\|6512155_6512803_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380065
NZ_LN890477.1\|WP_155873932.1\|6508552_6510043_-\|chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_LN890477.1\|WP_054473160.1\|6513050_6514031_+\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|377562
NZ_LN890477.1\|WP_155873944.1\|6521347_6521896_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890477.1\|WP_020928967.1\|6523686_6525144_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234967
NZ_LN890477.1\|WP_020928962.1\|6511530_6512148_+\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|236807
NZ_LN890477.1\|WP_165596080.1\|6517557_6517710_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890477.1\|WP_020928969.1\|6526901_6527609_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_LN890477.1\|WP_054473158.1\|6514935_6515838_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225787
NZ_LN890477.1\|WP_155873946.1\|6527802_6528675_+\|NAD-binding-protein	unknown	unknown	gnl\|CDD\|224995
NZ_LN890477.1\|WP_155873938.1\|6518911_6520483_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379312
NZ_LN890477.1\|WP_155873942.1\|6520893_6521346_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890477.1\|WP_155873940.1\|6520511_6520832_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LN890477.1\|WP_155873934.1\|6510408_6511374_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_LN890477.1\|WP_054473157.1\|6515920_6517339_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|181288

Protein	Function_ID	Function_description	E-value
NZ_LN890477.1\|WP_054473153.1\|6528705_6529977_-\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.88459e-49
NZ_LN890477.1\|WP_006387591.1\|6525222_6525651_-\|PaaI-family-thioesterase	gnl\|CDD\|239527	cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).	6.09784e-21
NZ_LN890477.1\|WP_155873929.1\|6506739_6508434_+\|flagellin-FliC	gnl\|CDD\|236140	PRK08026, PRK08026, FliC/FljB family flagellin.	4.57866e-162
NZ_LN890477.1\|WP_054473159.1\|6514064_6514838_+\|cyclase-family-protein	gnl\|CDD\|377240	pfam04199, Cyclase, Putative cyclase. Proteins in this family are thought to be cyclase enzymes. They are found in proteins involved in antibiotic synthesis. However they are also found in organisms that do not make antibiotics pointing to a wider role for these proteins. The proteins contain a conserved motif HXGTHXDXPXH that is likely to form part of the active site.	7.64294e-35
NZ_LN890477.1\|WP_108913913.1\|6512155_6512803_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|380065	pfam17939, TetR_C_30, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in the Pseudomonas aeruginosa PsrA which regulates the fadBA5 beta-oxidation operon. Functional analysis of PsrA indicated its importance in regulating b-oxidative enzymes. It has also been suggested that PsrA, a member of the TetR family of repressors, could affect global gene expression including activation of rpoS.	2.3907e-19
NZ_LN890477.1\|WP_054473160.1\|6513050_6514031_+\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|377562	pfam05853, BKACE, beta-keto acid cleavage enzyme. BKACE, beta-keto acid cleavage enzyme plays, a role in lysine degradation. In certain instances it catalyzes the conversion of 3-keto-5-aminohexanoate and acetyl-CoA into acetoacetate and 3-aminobutyryl-CoA. The family is found to have at least 14 slightly different potential new enzymatic activities, all of which can therefore be designated as beta-keto acid cleavage enzymes.	1.99656e-135
NZ_LN890477.1\|WP_020928967.1\|6523686_6525144_+\|hypothetical-protein	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	6.64271e-104
NZ_LN890477.1\|WP_020928962.1\|6511530_6512148_+\|LysE-family-transporter	gnl\|CDD\|236807	PRK10958, PRK10958, leucine export protein LeuE; Provisional.	6.46569e-44
NZ_LN890477.1\|WP_155873932.1\|6508552_6510043_-\|chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	1.59447e-63
NZ_LN890477.1\|WP_020928969.1\|6526901_6527609_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	2.03837e-79
NZ_LN890477.1\|WP_054473158.1\|6514935_6515838_+\|hypothetical-protein	gnl\|CDD\|225787	COG3248, Tsx, Nucleoside-binding outer membrane protein [Cell envelope biogenesis, outer membrane].	0.000374949
NZ_LN890477.1\|WP_155873946.1\|6527802_6528675_+\|NAD-binding-protein	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	1.35384e-79
NZ_LN890477.1\|WP_155873938.1\|6518911_6520483_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.91817e-12
NZ_LN890477.1\|WP_155873934.1\|6510408_6511374_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	9.71174e-136
NZ_LN890477.1\|WP_054473157.1\|6515920_6517339_+\|amidohydrolase-family-protein	gnl\|CDD\|181288	PRK08204, PRK08204, hypothetical protein; Provisional.	7.19044e-164

