CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LT700187	Christensenella sp. Marseille-P2438 genome assembly, chromosome: contig00001	1 crisprs	WYL,Cas14u_CAS-V,cas3,DEDDh,csa3	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LT700187_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT700187_1

796473-796552

Orphan

Consensus_repeat	Method
ACCCGCAGGCCGCCGCCCTCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LT700187_1

>merge|NZ_LT700187|1|796473-796552|CRISPRCasFinder
ACCCGCAGGCCGCCGCCCTCGCGGCGGGCGTCTGGCGGTTTGACCAGCTGATCGCGGACCCGCAGGCCGCCGCCCTCGCG

>NZ_LT700187|1|1|796473-796552|CRISPRCasFinder
ACCCGCAGGCCGCCGCCCTCGCG	GCGGGCGTCTGGCGGTTTGACCAGCTGATCGCGG
ACCCGCAGGCCGCCGCCCTCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT700187.1\|WP_079546232.1\|800442_802290_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293795
NZ_LT700187.1\|WP_079546220.1\|788988_789861_-\|PHP-domain-containing-protein	unknown	unknown	gnl\|CDD\|235519
NZ_LT700187.1\|WP_079546231.1\|800066_800276_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT700187.1\|WP_079546224.1\|792089_792362_+\|ACT-domain-containing-protein	unknown	unknown	gnl\|CDD\|178923
NZ_LT700187.1\|WP_079546234.1\|803727_804114_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
NZ_LT700187.1\|WP_079546221.1\|789951_790443_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NZ_LT700187.1\|WP_079546233.1\|802322_802934_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT700187.1\|WP_079546219.1\|787959_788730_-\|nitrogenase-iron-protein	unknown	unknown	gnl\|CDD\|349759
NZ_LT700187.1\|WP_079547800.1\|803122_803656_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NZ_LT700187.1\|WP_079546230.1\|798796_799105_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT700187.1\|WP_079546222.1\|790447_791032_+\|TIGR00730-family-Rossman-fold-protein	unknown	unknown	gnl\|CDD\|129813
NZ_LT700187.1\|WP_079546223.1\|791118_792009_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT700187.1\|WP_079546225.1\|792479_793832_+\|PFL-family-protein	unknown	unknown	gnl\|CDD\|180009
NZ_LT700187.1\|WP_079546218.1\|786716_787967_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|365905
NZ_LT700187.1\|WP_079546226.1\|794452_796333_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_LT700187.1\|WP_079546235.1\|804292_804736_-\|dUTP-diphosphatase	unknown	unknown	gnl\|CDD\|234802
NZ_LT700187.1\|WP_079546229.1\|798071_798800_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT700187.1\|WP_079546228.1\|797152_797959_+\|sugar-phosphate-isomerase/epimerase	unknown	unknown	gnl\|CDD\|366542
NZ_LT700187.1\|WP_079547799.1\|799101_799740_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|227169
NZ_LT700187.1\|WP_079547798.1\|793944_794373_+\|DUF296-domain-containing-protein	unknown	unknown	gnl\|CDD\|377054