>NZ_LN890477.1|WP_165596080.1|6517557_6517710_-|hypothetical-protein
MKILCSLALVASLLGGCAVYTPDGAVIVDPHRGGGGGGFCPPGQAKKGNC
>NZ_LN890477.1|WP_054473157.1|6515920_6517339_+|amidohydrolase-family-protein
MRNILLKNGFIISMDPSIGELSGADVLIVDGRIAQVGKNISAEGAEVIDVSGKIVMPGMVDTHRHTWQTQLRAICADMSLEQYMRCIRFSISPVYTPEDVYVGNYIGALEAINAGVTTLYDFSHTSHSPEHADEAIRGLRDAGIRGIYGYGYYPAPVDNPWFATVDQRIADAERVRKHHFSSSSDLLQMGVAITEAGMYPFEIMRREILSGRHMAVPQTIHTNCFWGSAFCSGVERLAAEGLLGPDQIHVHCNTSTDLEMRLLSDNGCRISCTPDTEMQMGMGHPVIGKAVRHNIKPTLGADVISCNGGDLLTQARLGLQDARVLANDALNHLDRMPEDIPFKVRDAIAWMTINGAEAMGLASTIGTLSVGKSADIVVVAPNDFNLAPLNDMMGAVVLQSNVSNIETVLINGKVVKRDGKLVGINFAEAYRIAAQSRDRIMEAAQRRGPLLPPPDQTAMAHMNEMAAANVRK
>NZ_LN890477.1|WP_054473158.1|6514935_6515838_+|hypothetical-protein
MQHRKHLAGLEAYAQAGTATPAGAHHCTPPYLTRGLGMLLFFLGAQPLQAAESFQATSLSLGYSFNAKEDVLYGTGTSNNKAVVGQFEHFSTWGYGDNYFDFEAYHGKNIGDIPALSSHGVNAGSFGSSTSQTYLAIYNGRLSAGRLSGRSLAWGPVKDLYAAARLEGSNYANYRAAMLGLSVDLDVPGASFFETDLYIRSAQFTGNTNAAPNLFSRTYAVFPFRINGMNLSWQPLLLLNFRRDGRGTEVYFRPDLWVDIPGTSLSLGFRPDVHLFGKLPSEGGGRYRRITPTFLARWTF
>NZ_LN890477.1|WP_054473159.1|6514064_6514838_+|cyclase-family-protein
MSRIVDISIHLENEVVSDPPVFAPKITYFDHHATTGELLSFFPGLTKEELPDQEAWAIEKVELITHNGTHLDAPYHFHSTMNGGQRAITIDEVPLDWCYRPGVKLDFRHLPDGHVVSAEEVARELERIHYALQPLDIVVVNTRAGSRYGADDYVSSGCGMGHEATMYLLERGVRLTGTDAWSWDAPFVHTAKRYSESRDASVIWEGHKASRTTGYCHLEKLHNLEALPSHGFRIACFPVKIRGASAGWTRAVAIFPD
>NZ_LN890477.1|WP_054473160.1|6513050_6514031_+|3-keto-5-aminohexanoate-cleavage-protein
MYQPTATAAVSRRERAEMTRKVIITCAVTGAIHTPTMSKYLPITPPQIAEQAVGAAAAGASILHLHARDPIDGRPTADPAVFMRFLPEIKEKTNAIVNLTSGGSTAMSLDERLAAPLLARPEMASLNMGSMNFSIHPLARRIKDWLHPWEKPYVEGTEDTIFRNTFKDITRIMKTLGEGCGTRFEFECYDVGHLYNLASYVDAGLVTPPFLVQTIFGVFGGIGADPENVAYMRQTADRLFGKDYLWSVLGAGRHQMPLATYGSLMGANVRVGLEDSLFLGRNELARSNADQVRKIRSILEHLSLDIATPDEARAMLGLKGRENVGF
>NZ_LN890477.1|WP_108913913.1|6512155_6512803_-|TetR/AcrR-family-transcriptional-regulator
MATKKAGDEKKARNDGAKRERIILAAEKLFAQEGYHGVSMRDIAKQADVGLPLIVYHFETKLNLYRSIFEFRKQVNQNRLAELSRITDFDAADVLEQIVHAFVAPIVRSHANAESPYYAQLVVREASDPQEATRGIIAEHFDPTAIAFIAAFERAMPQASHEYICRAYLFAVGALVMSNFDDRLGRISQGRYTSKSVQKKISMLTQFIAGGIRAG
>NZ_LN890477.1|WP_020928962.1|6511530_6512148_+|LysE-family-transporter
MLGVTDYGAFVLAFIMLLIIPGPGNFALLTATGKGGIKAGLAATCGVILGDQVLMWLAVAGVSALLAAYPTAFHIVQWAGAAYLAWLGLQMMRSKPGAPPRPSRMDNGHYLRQTAMITLLNPKAIMFYMAFFPLFIDPVRHQGLVTFAFMAVTVAALTFLYGLVAVLLTHHLAQRMRANPRVANLLERLAGVFLLGFAVKLAAIR
>NZ_LN890477.1|WP_155873934.1|6510408_6511374_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHPYAKRLLALATLSLAATAQAQSWPTQPIRWIVPYPAGGGTDVLARTVVSGLEKPLGQTVVVENRPGAATIVGATAIAESAPSGYVLGSADIATLAFNPALYNSLTYDPSKFTYIGGLARFPMMLAVNAGSAYKTLDDVLQAARKHPGKLTASSAGTGSPHHLALELFKQRTGADILHVPYKGAAPAIQDLLGNQVDLMFVDLTSALPNIKAGKLRILATATPQRLRDLPDVPTMAEQGVKDYTVYSWQGVVGPKGLPEAVTKKLSAELQAAIRTPAMTQKMADIGVQPMPMSAEEFRAYAEQERQIWAEVIRKAGIKRE
>NZ_LN890477.1|WP_155873932.1|6508552_6510043_-|chemotaxis-protein
MRTASRLLQDSYRRTDRAMLPLLWLLFIVGLCMAPQYGRWAAALIVGGLAAGIPSLLILWLPGRLATRLAVACGLMVLAALHIHLMSGMTEIHFGIFVLLSLLLAYRDWRTILCAALVIAVHHLSFNFLQQWGYGTICFTEPSLGMVLLHATYVVVQAAALGWLAWKMERAGVAAEELARLSAHIGREVGVFDLRFDGQGMHSDLGRSFKTTMDAVHRTMSEVRATATSLSVALSEMMQGNQQLDAHAGTQAESLARTAASMRDLAANVHDNAARAQQARQLTDQARQTVDAGSAAVAGVATMMGEIQQESKKISEIIGLIDSIAFQTNILALNAAVEAARAGESGRGFAVVATEVRALAQRSASAARDIRTLIEGSLHKTSEGFRQADHAAGVIREVVSSIDQAARIVGQIGEAGQTQSADIDAVNLAVSNMDELVRETASEVAQAARASTAQQAQAAALLRAVEVFRLQADPSADAVAAPGARPPSAALTLAGA
>NZ_LN890477.1|WP_155873929.1|6506739_6508434_+|flagellin-FliC
MAAVINTNYLSLVAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGMAIANRFTANVRGLTQASRNANDGISLAQTTEGAAAEITTHLQRVRELAVQAGNGSYSQEQKNSIQDEINQRLADIDRISQQTDFNGVKVLSANAQPLTLQVGANDGETITLNLYEISAKTLGLDGFNVNGSGVTENRSATVSDLQAAGGVTVAANEWQVTTTHAAATADQVFGKLENGNKVTVGTAATGTIYTYDAANKNFTFSDKSASNAASVTTLATTLRPATGTTTGVYTHSNGTSSTSFEVDATGAVKINGTAAFLDAAGNLTTNSAGGTAATLDGVLQAAGGNTAAAGSSSVAINGKTYSNVAGTGVALQFTNTIASDALLANVKAHATANDVTVTLGSGITSATVNFTAGTSTNTFVDDKSAFTTLANYTTNYAVDPNNGKVTVKSGTGSGDYAPKIGEEAKVSSGGKLTTDATSKGSLTEDPLKTLDAAFTVLNKLTGELGAVQNRLESTIANLDNVVNNLSSARSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQVPQTVLSLLR
>NZ_LN890477.1|WP_155873936.1|6518453_6518780_-|hypothetical-protein
MTGDPPGISQDTKAILAALHEMQAAASRDTNARFEAMQKEMLAISAAVKTGFPGGDFDGHRRYHELVIEREEQRREFWRGLALHVAKTSTWAVLAGLSFYLVPLIIVA
>NZ_LN890477.1|WP_155873938.1|6518911_6520483_+|methyltransferase-domain-containing-protein
MSFTKNARPSSPFAYDRPVSERLDPVQRPASVFSLQHNRCAHYINDFDPASDLVSVPCGKQTRETVVMLRPGQHVLTHAVQIGSEHVIDISLCAEGGDATSLPTTLSLRHVDEAGVSREILSFHVHTKDPAHRHEMQIALPHLFGVAARFSLGIRRTDRPTSSVGISRFLICPKLSVERVNALTNYGLRTRNELANFSGNSYTHSMYGEAAAHGDGTHLVEKLSTRTEATAHFATEQEKKLRAKLDLVHPNADEPIYNLALRCLSLVLPLEAPDFFSYIARASKDKPLRVLSLCSGAARIEEQMLTHAVNSIDLTLFDVSEPLIQRAASRINQPRHNIRYLVGDINNGIPTNETYDVIVCVSALHHVVELELLLAQINERLAPDGQFWNLGEQIGRNGNRLWPEGLQAANIAFSKLPEHLRVNAITKKPDGELPDDDFSINCFEGIRSESLEAMLDRFLLPVHVYKRNCFLWRLTDSMYCDNYSLSSKEDLRHLKDLVVAEAMHWLQGGRATEMHAVYKRREF
>NZ_LN890477.1|WP_155873940.1|6520511_6520832_-|hypothetical-protein
MVDAMNSIGFAVRIRNSTGGVGGTAVNWTAMGTWKQGRNMKFYYSNETKGFYLDEMHGQNIPGDATALKDGEHEKALAWQGVGGLIAGVNSDGTMLLKKVQEERQS
>NZ_LN890477.1|WP_155873942.1|6520893_6521346_-|hypothetical-protein
MTQSSIAISTTPPLPGLQLVEQANGALETIATDFAGATDPASFAGPYMTWADTGTGTLWRRNAAGSAWVEIGRVLDRSFYAADVASTAQAQALTSDAVLLTPKKLDDAFGGANQSLGANTFYQKFPGGLLIQGGLVFASTADFAITFPVF
>NZ_LN890477.1|WP_155873944.1|6521347_6521896_-|hypothetical-protein
MDIGYATPVRIDFEIDEYALNFSEDVLSYVDVFAVADILNDSNRQRYQVRPQIQFAQDDGVYGEWQDYIPGTVNARYFRVRLVLQTDDPMIVPFVRHFSWTIDVPDLVQTGTGVIVPSAGLRITYPKTFHAKPNLQVTTLDAVDGDRAVIQQVTDPLLGFNVQIFNNSTPVERVINWLAQGY
>NZ_LN890477.1|WP_020928967.1|6523686_6525144_+|hypothetical-protein
MDRIHELLTAYWPHMVFGISVVAGTGAAVHAAMTKQDVRSAIGWVGLALFSPLFGAAAYFVAGINRIRKTRLSQQRDEAMLVDAALVETPSVDVAPISGPQFASLKVLGDQVSRFRLLGGNAVRPLAGGDEAYPAMLQAIREARHAVAMQSYIFDNDAIGREMAQALIEAHGRGVQVRVLIDAIGAKYSRPPIVRMLARGGVPVARFMTNPLGVLRMPYANLRSHRKVLVVDGRIGFTGGMNVRAAFVTALSGAATNVDTHFRVEGPIVTQLMSVFAHDWNFTTHESLPARPWFDPHAQPVHGVVPMRCVPSGPDRAMGSAHSIILGALAVAQRHVRIQSPYFLPDQPLIGALATAARRGVIVDIVIPGKNNLRLVDYAMTAQLDQVVRTGCRVWRSRGAFDHSKLMTVDDGWAYVGSSNLDPRSLRLNFELDTEIYDPQVACWIGARIDALVADARRQTLDELQQAPFAKRLRNKVIWLATPYL
>NZ_LN890477.1|WP_006387591.1|6525222_6525651_-|PaaI-family-thioesterase
MTDTIPAGFAPWQPSSQFMRHLADLGGFYRRAADDVLAMRIGAAHGNMHGMAHGGLLATLADSALGYVIAHQCQASVVTAQMSVEYLNAVMPGDWLEAHVTIDKRGKRLIYATCHLKVDERLVLKASAVFAVRQAAVPTSDG
>NZ_LN890477.1|WP_020928969.1|6526901_6527609_+|fumarylacetoacetate-hydrolase-family-protein
MTQSVQTPFAVPQTTVPIAGGDLRFPVRRIYCIGRNYAAHAIEMGSDPSREAPFFFQKPTDAIQVVLPDTVADHPYPPLTQNYHYEVELVAALSQGGRDIPVERALDCVYGYALGLDMTRRDLQRGMGDQKKPWEIGKSFDHAAPIGPIHPVSQTGHYKEGSIWLAVNGERKQQATLSHMIWSVAEQIARLSQAFELFPGDLIYSGTPENVGPVVRGDVIVAHVDGLPELSIRIV
>NZ_LN890477.1|WP_155873946.1|6527802_6528675_+|NAD-binding-protein
MAKIGMVGIGLMGHGIASNLVKHGHTLTVLEHPGNQPLDALKAAGATSCADGATLAAQSDVIILCVTGSPQVEAVLLSPGGMLEGLRPGTVIIDCSTAIPSSTVKVAEAVTEKGGRFLDAPMTRTPKEAAEGRLNLLVGGDKALFEECKPILACFAENIAHAGPVGAGHRMKLLHNYVSLGAIALLSEAAACALRADIDPAVFAEVLTKGGGGGVALERLKPYLLEQDPSSLRFFMSNAQKDLSYYNTMAAETGAVREIGAAVLHTYDQAVSQGGGERYVPELVSLLKDR
>NZ_LN890477.1|WP_054473153.1|6528705_6529977_-|MFS-transporter
MDKQASGGWYFGWNIVGAATVLTLLTVGLRMGIGPFFLPMADGLGFSRSLLSGIVAVGMLCYGLGMPLAGYLVSTRGTRFVLLTGTAIVVASSIWTVFARGPIEFLLAFGVALSIGLAFTSPVALTPVISRWFTRQRGMALFFLSTGSMAGIALMTPTLTFAIGAVGWQETLLAFAVLFALLTVPVALFVMRDQAPEHTDLLPHQIVERKAGARPAAKAPDLRVGDAVRTLPFWQVALGLFACGFSMNLLGTHGMPMLMDHGFDATTSSLGIGLIGLVAIFSTLVLGRMSDQVERRSILAVIYLVRGLGFFALVMVGAHWELYAAATIGGVVWAGSIALSSAILADVYGVRLVGVLYGLTYLGHQVGGMISSWLGGWAFETFHTHWVAFGAAGALLLLAAAISLQLPRRGALRAVPAMAAGGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_LN890477_7	7.2\|6518303\|29\|NZ_LN890477\|CRISPRCasFinder	6518303-6518331	29	NZ_LN890477.1	6443537-6443565	1	0.966