Protein	Function_ID	Function_description	E-value
NZ_LT700187.1\|WP_079546232.1\|800442_802290_+\|hypothetical-protein	gnl\|CDD\|293795	cd07709, flavodiiron_proteins_MBL-fold, catalytic domain of flavodiiron proteins (FDPs) and related proteins; MBL-fold metallo-hydrolase domain. FDPs catalyze the reduction of oxygen and/or nitric oxide to water or nitrous oxide respectively. In addition to this N-terminal catalytic domain they contain a C-terminal flavin mononucleotide-binding flavodoxin-like domain. Although some FDPs are able to reduce NO or O2 with similar catalytic efficiencies others are selective for either NO or O2, such as Escherichia coli flavorubredoxin which is selective toward NO and G. intestinalis FDP which is selective toward O2. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. Some members of this subgroup are single domain.	2.14078e-119
NZ_LT700187.1\|WP_079546220.1\|788988_789861_-\|PHP-domain-containing-protein	gnl\|CDD\|235519	PRK05588, PRK05588, histidinol phosphate phosphatase.	1.64656e-38
NZ_LT700187.1\|WP_079546224.1\|792089_792362_+\|ACT-domain-containing-protein	gnl\|CDD\|178923	PRK00194, PRK00194, ACT domain-containing protein.	4.44146e-37
NZ_LT700187.1\|WP_079546234.1\|803727_804114_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	1.21686e-13
NZ_LT700187.1\|WP_079546221.1\|789951_790443_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	6.38644e-50
NZ_LT700187.1\|WP_079546219.1\|787959_788730_-\|nitrogenase-iron-protein	gnl\|CDD\|349759	cd02040, NifH, nitrogenase component II NifH. NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.	3.11325e-148
NZ_LT700187.1\|WP_079547800.1\|803122_803656_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	2.10105e-52
NZ_LT700187.1\|WP_079546222.1\|790447_791032_+\|TIGR00730-family-Rossman-fold-protein	gnl\|CDD\|129813	TIGR00730, LOG_family_protein_YJL055W, TIGR00730 family protein. This model represents one branch of a subfamily of proteins of unknown function. Both PSI-BLAST and weak hits by this model show a low level of similarity to and suggest an evolutionary relationship of the subfamily to the DprA/Smf family of DNA-processing proteins involved in chromosomal transformation with foreign DNA. Both Aquifex aeolicus and Mycobacterium leprae have one member in each of two branches of this subfamily, suggesting that the branches may have distinct functions. [Hypothetical proteins, Conserved].	2.7573e-48
NZ_LT700187.1\|WP_079546225.1\|792479_793832_+\|PFL-family-protein	gnl\|CDD\|180009	PRK05313, PRK05313, hypothetical protein; Provisional.	0
NZ_LT700187.1\|WP_079546218.1\|786716_787967_-\|hypothetical-protein	gnl\|CDD\|365905	pfam00148, Oxidored_nitro, Nitrogenase component 1 type Oxidoreductase.	9.13246e-16
NZ_LT700187.1\|WP_079546226.1\|794452_796333_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_LT700187.1\|WP_079546235.1\|804292_804736_-\|dUTP-diphosphatase	gnl\|CDD\|234802	PRK00601, dut, dUTP diphosphatase.	3.28257e-67
NZ_LT700187.1\|WP_079546228.1\|797152_797959_+\|sugar-phosphate-isomerase/epimerase	gnl\|CDD\|366542	pfam01261, AP_endonuc_2, Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae.	8.00191e-25
NZ_LT700187.1\|WP_079547799.1\|799101_799740_-\|transcriptional-regulator	gnl\|CDD\|227169	COG4832, COG4832, Uncharacterized conserved protein [Function unknown].	1.36205e-84
NZ_LT700187.1\|WP_079547798.1\|793944_794373_+\|DUF296-domain-containing-protein	gnl\|CDD\|377054	pfam03479, DUF296, Domain of unknown function (DUF296). This putative domain is found in proteins that contain AT-hook motifs pfam02178, which strongly suggests a DNA-binding function for the proteins as a whole. There are three highly conserved histidine residues, eg at 117, 119 and 133 in Reut_B5223, which should be a structurally conserved metal-binding unit, based on structural comparison with known metal-binding structures. The proteins should work as trimers.	3.96893e-34

>NZ_LT700187.1|WP_079546226.1|794452_796333_+|oligoendopeptidase-F
MMEEKTREQIDKRYKWTLEDIYATDEAWEQDYKRLEKLMEDIPSLQKTLTKDEKSLAAALAAIEKMEHIAGDLFVYARMRRDEDNANAAYQARAARAMDLNVRLGSALSFVSPALLALKPGVLEGYIGAAVPHCKKGRDPKTCKKGGHCSKCSNHTHGNRQLAPYDFMLKELVRSKKHVLSKKEERLLSMAADISGAPKDIFTMIDNADLKFGSVKDADGKDVQLSHGKYIVMMQSPDRAVRKNTYETYYQSYKDMINTISAAYAASVKKDVFYARARKFGSALEKSLFSDNVPVSLYDNLIETIHKNLPTMYRYVDVRKKALGLSDLAMYDIYTPLAKETHGEYSYEQSMELVKKGLAVLGGEYGALLQEAQDGGWIDVYETPGKTSGAYSWGVFGVHPYVLLNHRGDLDSVFTIAHELGHAMHTYYSNQNQPEAKAGYEIFVAEVASTVNEVLLTHYLLETEQDADARRYILNHYLDQFRTTVVRQTMFAEFEKMTHAAAEAGEALTHESMCKMYGDLNALYYGPQIARDDTISYEWARIPHFYNAFYVYKYATGFSCAVKIASDILSGKKDAVRDYIRFLSSGGSDYPLELLKLAHVDLAGGEPVEVCMQEFAKALGEFEEML
>NZ_LT700187.1|WP_079547798.1|793944_794373_+|DUF296-domain-containing-protein
MEYKRFENTIIVRLDRGEEILEQMEKLALREHIQLAGVQALGAVCEFTAGVFDTREKKFLANDFRGTFEIVSLTGTIDTMNGAFYCHLHMSAANERGEVFGGHLSRAVISATCEMVVTVINGSADRLYDEQTGLNLLQFPRV
>NZ_LT700187.1|WP_079546225.1|792479_793832_+|PFL-family-protein
MIDQKDILKTIDMIARQNLDIRTVTMGISLFDCVSDDADVCAGRVYDKITRRAAHLVETGEAIENEFGIPIVNKRISVTPISLISQGCGDYVKFARAMDRAAHETGVDFIGGYSAFVQKAATEAEARFIDSIPQALSETKIVCSSVNVATTRAGINMDAVRRMGEVIKESAERTAAEGGMGAAKLVVFANAVEDNPFMAGAFHGTGEGDCVVNVGVSGPGVVKVALESKKGQPFDEVAETIKTTAFHITRMGQLVAREASRRLGVPFGIVDLSLAPTPAIGDSVAYILEEMGLETCGAHGTTAALALLNDAVKKGGIMATSHVGGLSGAFIPVSEDAGMIHAAETGALTLEKLEAMTCVCSVGLDMIALPGDTPAEVLSAIMADEAAIGMVNTKTTAVRLIPVPGRQVGDYVDFGGLLGRAPIMPYNQNSPKEFIARGGRIPAPLHAQRN
>NZ_LT700187.1|WP_079546224.1|792089_792362_+|ACT-domain-containing-protein
MRAIVSVLGQDRPGIIAHISHALYEANANILDITQTVLRDEVFAMTMLVDLSAVSTSFGELKEQLTAAGAKIGVEVRLMREEIFKSMHRV
>NZ_LT700187.1|WP_079546223.1|791118_792009_+|hypothetical-protein