1. spacer 7.2|6518303|29|NZ_LN890477|CRISPRCasFinder matches to position: 6443537-6443565, mismatch: 1, identity: 0.966

ttgtagatggccgcaatttctgtgcggtt	CRISPR spacer
ttgtagatggccgcaatttccgtgcggtt	Protospacer
********************.********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP029096	Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence	209006-209035	5	0.833
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	501095-501124	5	0.833
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	198335-198364	5	0.833
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP015879	Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence	99442-99471	5	0.833
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	280797-280826	5	0.833
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP048608	Pseudomonas fluorescens strain DR133 plasmid unnamed, complete sequence	21988-22017	5	0.833
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_LT222313	Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence	79784-79813	5	0.833
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_LT963400	Pseudomonas cerasi isolate PL963 plasmid PP5, complete sequence	14551-14580	5	0.833
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP039294	Pseudomonas aeruginosa strain PABL048 plasmid pPABL048, complete sequence	1925-1954	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP044976	Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence	303017-303046	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	115791-115820	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	271434-271463	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	279703-279732	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_KU130294	Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence	169217-169246	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	164938-164967	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	172893-172922	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	168439-168468	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	235413-235442	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP011053	Halomonas sp. KO116 plasmid unnamed1, complete sequence	301272-301301	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	11326-11355	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	347618-347647	6	0.8
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	MF344571	Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence	168960-168989	7	0.767
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	MF344568	Pseudomonas aeruginosa plasmid p727-IMP, complete sequence	181765-181794	7	0.767
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	173988-174017	7	0.767
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	CP027478	Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence	284459-284488	7	0.767
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	175235-175264	7	0.767
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_LT969519	Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1	83121-83150	7	0.767
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	50662-50691	7	0.767
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP040126	Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence	57993-58022	7	0.767
NZ_LN890477_7	7.1\|6518241\|30\|NZ_LN890477\|CRISPRCasFinder	6518241-6518270	30	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	136128-136157	7	0.767
NZ_LN890477_4	4.1\|3230003\|31\|NZ_LN890477\|CRISPRCasFinder	3230003-3230033	31	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	552130-552160	8	0.742
NZ_LN890477_7	7.2\|6518303\|29\|NZ_LN890477\|CRISPRCasFinder	6518303-6518331	29	MK552327	Pseudomonas phage Psa21, complete genome	96927-96955	8	0.724

1. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP029096 (Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
agcgaagcactgcatcatcccggccgcggc	Protospacer
 **  *********************  **

2. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
agcgaagcactgcatcatcccggccgcggc	Protospacer
 **  *********************  **

3. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
agcccagcactgcgtcatcccggcggcggc	Protospacer
 ************.********** *  **

4. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP015879 (Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
agcgaagcactgcatcatcccggccgcggc	Protospacer
 **  *********************  **

5. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
agcgaagcactgcatcatcccggccgcggc	Protospacer
 **  *********************  **

6. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP048608 (Pseudomonas fluorescens strain DR133 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
ggcccagcactgcattatcccggcggcggc	Protospacer
 **************.******** *  **

7. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_LT222313 (Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf plasmid p58T1, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
cgcccaacactgcatcatccctgcggtggc	Protospacer
******.************** ** *  **

8. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_LT963400 (Pseudomonas cerasi isolate PL963 plasmid PP5, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
cgcccaacactgcatcatccctgcggtggc	Protospacer
******.************** ** *  **

9. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP039294 (Pseudomonas aeruginosa strain PABL048 plasmid pPABL048, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcatcccggccgcagc	Protospacer
  *  *********************  **

10. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP044976 (Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
cgggcagcgctgcatcatccctgccgactg	Protospacer
**  ****.************ ******

11. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
caccaccgacagcatcatcccggccgacgc	Protospacer
*.**    ** *******************

12. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
caccaccgacagcatcatcccggccgacgc	Protospacer
*.**    ** *******************

13. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
caccaccgacagcatcatcccggccgacgc	Protospacer
*.**    ** *******************

14. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_KU130294 (Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
ggcgaagcattgcatcatcccggccgcggc	Protospacer
 **  ****.****************  **

15. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
ggcgaagcattgcatcatcccggccgcggc	Protospacer
 **  ****.****************  **

16. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
ggcgaagcattgcatcatcccggccgcggc	Protospacer
 **  ****.****************  **

17. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
ggcgaagcattgcatcatcccggccgcggc	Protospacer
 **  ****.****************  **

18. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
ggcgaagcattgcatcatcccggccgcggc	Protospacer
 **  ****.****************  **

19. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP011053 (Halomonas sp. KO116 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
agcgcagcactgcatcatccccgcggcggc	Protospacer
 ** ***************** ** *  **

20. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
ggcgaagcattgcatcatcccggccgcggc	Protospacer
 **  ****.****************  **

21. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
ggcgaagcattgcatcatcccggccgcggc	Protospacer
 **  ****.****************  **

22. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to MF344571 (Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcattccggccgctgc	Protospacer
  *  *************.******* .**

23. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to MF344568 (Pseudomonas aeruginosa plasmid p727-IMP, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcattccggccgctgc	Protospacer
  *  *************.******* .**

24. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcattccggccgctgc	Protospacer
  *  *************.******* .**

25. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to CP027478 (Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcattccggccgctgc	Protospacer
  *  *************.******* .**

26. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcattccggccgctgc	Protospacer
  *  *************.******* .**

27. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_LT969519 (Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgtatcatcccggccgcagc	Protospacer
  *  *******.*************  **

28. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcattccggccgctgc	Protospacer
  *  *************.******* .**

29. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP040126 (Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcattccggccgctgc	Protospacer
  *  *************.******* .**

30. spacer 7.1|6518241|30|NZ_LN890477|CRISPRCasFinder matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccagcactgcatcatcccggccgacgc	CRISPR spacer
gtcgaagcactgcatcattccggccgctgc	Protospacer
  *  *************.******* .**

31. spacer 4.1|3230003|31|NZ_LN890477|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

ttcgatcgtgccccaggcgtcgttggccagt	CRISPR spacer
cttgcccgagccccaggggtcgttggccatg	Protospacer
.*.* .** ******** ***********

32. spacer 7.2|6518303|29|NZ_LN890477|CRISPRCasFinder matches to MK552327 (Pseudomonas phage Psa21, complete genome) position: , mismatch: 8, identity: 0.724

ttgtagatggccgcaatttctgtgcggtt	CRISPR spacer
ttgttgatggcggcaatttctgtctctac	Protospacer
**** ****** *********** .   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

30297 : 141822

126

Burkholderia_virus(25.53%)

holin,integrase,terminase,portal,capsid,tail,plate,head

attL 67929:67975|attR 107732:107778

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054498492.1\|30297_32250_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_006384047.1\|32491_33217_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_049055496.1\|33368_34049_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_053498776.1\|34085_35750_-	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
WP_155871262.1\|35804_37334_-	amidase	NA	NA	NA	NA
WP_024068303.1\|37522_38902_-	DNA recombination protein RmuC	NA	NA	NA	NA
WP_049058827.1\|39067_39802_+	hypothetical protein	NA	NA	NA	NA
WP_006384053.1\|39838_40564_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_006384054.1\|40568_40925_-	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_006384055.1\|40921_41731_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_070780632.1\|41727_42648_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_006384057.1\|42644_43772_-	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.2e-23	35.7
WP_006384058.1\|43777_44881_-	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038503137.1\|45031_45763_-	3-deoxy-D-manno-octulosonic acid kinase	NA	NA	NA	NA
WP_082392015.1\|45752_46175_-	group II truncated hemoglobin	NA	NA	NA	NA
WP_155871264.1\|46174_48706_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_006388529.1\|48831_49806_+	TRAP transporter substrate-binding protein DctP	NA	NA	NA	NA
WP_006388528.1\|49917_50418_+	TRAP transporter small permease	NA	NA	NA	NA
WP_006388527.1\|50451_51729_+	TRAP transporter large permease	NA	NA	NA	NA
WP_006388526.1\|51850_52141_-	DUF3579 domain-containing protein	NA	NA	NA	NA
WP_006388525.1\|52286_53468_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.4e-22	29.0
WP_026382721.1\|53524_54466_+	ornithine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	5.2e-17	24.9
WP_083301386.1\|54531_55419_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_054505103.1\|55442_56006_-	hypothetical protein	NA	NA	NA	NA
WP_049051011.1\|56018_56549_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_155871266.1\|56551_57508_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_173361318.1\|57566_58433_-	amidohydrolase family protein	NA	NA	NA	NA
WP_024068290.1\|58559_59489_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006388517.1\|59611_60952_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	1.5e-54	80.2
WP_006388516.1\|61366_63295_-	potassium transporter Kup	A7K9V6	Acanthocystis_turfacea_chlorella_virus	3.1e-72	32.5
WP_020924430.1\|63291_64317_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.5e-14	27.9
WP_024068289.1\|64493_65165_-	response regulator transcription factor	NA	NA	NA	NA
WP_006388514.1\|65230_65710_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_024068288.1\|65709_66699_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_038503127.1\|66700_67498_-	energy transducer TonB	NA	NA	NA	NA
67929:67975	attL	NA	NA	NA	NA
WP_155871268.1\|68123_68816_+	SOS response-associated peptidase family protein	A0A2H4J5W2	uncultured_Caudovirales_phage	7.5e-37	39.0
WP_155871270.1\|68799_68994_-	hypothetical protein	NA	NA	NA	NA
WP_155871271.1\|69082_69376_+	hypothetical protein	NA	NA	NA	NA
WP_155871273.1\|69385_69604_+	hypothetical protein	NA	NA	NA	NA
WP_155871275.1\|69706_69940_+	hypothetical protein	NA	NA	NA	NA
WP_155874023.1\|70046_70430_-	hypothetical protein	NA	NA	NA	NA
WP_155871276.1\|70444_70936_-	hypothetical protein	I6NSS1	Burkholderia_phage	1.7e-43	59.3
WP_006387653.1\|70938_71379_-	hypothetical protein	A0A0U5LBV3	unidentified_phage	1.2e-08	35.2
WP_155871278.1\|71473_72139_-	hypothetical protein	NA	NA	NA	NA
WP_155871280.1\|72138_72429_-	hypothetical protein	NA	NA	NA	NA
WP_155871282.1\|72430_75598_-	DUF1983 domain-containing protein	Q6JIL2	Burkholderia_virus	2.4e-263	46.0
WP_155871284.1\|75594_76200_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	1.2e-51	55.0
WP_155871286.1\|76203_76977_-	Mov34/MPN/PAD-1 family protein	A4JX14	Burkholderia_virus	6.5e-66	51.3
WP_155871288.1\|76979_77708_-\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	2.5e-67	56.6
WP_155874025.1\|77717_78092_-	hypothetical protein	NA	NA	NA	NA
WP_155871290.1\|79449_79788_-\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	2.7e-32	57.1
WP_155871292.1\|79796_83297_-	tape measure protein	A4JX10	Burkholderia_virus	2.0e-69	45.7
WP_155871294.1\|83342_83642_-	DUF4035 domain-containing protein	A0A1B5FP87	Escherichia_phage	6.7e-11	43.9
WP_155871296.1\|83641_84091_-\|tail	phage tail protein	Q6JIM0	Burkholderia_virus	3.0e-23	43.5
WP_155871298.1\|84094_84562_-	hypothetical protein	S4TNM8	Salmonella_phage	1.6e-19	39.2
WP_155871300.1\|84621_84972_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_155871302.1\|84968_85448_-	HK97 gp10 family phage protein	K7P6X4	Enterobacteria_phage	6.8e-13	36.2
WP_173361319.1\|85444_85762_-\|head	phage head closure protein	NA	NA	NA	NA
WP_155871307.1\|85778_86318_-	hypothetical protein	A4JX03	Burkholderia_virus	2.8e-31	43.7
WP_173361320.1\|86320_86491_-	hypothetical protein	NA	NA	NA	NA
WP_155871309.1\|86555_87881_-\|capsid	phage major capsid protein	Q8W6U5	Burkholderia_virus	1.5e-155	69.2
WP_155871311.1\|87944_88901_-	S49 family peptidase	A4JX00	Burkholderia_virus	1.2e-85	56.7
WP_155871313.1\|88897_90154_-\|portal	phage portal protein	A4JWZ9	Burkholderia_virus	3.4e-136	55.3
WP_155871315.1\|90157_90352_-	hypothetical protein	NA	NA	NA	NA
WP_155871317.1\|90348_92037_-\|terminase	terminase large subunit	S4TSQ6	Salmonella_phage	1.3e-130	46.0
WP_155871319.1\|92033_92627_-\|terminase	terminase small subunit	A0A2K9V3C4	Faecalibacterium_phage	5.8e-14	36.4
WP_155871321.1\|92819_93158_-	HNH endonuclease	B5WZZ4	Pseudomonas_phage	2.2e-26	54.3
WP_155874027.1\|93319_93742_-	hypothetical protein	NA	NA	NA	NA
WP_155874029.1\|93891_94305_-	hypothetical protein	NA	NA	NA	NA
WP_155871323.1\|94516_95500_-	hypothetical protein	Q8W6P0	Burkholderia_virus	5.3e-36	42.8
WP_155871325.1\|95496_95985_-	DUF1364 family protein	NA	NA	NA	NA
WP_155871327.1\|96258_96564_-	hypothetical protein	A0A1J0GUZ1	Halomonas_phage	8.7e-06	32.1
WP_155871329.1\|96557_97073_-	hypothetical protein	B7SYH6	Stenotrophomonas_phage	3.6e-28	40.5
WP_155871331.1\|97337_97559_+	hypothetical protein	NA	NA	NA	NA
WP_155874031.1\|97978_98662_+	helix-turn-helix domain-containing protein	H2BDH4	Pseudomonas_virus	3.3e-21	32.5
WP_155871333.1\|99077_99281_+	hypothetical protein	A0A0M3MWN3	Stenotrophomonas_phage	8.6e-10	57.4
WP_155871335.1\|99316_99514_+	hypothetical protein	NA	NA	NA	NA
WP_155871337.1\|99555_99741_+	hypothetical protein	NA	NA	NA	NA
WP_155871339.1\|99751_100363_+	hypothetical protein	NA	NA	NA	NA
WP_155871341.1\|100647_100881_+	hypothetical protein	NA	NA	NA	NA
WP_155871343.1\|101185_102085_+	recombination-associated protein RdgC	B5AX95	Iodobacteriophage	6.9e-35	31.0
WP_155871345.1\|102099_103095_+	hypothetical protein	A1YZR3	Burkholderia_virus	1.5e-54	40.5
WP_155871347.1\|103528_103945_+	hypothetical protein	NA	NA	NA	NA
WP_155871349.1\|103941_104322_+	hypothetical protein	NA	NA	NA	NA
WP_155871351.1\|104893_105322_+	hypothetical protein	NA	NA	NA	NA
WP_155871353.1\|105314_105719_+	hypothetical protein	NA	NA	NA	NA
WP_155871355.1\|105702_106011_+	hypothetical protein	NA	NA	NA	NA
WP_155874033.1\|106204_106522_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155874035.1\|106442_107558_-\|integrase	tyrosine-type recombinase/integrase	A0A1L7DQ84	Ralstonia_phage	1.3e-22	29.7
WP_003812968.1\|107954_108227_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	1.1e-20	57.8
107732:107778	attR	NA	NA	NA	NA
WP_006388510.1\|108660_109341_-	Fe2+-dependent dioxygenase	Q5GQB0	Synechococcus_phage	3.8e-17	29.1
WP_024068286.1\|109395_110640_-	cystathionine gamma-synthase family protein	NA	NA	NA	NA
WP_155871357.1\|110691_111429_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_026384162.1\|111562_114028_-	ribonuclease R	Q0GXV6	Lactococcus_phage	7.4e-63	31.2
WP_006388506.1\|114590_115202_-	DTW domain-containing protein	NA	NA	NA	NA
WP_006388505.1\|115619_116063_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_155871359.1\|116181_117090_+	EamA family transporter	NA	NA	NA	NA
WP_054499332.1\|117121_118066_+	AEC family transporter	NA	NA	NA	NA
WP_155871361.1\|118235_119459_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_049054401.1\|119648_121319_+	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_024068279.1\|121350_122730_-	cardiolipin synthase B	NA	NA	NA	NA
WP_006388499.1\|122828_123161_-	DUF883 domain-containing protein	NA	NA	NA	NA
WP_020924444.1\|123539_124517_+	L-histidine N(alpha)-methyltransferase	NA	NA	NA	NA
WP_024068277.1\|124554_125871_+	ergothioneine biosynthesis protein EgtB	NA	NA	NA	NA
WP_020924446.1\|126273_127185_-	hypothetical protein	NA	NA	NA	NA
WP_006388491.1\|127344_127536_-	hypothetical protein	NA	NA	NA	NA
WP_006388490.1\|127665_127920_-	hypothetical protein	NA	NA	NA	NA
WP_006388489.1\|128167_128359_+	hypothetical protein	NA	NA	NA	NA
WP_053514660.1\|128377_129286_-	aromatic amino acid DMT transporter YddG	NA	NA	NA	NA
WP_026384169.1\|129457_129718_+	hypothetical protein	NA	NA	NA	NA
WP_054437215.1\|129752_131330_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_054437212.1\|131672_131945_-	hypothetical protein	NA	NA	NA	NA
WP_054437210.1\|131925_132456_-	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	5.3e-43	57.4
WP_164497481.1\|132445_132937_-	hypothetical protein	A0A0U5LBV3	unidentified_phage	6.3e-14	37.2
WP_080684492.1\|133098_133647_-\|tail	tail fiber assembly protein	A0A2H4J9Z7	uncultured_Caudovirales_phage	1.0e-12	52.9
WP_155871363.1\|133559_134591_-\|tail	tail fiber protein	A0A0M3ULD8	Salmonella_phage	6.3e-16	54.1
WP_054496611.1\|134605_135271_-	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	2.1e-73	60.2
WP_054496612.1\|135272_136454_-\|plate	baseplate J/gp47 family protein	A9YX12	Burkholderia_phage	3.4e-130	62.8
WP_020924456.1\|136450_136804_-	hypothetical protein	A9YX11	Burkholderia_phage	6.1e-35	66.7
WP_155871366.1\|136812_137556_-	hypothetical protein	A9YX06	Burkholderia_phage	3.3e-83	63.5
WP_054505127.1\|137590_138601_-	hypothetical protein	A9YX04	Burkholderia_phage	1.7e-77	52.6
WP_006388474.1\|138620_138920_-	hypothetical protein	NA	NA	NA	NA
WP_026384173.1\|138929_139529_-	hypothetical protein	NA	NA	NA	NA
WP_155871368.1\|139521_141195_-\|tail	phage tail protein	NA	NA	NA	NA
WP_006393814.1\|141187_141346_-	hypothetical protein	NA	NA	NA	NA
WP_024068262.1\|141372_141822_-	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	1.1e-17	36.5