MSFKTMFRRSGIVYKRNFSRLFLPLLLFQLVLLVPLMFFTMPGTVSVARSLLLTLSRAGRSGLSSIGAMLSVVAGVAVFVSPLMVSNVVYVIHSDYIGRTVTFREAAAHARRRYGGMLRSYFAAIALLALPVAGIVLAIIAIVLPGGVPVSVLSAGQLAGIVVLALAALLLFFGIVFLPYTVAVEGKHGFAAVLSSYRYAFLGNFWSNFTRVLSAAVIVGLAGMLVNWLSRLPFRELYDLYLADPMLALQDPLMIFVILLALAAIVVGTFVFPFWYAFTYHTYRNAKWEYERKKGA
>NZ_LT700187.1|WP_079546222.1|790447_791032_+|TIGR00730-family-Rossman-fold-protein
MKKICVFGSSSSVIEKTYLDAAYRLGELLAENGWELVFGAGTMGMMGAAARGAHSRGGRVTGVIPEFMNVPGIPYEKCDELFVTPDMRMRKQKMEDLSDGFIATAGGFGTFEELCEVVTLKQLKRHKKPIVILNTNGFFDELLAMFEKTAALRFAKSEALGVYAAVDTPEQAIESILNYHYTETGDKWFTPESP
>NZ_LT700187.1|WP_079546221.1|789951_790443_+|QueT-transporter-family-protein
MERPSKTRFICETAVIAAIYAVVTLLLAPFGFLQFQVRVSEAMCVLPFFTPAAVPGLFIGCLIANLFGSGTLGLMDIIVGSLATLLAAFVTWKLRGRSKWLLPLPSVLANAFLVSWTLSVMLGLPYWMNVLTVGIGQAIACYAIGMPLWFLLKRYQKNIFQRI
>NZ_LT700187.1|WP_079546220.1|788988_789861_-|PHP-domain-containing-protein
MRIGGRGGRAPDSEREEAMMFDYHIHSNVSHDAYDSPVRIAMTAREKGLTEICFTEHQEIDYPYPEPMPGLHYGLYERELGKARERVPGIVIRRGAELSLMPGSLKKIAADVRGHEFDFIIASQHTIKEKDPYFGESFEGKTLRQAQREYLEEMLYDLEHFDDFDVVGHIGYLDKYLPDIETLDDRTPFGYEDFPELLDAVFRSVIGRGKGIEVNTSNYAVYGWPTPAASVLRRYVELGGEVVTLGSDAHVAERVGWRFADAVEYMRACGVRYVCRFAARKPEFVPLEKF
>NZ_LT700187.1|WP_079546219.1|787959_788730_-|nitrogenase-iron-protein
MIKIALYGKGGIGKSTTASNLSAAFAQKGLRVMQIGCDPKADSTQNLLGGRKPRTVLDALREKGDGVILEDIVEEGYRGILCVEAGGPTPGIGCAGRGIITAFEKLEELKAYERFKPDIVLYDVLGDVVCGGFAMPIRGGYADEVFVVTSGEKMALYAAANIALAIGNFKNRGYASFGGVILNARNVEREEELVEDFAREAGTQVVKTIPRSGDVQRAEEQGKTVVEAFPDSSMAREYLELADRVLKICEGGRADV
>NZ_LT700187.1|WP_079546218.1|786716_787967_-|hypothetical-protein