DBSCAN-SWA_2

844301 : 882297

Escherichia_phage(22.22%)

integrase,transposase

attL 876964:877023|attR 881529:882349

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023103875.1\|844301_846245_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0U1UNT3	Pseudomonas_phage	2.1e-97	48.2
WP_020924940.1\|846282_847251_-	Dyp-type peroxidase	NA	NA	NA	NA
WP_023106332.1\|847369_848023_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_009459591.1\|848142_848436_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023103878.1\|848458_849349_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023093406.1\|849833_851048_-	glutathione-independent formaldehyde dehydrogenase	NA	NA	NA	NA
WP_028698648.1\|851514_852456_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024086516.1\|852904_853885_+\|transposase	IS5-like element ISPa26 family transposase	A0A077K814	Ralstonia_phage	3.2e-94	56.7
WP_023835768.1\|854137_854569_+	DUF488 domain-containing protein	NA	NA	NA	NA
WP_028690943.1\|854944_856921_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_023103881.1\|857071_857977_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023103882.1\|858131_858539_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_028690944.1\|858540_859149_+	GNAT family acetyltransferase	NA	NA	NA	NA
WP_028690945.1\|859145_860036_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_028690946.1\|860318_860594_+	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_011871467.1\|860653_861763_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.9e-35	30.4
WP_023103885.1\|861806_862205_+	VOC family protein	NA	NA	NA	NA
WP_023464791.1\|862387_863722_+	DUF3422 family protein	NA	NA	NA	NA
WP_023464790.1\|863780_864611_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_028690947.1\|864629_865937_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_028690948.1\|865988_867302_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.3e-77	40.2
WP_028690949.1\|867362_869228_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	3.4e-52	37.1
WP_028690950.1\|869253_871905_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	5.2e-155	33.9
WP_028690951.1\|871985_873830_-	TraI domain-containing protein	NA	NA	NA	NA
WP_155871564.1\|874149_874776_+\|integrase	integrase	NA	NA	NA	NA
WP_028690952.1\|874788_875421_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_028690953.1\|875505_875871_+	DUF3742 family protein	NA	NA	NA	NA
WP_000480968.1\|875994_876831_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
876964:877023	attL	NA	NA	NA	NA
WP_001067855.1\|877027_877732_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000015696.1\|878089_878368_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_071533317.1\|878393_878579_+	hypothetical protein	NA	NA	NA	NA
WP_002310911.1\|878575_878914_-	hypothetical protein	NA	NA	NA	NA
WP_001297013.1\|878817_880008_-	tetracycline efflux MFS transporter Tet(C)	A0A2H4UVM2	Bodo_saltans_virus	8.1e-07	24.0
WP_001038045.1\|880100_880760_+	tetracycline resistance transcriptional repressor TetR(C)	NA	NA	NA	NA
WP_001067855.1\|881592_882297_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
881529:882349	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2704404 : 2722122

Burkholderia_virus(33.33%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054470655.1\|2704404_2705862_+	DUF1254 domain-containing protein	M1IA53	Paramecium_bursaria_Chlorella_virus	6.8e-64	35.4
WP_053497387.1\|2705914_2706610_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_102949899.1\|2706906_2707476_+	hypothetical protein	NA	NA	NA	NA
WP_006385689.1\|2707726_2708194_+	hypothetical protein	NA	NA	NA	NA
WP_054439097.1\|2708199_2708673_+\|tail	phage tail protein	Q3HQT7	Burkholderia_phage	7.1e-23	39.9
WP_054439099.1\|2708672_2708963_+	DUF4035 domain-containing protein	S4TND7	Salmonella_phage	2.7e-12	48.2
WP_076467933.1\|2709020_2710307_+\|tail	phage tail tape measure protein	A0A1W6JP49	Morganella_phage	1.6e-13	30.3
WP_054472578.1\|2710309_2710648_+\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	6.4e-26	48.6
WP_155872205.1\|2710653_2713290_+\|tail	tail fiber domain-containing protein	A0A1B1IX43	uncultured_Mediterranean_phage	4.7e-15	42.9
WP_054472580.1\|2713292_2714021_+\|tail	phage minor tail protein L	A4JX13	Burkholderia_virus	1.7e-68	56.6
WP_054482521.1\|2714023_2714803_+	C40 family peptidase	A4JX14	Burkholderia_virus	5.0e-66	49.0
WP_006385697.1\|2714799_2715405_+\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	1.0e-50	55.7
WP_054472643.1\|2715530_2719034_+	host specificity protein J	A4JX16	Burkholderia_virus	2.2e-262	45.3
WP_054472581.1\|2719038_2719404_+	hypothetical protein	NA	NA	NA	NA
WP_035199492.1\|2719384_2719621_+	hypothetical protein	NA	NA	NA	NA
WP_006385701.1\|2719617_2720214_+\|tail	tail assembly protein	C7BGD3	Burkholderia_phage	1.9e-49	53.0
WP_026382512.1\|2720355_2721285_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155872207.1\|2721303_2722122_-	3-oxoacyl-ACP reductase FabG	W8CYX9	Bacillus_phage	1.4e-10	49.3

DBSCAN-SWA_4

2828302 : 2853068

Salmonella_phage(57.14%)

integrase,transposase

attL 2831772:2831788|attR 2839470:2839486

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003159550.1\|2828302_2828503_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.2e-18	68.9
WP_003158660.1\|2828685_2831601_-\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA
2831772:2831788	attL	NA	NA	NA	NA
WP_003124096.1\|2834481_2835042_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	2.1e-50	88.6
WP_033865223.1\|2835172_2835376_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_000845048.1\|2835566_2836580_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_023835631.1\|2836681_2837665_+	dihydropteroate synthase	NA	NA	NA	NA
WP_000214125.1\|2837881_2839096_+	chloramphenicol/florfenicol efflux MFS transporter FloR2	S4TR35	Salmonella_phage	9.8e-16	23.7
WP_155872237.1\|2839261_2842147_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	9.3e-190	39.9
2839470:2839486	attR	NA	NA	NA	NA
WP_023434504.1\|2842272_2842941_+	recombinase family protein	E5FFF9	Burkholderia_phage	5.5e-37	48.1
WP_001082319.1\|2842952_2843756_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	4.9e-24	34.3
WP_000480968.1\|2843755_2844592_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_173361396.1\|2844715_2844781_+	hypothetical protein	NA	NA	NA	NA
WP_000163574.1\|2844777_2845404_-	tetracycline resistance transcriptional repressor TetR(G)	NA	NA	NA	NA
WP_001257840.1\|2845507_2846683_+	tetracycline efflux MFS transporter Tet(G)	NA	NA	NA	NA
WP_001253717.1\|2846703_2847495_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155874106.1\|2847586_2848969_-\|transposase	transposase	NA	NA	NA	NA
WP_052437149.1\|2849110_2849974_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_039843394.1\|2850009_2850765_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_155872239.1\|2851538_2853068_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

3537596 : 3581465

Ralstonia_phage(20.59%)

integrase,holin,terminase,portal,capsid,tail,tRNA,plate,head

attL 3527849:3527867|attR 3571388:3571406

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3527849:3527867	attL	NA	NA	NA	NA
WP_155874137.1\|3537596_3539219_+\|tail	phage tail protein	A0A0B5A509	Achromobacter_phage	3.9e-76	60.5
WP_155872481.1\|3539352_3540960_+\|tail	phage tail protein	A0A0B5A509	Achromobacter_phage	1.8e-49	56.1
WP_155872484.1\|3541002_3541989_-	TRAP transporter substrate-binding protein DctP	NA	NA	NA	NA
WP_006385528.1\|3542240_3543434_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_006385527.1\|3543566_3545249_-	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	2.9e-26	23.2
WP_006385526.1\|3545416_3546322_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.4e-19	28.6
WP_024070116.1\|3546447_3547431_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.9e-26	33.6
WP_026383153.1\|3547497_3547986_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_006385523.1\|3548133_3548712_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_006385522.1\|3548862_3549891_-	alcohol dehydrogenase AdhP	A0A2P1EIJ9	Megavirus	7.9e-35	29.1
WP_006385521.1\|3550102_3550492_+	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_026383152.1\|3550628_3551426_-	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
WP_006390766.1\|3552469_3553498_+\|integrase	site-specific integrase	A0A2D1GMX8	Marinobacter_phage	1.6e-56	38.8
WP_083827922.1\|3553494_3553713_-	hypothetical protein	NA	NA	NA	NA
WP_173361348.1\|3553771_3555601_-	DNA cytosine methyltransferase	L7TH64	Pseudomonas_virus	3.6e-179	53.9
WP_054448001.1\|3555600_3555870_-	hypothetical protein	NA	NA	NA	NA
WP_155874139.1\|3555866_3558542_-	toprim domain-containing protein	A0A077K8T2	Ralstonia_phage	1.4e-269	53.3
WP_054479074.1\|3558571_3558805_-	hypothetical protein	NA	NA	NA	NA
WP_155872487.1\|3558890_3559277_-	hypothetical protein	NA	NA	NA	NA
WP_173361349.1\|3559269_3559557_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_167334262.1\|3559553_3559781_-	hypothetical protein	NA	NA	NA	NA
WP_155872493.1\|3559860_3560265_+	helix-turn-helix domain-containing protein	K4NXA8	Burkholderia_phage	1.2e-13	60.6
WP_155872495.1\|3560293_3560608_+	hypothetical protein	NA	NA	NA	NA
WP_155872498.1\|3560738_3561029_+	hypothetical protein	NA	NA	NA	NA
WP_155872501.1\|3561040_3562126_-	phage late control D family protein	A0A2H4JAV0	uncultured_Caudovirales_phage	1.5e-84	49.8
WP_155872504.1\|3562125_3562581_-\|tail	phage tail protein	A0A2H4JG54	uncultured_Caudovirales_phage	2.1e-32	52.8
WP_155872507.1\|3562593_3565332_-\|tail	phage tail tape measure protein	A0A2H4JE61	uncultured_Caudovirales_phage	1.5e-184	44.5
WP_081322395.1\|3565335_3565452_-\|tail	GpE family phage tail protein	E5FFG6	Burkholderia_phage	3.0e-07	75.8
WP_081322394.1\|3565460_3565820_-\|tail	phage tail assembly protein	A0A1S6KZZ9	Salmonella_phage	1.6e-14	42.9
WP_058664993.1\|3565841_3566357_-\|tail	phage major tail tube protein	V9IQX1	Stenotrophomonas_phage	3.8e-46	54.1
WP_155872509.1\|3566414_3567596_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A077K9Y4	Ralstonia_phage	2.3e-147	65.7
WP_155872512.1\|3567740_3568355_-\|tail	tail fiber assembly protein	B5TK80	Pseudomonas_phage	5.3e-10	32.8
WP_155872515.1\|3568368_3569634_-\|tail	phage tail protein	A0A077K818	Ralstonia_phage	1.7e-55	32.3
WP_155872518.1\|3569630_3570269_-\|tail	phage tail protein I	A0A077KER5	Ralstonia_phage	1.1e-50	58.0
WP_155872520.1\|3570252_3571170_-\|plate	baseplate J/gp47 family protein	A0A077K9X9	Ralstonia_phage	6.3e-76	54.9
WP_068980947.1\|3571171_3571513_-	GPW/gp25 family protein	E5E3V5	Burkholderia_phage	1.4e-17	53.2
3571388:3571406	attR	NA	NA	NA	NA
WP_155872523.1\|3571524_3572160_-\|plate	phage baseplate assembly protein V	A0A077K9S0	Ralstonia_phage	9.2e-50	52.0
WP_155872525.1\|3572221_3572683_-	phage virion morphogenesis protein	Q6K1H7	Salmonella_virus	1.9e-28	46.9
WP_155872527.1\|3572675_3573179_-\|tail	phage tail protein	A0A077K8R3	Ralstonia_phage	2.8e-33	52.9
WP_155872529.1\|3573277_3573700_-	hypothetical protein	Q9ZXL5	Pseudomonas_virus	2.3e-09	31.7
WP_155872531.1\|3573696_3574506_-	DUF3380 domain-containing protein	E5FFI0	Burkholderia_phage	1.1e-76	56.0
WP_155872533.1\|3574498_3574798_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_006390739.1\|3574794_3575157_-	hypothetical protein	NA	NA	NA	NA
WP_006390738.1\|3575162_3575369_-\|tail	tail protein X	A0A2H4J946	uncultured_Caudovirales_phage	1.1e-15	59.1
WP_155872535.1\|3575368_3575839_-\|head	head completion/stabilization protein	A0A1S5NNA6	Burkholderia_phage	1.1e-36	51.6
WP_155872537.1\|3575931_3576627_-	hypothetical protein	A0A2H4J948	uncultured_Caudovirales_phage	7.5e-37	41.3
WP_155872539.1\|3576629_3577637_-\|capsid	phage major capsid protein, P2 family	E5FFI6	Burkholderia_phage	1.3e-114	61.4
WP_155872542.1\|3577681_3578548_-\|capsid	GPO family capsid scaffolding protein	E5FFI7	Burkholderia_phage	1.3e-49	43.5
WP_155872545.1\|3578688_3580443_+\|terminase	terminase	A4JWQ1	Burkholderia_virus	6.6e-231	67.7
WP_155872548.1\|3580439_3581465_+\|portal	phage portal protein	A4JWV0	Burkholderia_virus	1.8e-127	62.4