MSECSFVRTLQYSSPARGGWSIVRMAMQVPESYQLFVGPSACMRHIMLSSMELKIDDRISWLPIREADIVSGSYEALILESVDGLLGKMEPRPRVFMIFVTCIDNLLGTDHDAFLAPLNEKYPETKTIVCFMNPITGDGPAPPAVTIQDTIYSLTGEAEKKDDAVNFIGSNLAIEPDNELIGWLKQNGIETRHISQYQTFDAFQEMGKSRFNIITSPLALYAAKQMKLRKGIGYGYFPVSYSFDEIERGAAELCGSLGIPAPDFSRERQRAEEKIFETLKALAGRPVSIDYAATYRPFGLARLLLEYGFRVDTVYTSECLPVERGDMEWILKNHREVKIVQPEHFSMPGQIAGSREHLCIGFEAAYFTGSPHVVPIAADGEHYGYAGVVSMMEKMRAECGHEYDLEQLVKDSGLVV
>NZ_LT700187.1|WP_079546228.1|797152_797959_+|sugar-phosphate-isomerase/epimerase
MKLCFSTLGCPEWSFSDIISTACDMGYDGIEIRGVGNVIDGTRIPQFSPENAEKTKALLAGKGLAVACLTSACYMNDSNHPEDMLYLAKAYVDTAHDMGIKNIRVLGDFGPEQSGELNIGEIAARVKEVARYAKPLGVDVLVETNGFFADSHNMEELMNKADEENLGVLWDIHHPYRYFGETPGDTVGRLGDLIRHVHIKDSVYTDGKLRYTMVGYGDLPVRACVEALRSVGYDGFYSLEWLKRWDLSLEEPGIAFAGYADYMRSLVK
>NZ_LT700187.1|WP_079546229.1|798071_798800_-|hypothetical-protein
MRRHAGEYRKRLVSFLLCIVVVFAASCAKKDIKLSYEDFVAVKDIEETYSRDIYAALGSSNVQKLVTEYQMSRFERPIEDYTEEELMQEYDTLLKVYDLACKNGYEPERYTKESYRNLLLANLETVDAFEGRDGEANLAYKQNIEAAAKAAGLSFDEYVDEVMIPYIKVWYAKEALQSYYFKKIYFGKFKEMNRTEKELYDKWEETQTSEDMNAWLEFHASEEYQNAYISFMKEFEEYCKTL
>NZ_LT700187.1|WP_079546230.1|798796_799105_-|hypothetical-protein
MKKKFAFLLMGEHYDPARHCAEFETEKQITYICTVKNAEEAYAKAAALKDAGVGAIELCGAFGEEMARKIIGLTGGEVAVGFVTHFPEQDGVFERFFQRFNG
>NZ_LT700187.1|WP_079547799.1|799101_799740_-|transcriptional-regulator
MPEKFDYKKEYKDLYLPKTKPALIDVPPICFIMADGKGAPGGEEYQSALHALYALTFTIKMSRMSGRQPEGYFEYVVPPLEGLWHGEPGWFERGDRKKWLWTSMIRQPEFVTQEVFEWAAEECRRKKPDADVSRVRLETFREGLCVQAMHIGPYAKEGETLGLLRRFMEENGLEDMTGSERKHHEIYLGDPRRTAPERLRTVLRLPVERKRI
>NZ_LT700187.1|WP_079546231.1|800066_800276_-|hypothetical-protein
MKKTRRTAVHFQRFSVTIEKRETASLPMPAVYWPGLRWKKEAARVYCGNAGEGSAVFFFERYTLAGRGI
>NZ_LT700187.1|WP_079546232.1|800442_802290_+|hypothetical-protein