DBSCAN-SWA_6

4455684 : 4463623

Moraxella_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155872873.1\|4455684_4456272_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	7.0e-20	36.8
WP_006388150.1\|4456305_4456680_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	1.9e-10	27.8
WP_006388152.1\|4458282_4458639_+	VOC family protein	NA	NA	NA	NA
WP_006388153.1\|4458723_4460016_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-65	36.3
WP_006388154.1\|4460124_4461156_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-92	51.6
WP_006388155.1\|4461225_4461867_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_020927471.1\|4462055_4462814_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.5e-67	51.6
WP_006388157.1\|4462858_4463623_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.3e-31	45.2

DBSCAN-SWA_7

5609545 : 5682700

Pseudomonas_phage(18.42%)

integrase,terminase,protease,capsid,portal,tRNA,tail,head

attL 5608805:5608824|attR 5678120:5678139

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5608805:5608824	attL	NA	NA	NA	NA
WP_006386145.1\|5609545_5611069_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.2
WP_020928310.1\|5611084_5611408_+	hypothetical protein	NA	NA	NA	NA
WP_054507257.1\|5611464_5612973_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_020928313.1\|5613148_5614402_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_020928314.1\|5614398_5615226_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_110059104.1\|5615245_5615899_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_038503902.1\|5615895_5617050_-	thiolase family protein	NA	NA	NA	NA
WP_155873435.1\|5617046_5618900_-	AMP-binding protein	A0A1V0SBX8	Catovirus	2.3e-48	24.1
WP_026384304.1\|5618896_5619691_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-11	22.6
WP_006386155.1\|5619731_5620913_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020928318.1\|5620954_5621992_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_006386157.1\|5621994_5622873_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_169538040.1\|5622872_5623670_-	ATP-binding cassette domain-containing protein	A0A1J0FA64	Only_Syngen_Nebraska_virus	3.9e-05	25.5
WP_049050888.1\|5623927_5624731_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_155873437.1\|5626727_5626994_-	hypothetical protein	NA	NA	NA	NA
WP_155873439.1\|5626977_5627526_-	hypothetical protein	A0A0H5BBZ5	Pseudomonas_phage	9.7e-32	54.8
WP_054447769.1\|5627528_5627972_-	hypothetical protein	A0A0A1IVG1	Pseudomonas_phage	1.7e-10	36.2
WP_026384313.1\|5628089_5628782_-	hypothetical protein	NA	NA	NA	NA
WP_155873441.1\|5629083_5632257_-	DUF1983 domain-containing protein	A4JX16	Burkholderia_virus	1.9e-276	47.0
WP_155873443.1\|5632253_5632868_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	2.0e-54	57.1
WP_155873445.1\|5632871_5633645_-	Mov34/MPN/PAD-1 family protein	A4JX14	Burkholderia_virus	3.5e-67	51.3
WP_155873447.1\|5633647_5634286_-	hypothetical protein	A0A1B0VMI8	Pseudomonas_phage	4.2e-42	41.5
WP_155873449.1\|5634300_5635029_-\|tail	phage minor tail protein L	A4JX13	Burkholderia_virus	8.0e-66	55.7
WP_155874241.1\|5635037_5635421_-	hypothetical protein	NA	NA	NA	NA
WP_054506194.1\|5636784_5637123_-\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	3.1e-28	49.1
WP_155873451.1\|5637119_5640560_-\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	3.1e-83	32.5
WP_155873453.1\|5640561_5640813_-	DUF1799 domain-containing protein	A0A0S2SY90	Pseudomonas_phage	1.8e-12	45.7
WP_006387896.1\|5640869_5641208_-	hypothetical protein	NA	NA	NA	NA
WP_155873456.1\|5641217_5641868_-\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	3.8e-59	56.5
WP_155873458.1\|5641925_5642276_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_155873460.1\|5642268_5642697_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_026384553.1\|5642693_5643023_-\|head	phage head closure protein	Q6JIM4	Burkholderia_virus	2.1e-13	45.0
WP_155873462.1\|5643019_5643439_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_155873464.1\|5643441_5643828_-	hypothetical protein	NA	NA	NA	NA
WP_155873466.1\|5643894_5645133_-\|capsid	phage major capsid protein	C7BGH0	Burkholderia_phage	3.4e-101	49.4
WP_155873468.1\|5645202_5645943_-\|protease	ATP-dependent Clp protease proteolytic subunit	C7BGG9	Burkholderia_phage	1.5e-56	56.2
WP_155873470.1\|5645908_5647249_-\|portal	phage portal protein	C7BGG8	Burkholderia_phage	1.9e-57	37.4
WP_155873472.1\|5647248_5648946_-\|terminase	terminase large subunit	S4TSQ6	Salmonella_phage	9.9e-200	61.8
WP_070668504.1\|5648991_5649318_-	hypothetical protein	Q2NPI9	Xanthomonas_virus	4.2e-06	45.7
WP_155873474.1\|5649475_5649811_-	HNH endonuclease	NA	NA	NA	NA
WP_155873476.1\|5649813_5650047_-	hypothetical protein	NA	NA	NA	NA
WP_155873478.1\|5650043_5650430_-	hypothetical protein	NA	NA	NA	NA
WP_155873480.1\|5650433_5650643_-	hypothetical protein	NA	NA	NA	NA
WP_054506208.1\|5650842_5651028_+	type II toxin-antitoxin system HicA family toxin	A0A0M3LQ86	Mannheimia_phage	3.1e-06	47.5
WP_155873482.1\|5651096_5651507_+	type II toxin-antitoxin system HicB family antitoxin	Q7Y3V7	Yersinia_phage	1.0e-17	40.3
WP_155873484.1\|5651508_5652279_-	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	2.4e-113	73.8
WP_155873487.1\|5652443_5652617_+	hypothetical protein	NA	NA	NA	NA
WP_155873489.1\|5652731_5653325_-	hypothetical protein	NA	NA	NA	NA
WP_155873492.1\|5653321_5653702_-	hypothetical protein	NA	NA	NA	NA
WP_173361405.1\|5653712_5654039_-	hypothetical protein	A0A0P0IKL1	Acinetobacter_phage	4.8e-18	45.7
WP_155873496.1\|5654110_5655838_-	toprim domain-containing protein	A0A0F7L6A5	uncultured_marine_virus	2.7e-104	37.7
WP_155873498.1\|5655834_5656911_-	hypothetical protein	U6C6J3	Ralstonia_phage	5.8e-28	73.9
WP_155873500.1\|5656922_5657168_-	hypothetical protein	NA	NA	NA	NA
WP_155873502.1\|5657272_5657473_-	hypothetical protein	NA	NA	NA	NA
WP_155873504.1\|5657475_5657808_-	hypothetical protein	K7PH30	Enterobacteria_phage	5.4e-09	48.2
WP_155873506.1\|5657800_5658130_-	hypothetical protein	NA	NA	NA	NA
WP_155873508.1\|5658115_5658934_+	helix-turn-helix domain-containing protein	A0A0R6PHL1	Moraxella_phage	4.2e-31	33.8
WP_155873510.1\|5659129_5659450_+	hypothetical protein	NA	NA	NA	NA
WP_026383231.1\|5659446_5659746_+	hypothetical protein	NA	NA	NA	NA
WP_155873512.1\|5659742_5659994_+	hypothetical protein	NA	NA	NA	NA
WP_026383229.1\|5659990_5660275_+	hypothetical protein	NA	NA	NA	NA
WP_155873514.1\|5660271_5660511_+	hypothetical protein	NA	NA	NA	NA
WP_155873516.1\|5660507_5660717_+	hypothetical protein	NA	NA	NA	NA
WP_155873519.1\|5660713_5661031_+	hypothetical protein	NA	NA	NA	NA
WP_155873521.1\|5661023_5661284_+	hypothetical protein	NA	NA	NA	NA
WP_155873523.1\|5661280_5661523_+	hypothetical protein	NA	NA	NA	NA
WP_155873525.1\|5661519_5662194_+	DNA polymerase III subunit beta	A0A1L7DQD4	Ralstonia_phage	2.1e-15	35.5
WP_155873527.1\|5662190_5662406_+	hypothetical protein	NA	NA	NA	NA
WP_155873529.1\|5662402_5662705_+	hypothetical protein	NA	NA	NA	NA
WP_155873531.1\|5662701_5663481_+	phage antirepressor	C8CLG1	Xylella_phage	4.2e-28	60.5
WP_155873533.1\|5663477_5664740_+	hypothetical protein	NA	NA	NA	NA
WP_155873535.1\|5664736_5664937_+	hypothetical protein	NA	NA	NA	NA
WP_155873537.1\|5664895_5666092_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	3.2e-59	37.2
WP_006386163.1\|5666921_5667812_-	methylglyoxal synthase	NA	NA	NA	NA
WP_006386165.1\|5667915_5668110_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_006386167.1\|5668109_5668451_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_054497502.1\|5668460_5670323_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.2e-99	39.3
WP_006386171.1\|5670388_5670901_-	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_006386172.1\|5670904_5671228_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	3.0e-25	54.2
WP_006386173.1\|5671230_5671635_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	8.2e-52	76.6
WP_006386174.1\|5671668_5672880_-	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
WP_006386175.1\|5672898_5673441_-	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
WP_042794076.1\|5673633_5674125_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_165595766.1\|5674374_5676357_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_006386178.1\|5676584_5677784_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_024069438.1\|5677938_5678589_+	transcriptional repressor LexA	A0A2K9V3G4	Faecalibacterium_phage	2.0e-15	32.6
5678120:5678139	attR	NA	NA	NA	NA
WP_020928331.1\|5678699_5681150_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	7.8e-222	52.2
WP_006386181.1\|5681401_5682700_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.7e-130	54.1

DBSCAN-SWA_8

6428773 : 6483345

Burkholderia_virus(19.23%)

integrase,terminase,portal,capsid,protease,tail,tRNA,head

attL 6460025:6460041|attR 6466522:6466538

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047991707.1\|6428773_6429253_-	hypothetical protein	A0A0A1IVG1	Pseudomonas_phage	2.3e-08	32.0
WP_155873854.1\|6429357_6429774_-	hypothetical protein	NA	NA	NA	NA
WP_155873856.1\|6431325_6432216_-	hypothetical protein	R9TJ58	Synechococcus_phage	4.2e-40	34.9
WP_155873858.1\|6432212_6437819_-\|tail	phage tail length tape measure family protein	A0A1V0E8B0	Vibrio_phage	1.8e-72	47.9
WP_155874291.1\|6437854_6438163_-	DUF1799 domain-containing protein	NA	NA	NA	NA
WP_068951791.1\|6438162_6438480_-\|tail	phage tail assembly chaperone	A0A2H4J121	uncultured_Caudovirales_phage	3.2e-27	52.9
WP_155873860.1\|6438567_6439215_-\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	2.5e-63	57.7
WP_155873862.1\|6439312_6439750_-	hypothetical protein	NA	NA	NA	NA
WP_155873864.1\|6439746_6440097_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_155873866.1\|6440089_6440584_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_054498349.1\|6440580_6440919_-\|head	phage head closure protein	Q3HQT3	Burkholderia_phage	9.3e-09	39.3
WP_155873868.1\|6440929_6441250_-\|head,tail	phage head-tail connector protein	S5FKK6	Shigella_phage	1.1e-11	36.8
WP_054498351.1\|6441287_6442520_-\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	8.1e-135	59.0
WP_155873870.1\|6442532_6443150_-\|head,protease	HK97 family phage prohead protease	A0A1J0GUZ0	Halomonas_phage	2.4e-63	62.7
WP_155873872.1\|6443160_6444378_-\|portal	phage portal protein	A0A1J0GUY8	Halomonas_phage	7.0e-155	66.7
WP_162838313.1\|6444374_6444530_-	hypothetical protein	NA	NA	NA	NA
WP_155873874.1\|6444531_6446256_-\|terminase	terminase large subunit	A4JWZ7	Burkholderia_virus	2.9e-279	80.3
WP_155873876.1\|6446259_6446742_-\|terminase	phage terminase small subunit P27 family	A4JWZ6	Burkholderia_virus	3.0e-53	62.0
WP_155873878.1\|6446942_6447326_-	HNH endonuclease	Q6JIE9	Burkholderia_virus	1.9e-26	53.0
WP_155873879.1\|6447514_6448297_+	hypothetical protein	NA	NA	NA	NA
WP_155873880.1\|6448430_6448952_+	hypothetical protein	NA	NA	NA	NA
WP_155873881.1\|6449553_6449994_-	VRR-NUC domain-containing protein	W6ARB7	Acinetobacter_phage	1.1e-14	38.7
WP_155873882.1\|6450037_6451000_-	helix-turn-helix domain-containing protein	A0A0U4IBP5	Pseudomonas_phage	1.4e-25	58.2
WP_155873886.1\|6450996_6451485_-	DUF1364 family protein	Q8W6N7	Burkholderia_virus	2.4e-13	42.7
WP_155873887.1\|6451475_6451781_-	hypothetical protein	NA	NA	NA	NA
WP_155873888.1\|6451773_6452079_-	hypothetical protein	A0A1J0GUZ1	Halomonas_phage	1.3e-06	34.5
WP_060721558.1\|6452072_6452600_-	hypothetical protein	B7SYH6	Stenotrophomonas_phage	2.0e-18	36.8
WP_155873889.1\|6453000_6453177_+	hypothetical protein	NA	NA	NA	NA
WP_155873890.1\|6453402_6453753_-	hypothetical protein	NA	NA	NA	NA
WP_054506804.1\|6453804_6454020_-	hypothetical protein	NA	NA	NA	NA
WP_155873894.1\|6454090_6455197_+	LexA family transcriptional repressor	A0A1B0VRI7	Pseudomonas_phage	3.4e-07	29.7
WP_155873896.1\|6455649_6456132_+	hypothetical protein	NA	NA	NA	NA
WP_155873898.1\|6456772_6457177_-	hypothetical protein	NA	NA	NA	NA
WP_070780976.1\|6457327_6457741_-	hypothetical protein	NA	NA	NA	NA
WP_155873899.1\|6457999_6458725_-	hypothetical protein	NA	NA	NA	NA
WP_155873901.1\|6458993_6459236_+	hypothetical protein	NA	NA	NA	NA
WP_155873903.1\|6459284_6459674_-	hypothetical protein	NA	NA	NA	NA
WP_155873905.1\|6459731_6460727_+	hypothetical protein	A1YZR3	Burkholderia_virus	7.6e-59	41.7
6460025:6460041	attL	NA	NA	NA	NA
WP_155874293.1\|6460807_6461143_+	hypothetical protein	K7PKY8	Enterobacterial_phage	5.4e-17	44.7
WP_155873907.1\|6461139_6461346_+	hypothetical protein	NA	NA	NA	NA
WP_155873909.1\|6461687_6462026_+	DUF4406 domain-containing protein	L7TKQ2	Pseudomonas_virus	2.4e-25	59.8
WP_155873911.1\|6462028_6463348_+	DNA (cytosine-5-)-methyltransferase	A0A2I7RFJ9	Vibrio_phage	3.1e-60	36.3
WP_082884045.1\|6463513_6463762_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_155873913.1\|6463758_6465048_-\|integrase	integrase arm-type DNA-binding domain-containing protein	C7BGE7	Burkholderia_phage	1.9e-134	55.5
WP_026384427.1\|6465289_6467890_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.8e-22	20.1
6466522:6466538	attR	NA	NA	NA	NA
WP_020928923.1\|6467886_6469080_+	cupin domain-containing protein	NA	NA	NA	NA
WP_006386500.1\|6469298_6469526_+	hypothetical protein	NA	NA	NA	NA
WP_155873915.1\|6469526_6469697_-	hypothetical protein	NA	NA	NA	NA
WP_006386499.1\|6469730_6470855_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_006386498.1\|6470872_6471778_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_006386497.1\|6471865_6472513_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_006386496.1\|6472574_6473201_-	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_006386495.1\|6473290_6474145_+	neutral zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	2.1e-36	38.1
WP_006386494.1\|6474325_6474862_+	hypothetical protein	NA	NA	NA	NA
WP_006386493.1\|6474858_6475626_+	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_006386492.1\|6475668_6475941_-	hypothetical protein	NA	NA	NA	NA
WP_155873917.1\|6476166_6476817_-	N-acetyltransferase	NA	NA	NA	NA
WP_006386490.1\|6476921_6477662_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_026384423.1\|6477749_6479030_+	MFS transporter	NA	NA	NA	NA
WP_026384422.1\|6478989_6479622_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_045953661.1\|6479745_6480231_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_006386486.1\|6480260_6480455_-	hypothetical protein	NA	NA	NA	NA
WP_165601568.1\|6480934_6481105_+	hypothetical protein	NA	NA	NA	NA
WP_155873919.1\|6481274_6482915_+	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_006386483.1\|6482973_6483345_+\|tRNA	tRNA-binding protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_LN890477.1|WP_155874293.1|6460807_6461143_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_LN890477.1|WP_155874293.1|6460807_6461143_+|hypothetical-protein

6460807_6461143_+

111 aa aa

6428773-6483345

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_LN890477_7	Orphan	7.2\|6518303\|29\|NZ_LN890477\|CRISPRCasFinder	6518303-6518331	29	6443537-6443565	1

1. spacer 7.2|6518303|29|NZ_LN890477|CRISPRCasFinder matches to NZ_LN890477 position: 6443537-6443565, mismatch: 1

ttgtagatggccgcaatttctgtgcggtt	CRISPR spacer
ttgtagatggccgcaatttccgtgcggtt	Protospacer
********************.********

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LN890477

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information