MYCTKKISDDLTWVGADDRRLAMFEGVYSVPDGVSYNSYLLTDEKTVLFDTVDKAVAKTFFENVEHALGGRKLDYLVVQHMEPDHSATIEGLLLRHPETTVVCNDKIKKMIGQFFSAELESKVQTVKEGDTLETGRHTLTFVMAPMVHWPEVMVTYDTADKILFSADAFGTFGALNGAIFADEVDFERDFLDEARRYYTNIVGKYGTQVQALLKKASAIDIEMICPLHGFVWRSNLGDYIGKYAKWSAYQPEETGVMIAYASVYGNTENTANILACRLRDRGIKTVMYDVSVTPASEIVAASFKWSHLVFASTTYNAGIFVTMDELLRDLASHNLQNRTVAFIQNGSWAPTSGKLMKEIIGPLKGMTVLEETVNITSSLKEDQLADIDRLVDAIAATVPRFEAEDDPKVPAIDPNALFKLSYGLYVVTAQDENGRDNGCITNAVMQVTDSPNRIAIGVNKANCTHDMIAKSGKFSVSVLTEDAPFKLFQHFGFRSGRDVDKFQEFKHADRCANGLYYLSKYSNALISGTVIVSEDCGTHTLFIADVTEACILSDAPSVTYEYYFEHIKPKPPVSAGPQKGFVCKVCGYVYEGDVLPADFICPLCKHGADAFEPLK
>NZ_LT700187.1|WP_079546233.1|802322_802934_+|hypothetical-protein
MKKAAILAAAVLLCAALFCGCSFFSSAVTDFIDSRTPVQVPAAADTSGSAAARYTGSVVSLVLPDGVTVDEQKSNHEDGIDFIYMDTPFDGTYITLTASAAPYEGMTWEEGKTMYENFLTSIDAEILARDEVESADYPNELLYVLQTAEATASAGEDLEVETLHIVFLAEDNLCALVGMSADYDAFESIMDMCFDLFDSFALK
>NZ_LT700187.1|WP_079547800.1|803122_803656_+|methylated-DNA--[protein]-cysteine-S-methyltransferase
MQYTARYHSPIGDILLAADDIGLTGLWFEGQKYFALSLDTEREEREIPLFERIKSWLDIYFSGKEPEFAVPLHFIGTEFQKDVWKILCSIPYGQTMTYGGIAKQIAAERGLPRMSAQAVGGAVGHNGISIIVPCHRVVGTNGSLTGYAGGIEKKVKLLTLEKTDMQRFFIPKKGTAL
>NZ_LT700187.1|WP_079546234.1|803727_804114_-|XRE-family-transcriptional-regulator
MKRKTLGATIAELRKKQGMTQLELAEKMCVTDKAVSKWERDLSCPDVSSLPRLAELLGVSTDELMRGAAPKETARSGMLSLAFKAVAAAMGIAAAVLSVLDALDIRSGTAMLGIGLAALALWALQEKK
>NZ_LT700187.1|WP_079546235.1|804292_804736_-|dUTP-diphosphatase
MPKQKINIKKLDKKAVIPTYGSEYSAGADLYACLGEEVVIAPGETKMIHTGIAMEIPVGYAGLIYARSGLASKRGLAPANKVGVVDSDYRGEFMVALHNHSGEPQTVQPGERIAQMVVTPVLAVSFHEVEELEETERGGGGFGSTGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

803122 : 810917

Streptococcus_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079547800.1\|803122_803656_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	5.2e-38	48.5
WP_079546234.1\|803727_804114_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_079546235.1\|804292_804736_-	dUTP diphosphatase	G0YQD9	Erwinia_phage	2.5e-30	47.3
WP_079546236.1\|804750_805278_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A2C9CZG1	Yersinia_phage	7.4e-37	47.1
WP_079546237.1\|805281_807408_-	anaerobic ribonucleoside-triphosphate reductase	Q76Z50	Aeromonas_virus	2.8e-143	42.1
WP_079546238.1\|807556_807886_-	hypothetical protein	NA	NA	NA	NA
WP_079546239.1\|807956_808634_-	fructose-6-phosphate aldolase	A0A1D7SCS1	Synechococcus_phage	8.6e-30	35.5
WP_079546240.1\|808652_809822_-	enoyl-[acyl-carrier-protein] reductase FabV	NA	NA	NA	NA
WP_079546241.1\|809954_810917_+	O-acetyl-ADP-ribose deacetylase	A0A140G0J9	Infectious_spleen_and_kidney_necrosis_virus	1.2e-37	48.8

DBSCAN-SWA_2

1615994 : 1639129

Bacillus_virus(18.75%)

tail,head,transposase,portal,terminase,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079546936.1\|1615994_1616297_+	HNH endonuclease	A0A2I7SC48	Paenibacillus_phage	5.7e-18	52.2
WP_079546937.1\|1616688_1617072_+	hypothetical protein	A0A0U4JV93	Exiguobacterium_phage	3.1e-16	40.6
WP_079546938.1\|1616959_1618762_+\|terminase	terminase large subunit	A0A0S2SXJ7	Bacillus_phage	8.0e-240	68.4
WP_079546939.1\|1618764_1619976_+\|portal	phage portal protein	A6XMJ5	Bacillus_virus	3.1e-123	54.2
WP_079546940.1\|1619944_1620535_+\|head,protease	HK97 family phage prohead protease	Q0H262	Geobacillus_phage	8.3e-53	57.3
WP_079546941.1\|1622207_1622495_+	hypothetical protein	Q0H259	Geobacillus_phage	1.8e-24	57.0
WP_079546942.1\|1622481_1622817_+\|head,tail	phage head-tail adapter protein	A6XMK0	Bacillus_virus	1.6e-24	59.0
WP_079546943.1\|1622785_1623154_+	hypothetical protein	A0A1S5SFC4	Streptococcus_phage	1.5e-15	37.3
WP_079546944.1\|1623150_1623483_+	hypothetical protein	A0A290GDX2	Caldibacillus_phage	2.9e-15	42.7
WP_079546945.1\|1623433_1624324_+	hypothetical protein	A0A0U4JWV5	Exiguobacterium_phage	3.4e-34	43.1
WP_079546946.1\|1624521_1625325_+	hypothetical protein	NA	NA	NA	NA
WP_079547848.1\|1625817_1626099_+	hypothetical protein	Q37878	Lactobacillus_phage	3.6e-06	34.4
WP_079546947.1\|1626249_1626642_+	hypothetical protein	A6XMK4	Bacillus_virus	4.2e-13	37.6
WP_079546948.1\|1626797_1630010_+	hypothetical protein	D2XR25	Bacillus_phage	4.4e-23	29.7
WP_079546949.1\|1630006_1630876_+	hypothetical protein	NA	NA	NA	NA
WP_079546950.1\|1630850_1632482_+	collagen-like protein	NA	NA	NA	NA
WP_079546951.1\|1632494_1632962_+	hypothetical protein	NA	NA	NA	NA
WP_079546952.1\|1632973_1633591_+	hypothetical protein	NA	NA	NA	NA
WP_079546953.1\|1633603_1633942_+	hypothetical protein	NA	NA	NA	NA
WP_079546954.1\|1633945_1634299_+	hypothetical protein	NA	NA	NA	NA
WP_079546955.1\|1634335_1635415_+	hypothetical protein	NA	NA	NA	NA
WP_079546956.1\|1635432_1635717_+\|holin	phage holin	A0A060ADQ7	Enterococcus_phage	4.6e-17	47.4
WP_079546957.1\|1635788_1635995_-	hypothetical protein	NA	NA	NA	NA
WP_079546958.1\|1636027_1636555_-	hypothetical protein	NA	NA	NA	NA
WP_079546959.1\|1636560_1636923_-	XRE family transcriptional regulator	L7TKV7	Pseudomonas_virus	2.1e-06	39.0
WP_079546960.1\|1637260_1637449_+	hypothetical protein	NA	NA	NA	NA
WP_079546961.1\|1638094_1639129_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	7.3e-113	60.8

DBSCAN-SWA_3

1766352 : 1788153

uncultured_Caudovirales_phage(18.75%)

portal,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079547069.1\|1766352_1766886_+	hypothetical protein	A0A059T5F1	Listeria_phage	1.8e-22	43.9
WP_079547070.1\|1766885_1767638_+	hypothetical protein	NA	NA	NA	NA
WP_079547071.1\|1767673_1768354_+	hypothetical protein	E3W8D3	Leuconostoc_phage	7.4e-21	31.9
WP_079547072.1\|1768452_1768983_+	hypothetical protein	NA	NA	NA	NA
WP_079547073.1\|1768979_1769384_+	single-stranded DNA-binding protein	A0A290GHL8	Caldibacillus_phage	4.8e-28	43.6
WP_079547074.1\|1769392_1770085_+	hypothetical protein	H7BV26	unidentified_phage	8.0e-15	48.5
WP_079547075.1\|1770081_1771167_+	hypothetical protein	A0A2H4J8K1	uncultured_Caudovirales_phage	1.2e-60	41.7
WP_079547076.1\|1771310_1771646_+	hypothetical protein	A0A2H4J4U3	uncultured_Caudovirales_phage	9.2e-25	49.6
WP_079547077.1\|1771647_1771875_+	hypothetical protein	NA	NA	NA	NA
WP_079547078.1\|1771968_1772160_+	hypothetical protein	NA	NA	NA	NA
WP_079547079.1\|1772175_1772472_+	hypothetical protein	NA	NA	NA	NA
WP_079547080.1\|1772477_1772699_+	hypothetical protein	NA	NA	NA	NA
WP_079547081.1\|1773085_1773529_+	hypothetical protein	NA	NA	NA	NA
WP_079547082.1\|1773993_1774308_+	hypothetical protein	A0A1J1J9Q7	Escherichia_phage	4.7e-15	44.6
WP_079547083.1\|1774520_1774901_+	helix-turn-helix domain-containing protein	A0A0S2SXV6	Bacillus_phage	1.1e-26	50.4
WP_079547084.1\|1774893_1776081_+\|terminase	PBSX family phage terminase large subunit	A0A2K9V3G6	Faecalibacterium_phage	7.8e-119	55.2
WP_079547085.1\|1776236_1777694_+\|portal	phage portal protein	A0A0N7GFE4	Paenibacillus_phage	8.9e-24	27.7
WP_079547086.1\|1777575_1779027_+	hypothetical protein	M4ZR27	Bacillus_phage	2.1e-20	27.5
WP_079547087.1\|1779026_1779206_+	hypothetical protein	NA	NA	NA	NA
WP_079547088.1\|1779375_1779948_+	hypothetical protein	NA	NA	NA	NA
WP_079547089.1\|1779962_1781081_+	hypothetical protein	H7BWE3	unidentified_phage	9.6e-34	45.6
WP_079547090.1\|1781095_1781626_+	hypothetical protein	NA	NA	NA	NA
WP_079547091.1\|1781612_1781912_+	hypothetical protein	NA	NA	NA	NA
WP_079547092.1\|1781908_1782259_+	hypothetical protein	A0A1B3B1W5	Gordonia_phage	5.7e-09	36.8
WP_079547093.1\|1782255_1782657_+	hypothetical protein	NA	NA	NA	NA
WP_079547094.1\|1782657_1783563_+	hypothetical protein	A0A0S2SXT6	Bacillus_phage	1.6e-18	34.3
WP_079547095.1\|1783747_1784050_+	hypothetical protein	NA	NA	NA	NA
WP_079547096.1\|1784249_1784858_+	SHOCT domain-containing protein	I3VYV9	Thermoanaerobacterium_phage	5.8e-09	28.9
WP_079547097.1\|1785210_1788153_+	hypothetical protein	A0A2H4J4V9	uncultured_Caudovirales_phage	2.0e-22	31.7

DBSCAN-SWA_4

2040926 : 2054583

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079545490.1\|2040926_2041535_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	4.1e-15	29.2
WP_079547321.1\|2041566_2042061_+	hypothetical protein	NA	NA	NA	NA
WP_079547322.1\|2043272_2043731_+	hypothetical protein	NA	NA	NA	NA
WP_079547323.1\|2044422_2045880_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.6e-33	26.8
WP_079547324.1\|2045957_2046449_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.5e-23	43.9
WP_079547325.1\|2046445_2047162_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3FUQ7	Synechococcus_phage	7.5e-40	39.7
WP_079547326.1\|2047167_2048625_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	6.1e-57	33.9
WP_079547327.1\|2048642_2049656_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.4e-60	40.7
WP_079547328.1\|2049649_2050270_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.6e-22	35.5
WP_079547329.1\|2050286_2051828_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG3	Prochlorococcus_phage	6.1e-47	51.3
WP_079547330.1\|2051848_2053105_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_079547331.1\|2053203_2054583_-	FAD-dependent oxidoreductase	R4THQ7	Phaeocystis_globosa_virus	8.0e-06	33.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage