CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LT855380	Pseudomonas viridiflava strain CFBP 1590 isolate E12-5 chromosome I	2 crisprs	csa3,DEDDh,DinG,cas3,csx1,WYL	1	2	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LT855380_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT855380_1

2429581-2429659

Orphan

Consensus_repeat	Method
CGCGGAGCGATGGGCACGATCAGTGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LT855380_1

>merge|NZ_LT855380|1|2429581-2429659|CRISPRCasFinder
CGCGGAGCGATGGGCACGATCAGTGTCGAGGCCGATTTGTGTATAACGATGAGCGCGGAGCGATGGGCACGATCGGTGT

>NZ_LT855380|1|1|2429581-2429659|CRISPRCasFinder
CGCGGAGCGATGGGCACGATCAGTGT	CGAGGCCGATTTGTGTATAACGATGAG
CGCGGAGCGATGGGCACGATCGGTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT855380.1\|WP_025994685.1\|2435573_2436899_+\|ammonium-transporter	unknown	unknown	gnl\|CDD\|223083
NZ_LT855380.1\|WP_088235017.1\|2426093_2427335_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273585
NZ_LT855380.1\|WP_088235016.1\|2422859_2425766_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273584
NZ_LT855380.1\|WP_088235021.1\|2433034_2433718_+\|protein-glxC	unknown	unknown	gnl\|CDD\|223148
NZ_LT855380.1\|WP_004886439.1\|2438291_2438777_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|214900
NZ_LT855380.1\|WP_088235022.1\|2437175_2438213_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|366009
NZ_LT855380.1\|WP_004888303.1\|2421397_2422171_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_LT855380.1\|WP_163000339.1\|2417883_2418837_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_LT855380.1\|WP_088235018.1\|2427316_2428222_-\|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase-FolD	unknown	unknown	gnl\|CDD\|172682
NZ_LT855380.1\|WP_029241146.1\|2433733_2435071_+\|FMN-binding-glutamate-synthase-family-protein	unknown	unknown	gnl\|CDD\|239202
NZ_LT855380.1\|WP_058431581.1\|2438968_2439304_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT855380.1\|WP_088235015.1\|2422283_2422856_-\|sarcosine-oxidase	unknown	unknown	gnl\|CDD\|226949
NZ_LT855380.1\|WP_058431572.1\|2416951_2417827_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293825
NZ_LT855380.1\|WP_004888307.1\|2425762_2426068_-\|sarcosine-oxidase-subunit-delta	unknown	unknown	gnl\|CDD\|377276
NZ_LT855380.1\|WP_088235019.1\|2428218_2429085_-\|formyltetrahydrofolate-deformylase	unknown	unknown	gnl\|CDD\|235676
NZ_LT855380.1\|WP_088235014.1\|2419282_2421223_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_LT855380.1\|WP_004886420.1\|2430709_2432044_+\|type-III-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|274431
NZ_LT855380.1\|WP_058431582.1\|2439459_2439900_-\|DedA-family-protein	unknown	unknown	gnl\|CDD\|224159
NZ_LT855380.1\|WP_025994689.1\|2429814_2430420_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_LT855380.1\|WP_088235020.1\|2432117_2433023_+\|glutamine-amidotransferase-family-protein	unknown	unknown	gnl\|CDD\|238888

Protein	Function_ID	Function_description	E-value
NZ_LT855380.1\|WP_025994685.1\|2435573_2436899_+\|ammonium-transporter	gnl\|CDD\|223083	COG0004, AmtB, Ammonia permease [Inorganic ion transport and metabolism].	3.55291e-160
NZ_LT855380.1\|WP_088235017.1\|2426093_2427335_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|273585	TIGR01373, Sarcosine_oxidase_subunit_beta, sarcosine oxidase, beta subunit family, heterotetrameric form. This model describes the beta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms. [Energy metabolism, Amino acids and amines].	2.75232e-150
NZ_LT855380.1\|WP_088235016.1\|2422859_2425766_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	0
NZ_LT855380.1\|WP_088235021.1\|2433034_2433718_+\|protein-glxC	gnl\|CDD\|223148	COG0070, GltB, Glutamate synthase domain 3 [Amino acid transport and metabolism].	9.56515e-41
NZ_LT855380.1\|WP_004886439.1\|2438291_2438777_-\|flavin-reductase-family-protein	gnl\|CDD\|214900	smart00903, Flavin_Reduct, Flavin reductase like domain. This entry represents the FMN-binding domain found in NAD(P)H-flavin oxidoreductases (flavin reductases), a class of enzymes capable of producing reduced flavin for bacterial bioluminescence and other biological processes. This domain is also found in various other oxidoreductase and monooxygenase enzymes... This domain consists of a beta-barrel with Greek key topology, and is related to the ferredoxin reductase-like FAD-binding domain. The flavin reductases have a different dimerisation mode than that found in the PNP oxidase-like family, which also carries an FMN-binding domain with a similar topology.	3.43274e-53
NZ_LT855380.1\|WP_088235022.1\|2437175_2438213_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|366009	pfam00296, Bac_luciferase, Luciferase-like monooxygenase.	5.25053e-61
NZ_LT855380.1\|WP_004888303.1\|2421397_2422171_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.65928e-56
NZ_LT855380.1\|WP_163000339.1\|2417883_2418837_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.48982e-78
NZ_LT855380.1\|WP_088235018.1\|2427316_2428222_-\|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase-FolD	gnl\|CDD\|172682	PRK14194, PRK14194, bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD.	0
NZ_LT855380.1\|WP_029241146.1\|2433733_2435071_+\|FMN-binding-glutamate-synthase-family-protein	gnl\|CDD\|239202	cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain. GltS is a complex iron-sulfur flavoprotein that catalyzes the reductive synthesis of L-glutamate from 2-oxoglutarate and L-glutamine via intramolecular channelling of ammonia, a reaction in the plant, yeast and bacterial pathway for ammonia assimilation. It is a multifunctional enzyme that functions through three distinct active centers, carrying out L-glutamine hydrolysis, conversion of 2-oxoglutarate into L-glutamate, and electron uptake from an electron donor.	1.36649e-162
NZ_LT855380.1\|WP_088235015.1\|2422283_2422856_-\|sarcosine-oxidase	gnl\|CDD\|226949	COG4583, COG4583, Sarcosine oxidase gamma subunit [Amino acid transport and metabolism].	0.000137458
NZ_LT855380.1\|WP_058431572.1\|2416951_2417827_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293825	cd07739, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	5.70621e-110
NZ_LT855380.1\|WP_004888307.1\|2425762_2426068_-\|sarcosine-oxidase-subunit-delta	gnl\|CDD\|377276	pfam04267, SoxD, Sarcosine oxidase, delta subunit family. Sarcosine oxidase is a hetero-tetrameric enzyme that contains both covalently bound FMN and non-covalently bound FAD and NAD(+). This enzyme catalyzes the oxidative demethylation of sarcosine to yield glycine, H2O2, and 5,10-CH2-tetrahydrofolate (H4folate) in a reaction requiring H4folate and O2.	4.84883e-35
NZ_LT855380.1\|WP_088235019.1\|2428218_2429085_-\|formyltetrahydrofolate-deformylase	gnl\|CDD\|235676	PRK06027, purU, formyltetrahydrofolate deformylase; Reviewed.	8.69156e-174
NZ_LT855380.1\|WP_088235014.1\|2419282_2421223_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	9.58265e-73
NZ_LT855380.1\|WP_004886420.1\|2430709_2432044_+\|type-III-glutamate--ammonia-ligase	gnl\|CDD\|274431	TIGR03105, gln_synth_III, glutamine synthetase, type III. This family consists of the type III isozyme of glutamine synthetase, originally described in Rhizobium meliloti, where types I and II also occur.	0
NZ_LT855380.1\|WP_058431582.1\|2439459_2439900_-\|DedA-family-protein	gnl\|CDD\|224159	COG1238, COG1238, Predicted membrane protein [Function unknown].	5.99607e-38
NZ_LT855380.1\|WP_025994689.1\|2429814_2430420_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	5.71309e-21
NZ_LT855380.1\|WP_088235020.1\|2432117_2433023_+\|glutamine-amidotransferase-family-protein	gnl\|CDD\|238888	cd01907, GlxB, Glutamine amidotransferases class-II (Gn-AT)_GlxB-type. GlxB is a glutamine amidotransferase-like protein of unknown function found in bacteria and archaea. GlxB has a structural fold similar to that of other class II glutamine amidotransferases including glucosamine-fructose 6-phosphate synthase (GLMS or GFAT), glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase), asparagine synthetase B (AsnB), beta lactam synthetase (beta-LS) and glutamate synthase (GltS). The GlxB fold is also somewhat similar to the Ntn (N-terminal nucleophile) hydrolase fold of the proteasomal alpha and beta subunits.	4.76329e-87

>NZ_LT855380.1|WP_088235019.1|2428218_2429085_-|formyltetrahydrofolate-deformylase
MQHEKNHFILKISCPATSGIVAAVTSYLAGNQCYIGEMAQFDDEFSGTFFMRAVFRFNDGHAGDIEQLKAGFDAVASDFSMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSNHLDLRPMAEREGIRFIYLPVTKDTKAEQEAALMRVVDETGTELVVLARYMQILSDELCRQLSGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHVYLPDDLVAAGRNTETIALSRAVKYHLEHRVFLNTDRTVIFR
>NZ_LT855380.1|WP_088235018.1|2427316_2428222_-|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase-FolD
MNQARLIDGKASAAKVLQQVRDEVQSLKAEGISPALAVILVGDDPASEVYVRNKILRAEEAGIRSLEYRLPADSSQARVLAVIAGLNADPSVNGILLQLPLPAHIEEACALQAIDPAKDVDGFHSENVGGLSQGREVLTPCTPSGCMHLLQETCGNLTGRHAVVIGRSNIVGKPMAALLLQAHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDASWLKPGAVVIDVGINRIQDQGRSRLVGDVDFDNVLNVASAITPVPGGVGPMTIAFLMKNTVTAARQQSRAQRSQSEAVCLSIY
>NZ_LT855380.1|WP_088235017.1|2426093_2427335_-|FAD-dependent-oxidoreductase
MPFNLLKYGLSPEYPVDVDLPAPKELKKAYDVVIIGGGGHGLATAYYLSKYHGITNIAVLEKGYLGGGNTARNTAVIRSNYLTSEGVRFYAESVKMFQGLSNEFDFNIMYSERGQLTLAHTDATVRSFRQRAEVNKHFGGRTEMIDRQQIRELVPSLNLDPGHLPVLAGLWHIDGGTARHDAVAWGYAKQAAKRGVEIHQLTEVQELVIENGAITAVKTNRGTIHCGCAVQAVAGMSSQMMKKAGISSPIQTFPLQAMVTQPFKPFLDPLVSSSALHCYVQQTSRGEVVFGGGSDPYPLFNTRSTLDLKESLLAHAIEMFPFLANAKLMRQWAGITDMTPDYSPIMGLSPVKNYYLDAGWGTWGFKATPICGKTMAELVASGGKVPELIKPFALERFSTFQQVNEMGATAASH
>NZ_LT855380.1|WP_004888307.1|2425762_2426068_-|sarcosine-oxidase-subunit-delta
MKIMTCPLNGPRNISEFTYGGEFKHMPDPQTCSDAEWADYVFNSEDTLGVVREWWMHNPSSYWFLAERHTASDQIIRTFDPREVFTARIDFTPMPSKEIAG
>NZ_LT855380.1|WP_088235016.1|2422859_2425766_-|FAD-dependent-oxidoreductase
MNTPARLPAPMGLLIDRNQPLTFSFDGKTYQGLQGDSIASALLANGRFLLSRSFKYHRPRGPLTMAGQDANSLIQLPHEPNVMADTFALQQGLHASGQNFNGSLDNDKDAVLGKFSKFMPVGFYYRSFYKPKGMWKIWEPIIRKKAGLGVLDLKFQPEYYDKAYLFTDLAIIGAGPAGLQAALTAANAGAQVLLIEQQAILGGSLTYARFDLDGQRAGQVLSELVETVESHANIRVLKQATCNAWFTDNYLPVIQGKRLYKVRATQCLVCSGSFDQPVIFRNNDLPGVMLTSAVQRLMKLYAVKPGKRAVVLTGNDDGYLAALDLNDQGVDVVAVVDMRPHASDRALQNAVEQRGITCHMNTTVFEALHEKGMRHVSGADLRKITGQGQVANSGLTVECDLLCMSGGYMPAYQLLCQAGGRLDYDDTQAEFAISGLPQNLGIAGSVNGCHALDNVLADATRAAADVLKALGLTFDGNPPALRNEARVNFAWPIFPHPKGKDFVDFDEDLQVRDIVNATRIGYRDIQLVKRYSTVGMGPSQGRHSALPTARLVAASTQRSISETGVTTARPPFEAEKLAHVAGRAFDPYRQTPMHRRHVEAGAKMMPAGIWQRPAFYGKPPQRDACMQEEAAHVRNKVGIIDVSTLGGLDIRGPDAAELLQRMYTFAFLKQPVGRSRYALMTNEQGVVIDDGVCARFAEQHFYVTATTSGVDRIYQQMLKWNAQWRLNVDITNVTAAICAVNVAGPDSRKVLEQVCNDLDLSSEGFPYLGVRQGTVAGIKARLLRVGFVGELGYEIHVAARHGLKLWDALIEAGRAFDMRPFGVETQRLLRLEKGHVIISQDTDGMTHPAEIDMGWAVSRTKPFFVGRRSVDILEAQPQKRKLVGFTLPKASPQPLEGHLVLKGPDISGNVTSCEYSQTLGRIIGLAYAAFDQSTPGQQIPIRVEDGVVVQATVVKLPFFDPDNQRQEL
>NZ_LT855380.1|WP_088235015.1|2422283_2422856_-|sarcosine-oxidase
MTSLTAERSVGLDPMPLCTLEDLTDLPRVGFRGTDSAAYLTARGFSLPDVPNRAVTQTDGSHVARLSQTEYLLLGSAQDQGQRIADEEASWEMDHNANYLLPREDSHAWLQLSGVCISEVMAKLCGVDLRAQAFPPSAVAQTSAARINVIVVNVGARSVPCFQILFDRASLTYFKDALLDAMTEFDGVSV
>NZ_LT855380.1|WP_004888303.1|2421397_2422171_-|IclR-family-transcriptional-regulator
MTDTTEKDTDYIVPALARGLSVLGMFSAQTRSLGMHDIAERLGVSTSAVYRILFTLTDMGYLDKNGTQYELGARVISDGFSYLASRDIVDVAMPHLNRLRDQSSLSCHLSIREQTDSLYLYRAFAAQRLSVNVPVGTRIACHCTAMGRMLLTALDDAELSRLYQHIRLDDYPAPAPRTLPELQAMTRQDRERGWVLHRSDYSTAIATSIKDHAGKITAAINLSGPDAIMDPDGARERFQDLLLACSERISSELGYRP
>NZ_LT855380.1|WP_088235014.1|2419282_2421223_-|methyl-accepting-chemotaxis-protein
MNIKQKLTWAFAVIACLPIIVVATIVVVNLRDEATKDFVDGSGREIRQVDNAMQLFFDGITQNVNYIAAHPLIAGASDDFRNYMGAAATAQSENDRQATELFASIAKAHPAYSYVSYGLINGSYIMTPEDPRMSNYDPRVRPWYKTAMANVGKTVRSDAYYWAADDAVLVSTIRAIPNKLGNPGGVVNIDVSLKQLTNIVKQIKLGESGYLMLMEKNGTVLVDPKQPEHNFKKLGELGDGFAELAKTSSGLVELTLNGERYMANVYPSDQLGWNFIGLIRQDEVMASATRLTWLIGVIAAVLALVFAIVGASFARVIVRPIHSVSTGLEGIAEGEGDLTHNLTVRGNDETAQLAGWFNKFLTAIRSLIQHIGQAAHKILEASHSSTRVSNDMAEAAGRQREAVDMVSTAFHEMVATSNEVARSCSQAADSADSGQQQAREGQRQIDDAVRSVDQLSEEIARSAKDVTQLEKDSIDIQSILATIRSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAKRTADSTAEIDTLLGNLAKRTKSVAQQMNASLDVSQQSVTKIGQARSSFGQIRESVDVIRDMNTQIATAAEEQHQVAEDINRHISQIHGDAQLIATLSDSARADSSSLASLSNELDALVRKFKT
>NZ_LT855380.1|WP_163000339.1|2417883_2418837_+|LysR-family-transcriptional-regulator
MKQKPYYWQLSVAWIGRIMDRIMAARVFIAINERGSLIAAADSLDMSRAMVTRYLAQMETWAGARLLHRTTRKLGLTASGQVTLVRCQQLLELADAMPLAADTQVDEPRGMLRIACSQSLAQAVLAPAVTAYLLRYPGTSVDLLIGNQAVDLVGERIDLAIRITNQLDPNLIARPLGTCDSVMCASPAYLTARGTPVRPQELSSHNCLTYSYFGKSLWEFIQAGQPLSVPVGGNLSANDSVVLLEAAVAGAGITLQPVHSAAPLLASGKLVALMPDYQPRTLGMHGIYTSRQHQSATLRTMLDFLAGWFGEEVLLRG
>NZ_LT855380.1|WP_058431572.1|2416951_2417827_-|MBL-fold-metallo-hydrolase
MLRSALFALSFATLFPLAAQAADPLKIDVYNPAEKAIFPVSSELITGQHDAVLIDAQFQRNDAEALVQKIKASGKKLTTVYISHSDPDYYFGLDVIQAAFPEAKIVASEPTVKAIKASMQGKLAYWGPILKDNAPAKLVLPEVLKGDHLTLEGQPLEIKGLQGPTPQRSYVWIPSLKAVVGGVVVSSGIHVWVADTQTPKSRQDWLATLKGIEALKPTTVIPGHYLGEVPEGTKAVTFTADYLKSFEKHATKAKDSAALIDAMKKAWPQLAEPSSLELSAKVIKGEMKWPN
>NZ_LT855380.1|WP_025994689.1|2429814_2430420_-|helix-turn-helix-domain-containing-protein
MNTPNETPPKLKLEQYLGIQIKRQRQAQELKLADVARIAGISQGMLSKIENAQVSTSLDNLSRLCDVLGMPMSKLFSQYDQQGSSALLVKADEGLEVVRRGTEKGHTYHLLNHTRGPKKSFEAYMVTMDDASEEFPTFSHPGTEFLHLLEGELIYRHGNQLYPMQAGDSLTFDGDIPHGPEQLVQVPIRLLSIMNYGAQGE
>NZ_LT855380.1|WP_004886420.1|2430709_2432044_+|type-III-glutamate--ammonia-ligase
MLPPETQRLIEQHGIKYVLAQFVDIHGSSKTKSVPVSGLEMVAEDGAGFAGFAICGMGMEPHGPDFMAKGDLSSLTPVPWQPGYGRVVCIGHVDGKPWPYDSRFVLQQQVERLTQRGWTLNTGLEPEFSLFKRDAAGSLQMVDASDNLDKPCYDYKGLSRSREFLERLTEALQPVGFDIYQIDHEDANGQFEINYTYSDAMESADRFTFFRMAAGEIANDMGMICSFMPKPDPKRAGNGMHFHLSIGSASNKNLFHDASDPSGMGLSKMAYHFAAGLLAHGPALCAFAAPTVNSYKRLVVGNSLSGATWAPAFIAFGANNRSAMVRVPYGRLEFRLPDAGCNPYLVSAAIIAAGLDGIDRQLEIDHVCNENLYKLSLEEIAARGIKTLPQSLKEACDALEADPLFAEVLGNEIVGEFVRLKRMEWVEYSRHVSDWEVKRYIEFF
>NZ_LT855380.1|WP_088235020.1|2432117_2433023_+|glutamine-amidotransferase-family-protein
MCGIVGLYLKNPALESQLGQLFEPMLEAMTDRGPDSAGFAIYGDEVADGWIKLTLQATTEDYDFKALIAGIEDRLAVPLDWFQNASAVVLKVQAEEAPVRALLSQLAPTVRIMSAGQSIEILKGMGLPRAISQRFGLGSMKGSHIIGHTRMATESAVTMEGSHPFSTGADLCLVHNGSLSNHFRLRQNLRREGIHFETDNDTEVAAGYLAWRLQQGDTLKQALDKSLEDLDGFFTFAIGTRNGFAVIRDPIACKPAILAETDDYVAMASEYQALSSLPGIEHARVWEPVPATMYIWERESA
>NZ_LT855380.1|WP_088235021.1|2433034_2433718_+|protein-glxC
MKTIDLSNATVRDLNQALHDQVRQLEDREWVVTHPDGAHNLAVGVNEAISIDIQGHAGYYCAGMNQKASITVHGNVGVGCAENMMSGAVRVKGSASQAAGATAHGGLLVIEGDAGARCGISMKGIDIVVGGSIGHMSCFMGQAGRLVVCGDAGDALGDSLYETRIYVKGKVESLGSDCIAKEMREEHLQELQELLNRAGFNEKAADFKRYGSARQLYNFKVDNASAY
>NZ_LT855380.1|WP_029241146.1|2433733_2435071_+|FMN-binding-glutamate-synthase-family-protein
MSDSSTPKAPVLRESATFDRLTIQEIQRAAETGIYDIRGGGTKRKLPHFDDLLLLGASVSRYPLEGYREKCGTDVVLGNRFAKKPLYLKIPVTIAGMSFGALSANAKEALGRGATIAGTSTTTGDGGMTPEERGQSQHLVYQYLPSRYGMNPDDLRKADAIEIVLGQGAKPGGGGMLLGMKVTERVAGMRTLPVGVDQRSACRHPDWTGPDDLAIKIAEIREITDWEKPIYVKIGASRPYYDVKLAVKAGADVIVLDGMQGGTAATQEVFIEHVGIPILPAIPQAVQALQEMGMHRKVQLIVSGGIRNGADVAKAMALGADAVAIGTAALIALGDNHPRLDEELKKIGSAAGFYDDWQNGRDPAGITTQDPELSKRLDPVEGGRRLANYLRVLVLEAQTMARACGKSHLHNLDPEDLVALTVESAAMARVPLAGTSWIPGGGSGY
>NZ_LT855380.1|WP_025994685.1|2435573_2436899_+|ammonium-transporter
MVNRLLGKPLLASLALGIFAPLVQAAETPTLNTGSTAWMITAAVLVLFMCLPGLALFYGGLVRAKNMLSLFTQCFGIAGVVGVLWVIYGYSMVVDTSNMVEGQVTFNSFVGGLSRAFLAGMTPDSLVGDIPEGVFVTFQMTFAIITPALIAGAFAERMKFSAALLFMALWFTFVYAPVAHMVWGGAGALMHNWGVLDFAGGTAVHINAGVAALAACLVLGKRKGYQNTPMPAHNLSLTMAGAAMLWVGWFGFNIGSGGGLSGTSGIVMLNTQVGACAGILGWMFTEWFKVGKPSALGLASGALAGLVGITPACAYVGVGGALAIGVLCGVFCYLSVTVLKKRLGYDDSLDVFGLHGIGGMIGAVLTGVFCVPSMGGLVPDVTMGAQVVAQIKGVLFTTVYCFAVSWVILKVVKALIGLRAHETVEELGLDLSEHNERAYNH
>NZ_LT855380.1|WP_088235022.1|2437175_2438213_-|LLM-class-flavin-dependent-oxidoreductase
MKFSLFVHMERWDESVSHRQLFEDLTELTLMAEKGGFSTVWIGEHHAMEYTISPSPMPLLAYLAARTETIHLGAGTIIAPFWHPLRVAGECALLDVISNGRMEVGLARGAYQVEFDRMAGGMPASEGGKALREMVPVVRALWQGDYAHDGDIWKFPTSTCVPKPINTPPMWIAARDPDSHNFAVANGCNVMVTPLMKGDEEVVDLKNKFEAALANNPGVPRPQLMVLRHTHVHATDDPEGWKVGAKAISKFYRTFDAWFGNKQTPVNGFLAPSPEEKFAERPEFTLESLHRTAMIGTPEEIIPRIKYYQELGVDEFSFWCDNSLPHAEKKKSLELFIKHVVTAFR
>NZ_LT855380.1|WP_004886439.1|2438291_2438777_-|flavin-reductase-family-protein
MIDATDYKNVMGSFPSGVTVITTLNEDGEVVGLTASAFSSLSMDPPLVLFCPNYSSDSYATLIKSKRFAIHLLSGGQQEEAYAFARKGKLKAEGIEWTLSELGNPLLNNATAIIECELWREYEGGDHAIMVGAIKNLIQPQQPVDPMVYCRGKMSTLPALA
>NZ_LT855380.1|WP_058431581.1|2438968_2439304_-|hypothetical-protein
MKFHAWFLILMIPAVSAHAEAKPIAVPIDPAAQHALVDKSGTMTHRVVVTKRESLLGVIYSKRVYNCDNHTVNLVGTGETLEIMESAHAVSGMGPVIRDSTAQYIQTEACS
>NZ_LT855380.1|WP_058431582.1|2439459_2439900_-|DedA-family-protein
MFELSSYFGLFMAALGAATLLPMQSETVLAGMLLSQAYPAVVLLWVATLGNVLGSILNWLLGRSIIRLRHKRWFPASEAQLEKAQRFYLKYGYWSLLLSWVPLIGDPLTLIAGVLREPLWRFVLIVTVAKGARYLVVAALVTHAIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LT855380_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT855380_2

5150113-5150189

Orphan

Consensus_repeat	Method
GCTCTGCGCTCGTCGTTATACACAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LT855380_2

>merge|NZ_LT855380|2|5150113-5150189|CRISPRCasFinder
GCTCTGCGCTCGTCGTTATACACAAGCCCGCCCCGACACTGATCGTGCCCACGCTCTGCGCTCATCGTTATACACAA

>NZ_LT855380|2|2|5150113-5150189|CRISPRCasFinder
GCTCTGCGCTCGTCGTTATACACAA	GCCCGCCCCGACACTGATCGTGCCCAC
GCTCTGCGCTCATCGTTATACACAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT855380.1\|WP_088236010.1\|5141919_5142690_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224423
NZ_LT855380.1\|WP_029241999.1\|5145707_5147261_-\|galactarate-dehydratase	unknown	unknown	gnl\|CDD\|274491
NZ_LT855380.1\|WP_167383129.1\|5144041_5145172_-\|gluconolaconase	unknown	unknown	gnl\|CDD\|308585
NZ_LT855380.1\|WP_043306779.1\|5143178_5143805_+\|DUF1282-family-protein	unknown	unknown	gnl\|CDD\|369140
NZ_LT855380.1\|WP_058431857.1\|5163346_5164762_+\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_LT855380.1\|WP_004883139.1\|5148819_5149731_-\|5-dehydro-4-deoxyglucarate-dehydratase	unknown	unknown	gnl\|CDD\|235141
NZ_LT855380.1\|WP_029244387.1\|5159656_5161279_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_LT855380.1\|WP_029242004.1\|5140384_5140786_+\|termination-factor-Rho	unknown	unknown	gnl\|CDD\|377850
NZ_LT855380.1\|WP_043306787.1\|5161592_5163191_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_LT855380.1\|WP_029241998.1\|5147271_5148654_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|273326
NZ_LT855380.1\|WP_088236008.1\|5139951_5140155_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT855380.1\|WP_004883154.1\|5142716_5142956_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379161
NZ_LT855380.1\|WP_088236009.1\|5140825_5141923_+\|DUF3182-family-protein	unknown	unknown	gnl\|CDD\|378651
NZ_LT855380.1\|WP_004883131.1\|5150401_5151151_-\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_LT855380.1\|WP_088236011.1\|5151251_5152985_-\|ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|226646
NZ_LT855380.1\|WP_058431854.1\|5155086_5155803_+\|SIMPL-domain-containing-protein	unknown	unknown	gnl\|CDD\|226002
NZ_LT855380.1\|WP_025994187.1\|5153634_5154894_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_LT855380.1\|WP_088236013.1\|5157790_5159392_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_LT855380.1\|WP_025994188.1\|5153074_5153638_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|226933
NZ_LT855380.1\|WP_088236012.1\|5156136_5157684_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369266

Protein	Function_ID	Function_description	E-value
NZ_LT855380.1\|WP_088236010.1\|5141919_5142690_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	7.86763e-10
NZ_LT855380.1\|WP_029241999.1\|5145707_5147261_-\|galactarate-dehydratase	gnl\|CDD\|274491	TIGR03248, galactar-dH20, galactarate dehydratase. Galactarate dehydratase converts D-galactarate to 5-dehydro-4-deoxyglucarate which is subsequently acted on by GarL, tartronate semialdehyde reductase and glycerate kinase (GenProp0714).	0
NZ_LT855380.1\|WP_167383129.1\|5144041_5145172_-\|gluconolaconase	gnl\|CDD\|308585	pfam03022, MRJP, Major royal jelly protein. Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts.	4.67676e-29
NZ_LT855380.1\|WP_043306779.1\|5143178_5143805_+\|DUF1282-family-protein	gnl\|CDD\|369140	pfam06930, DUF1282, Protein of unknown function (DUF1282). This family consists of several hypothetical proteins of around 200 residues in length. The function of this family is unknown although a number of family members are thought to be putative membrane proteins.	1.33117e-23
NZ_LT855380.1\|WP_058431857.1\|5163346_5164762_+\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	1.32192e-159
NZ_LT855380.1\|WP_004883139.1\|5148819_5149731_-\|5-dehydro-4-deoxyglucarate-dehydratase	gnl\|CDD\|235141	PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate dehydratase; Provisional.	0
NZ_LT855380.1\|WP_029244387.1\|5159656_5161279_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_LT855380.1\|WP_029242004.1\|5140384_5140786_+\|termination-factor-Rho	gnl\|CDD\|377850	pfam07498, Rho_N, Rho termination factor, N-terminal domain. The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It it thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers. This domain is found to the N-terminus of the RNA binding domain (pfam07497).	0.000142145
NZ_LT855380.1\|WP_043306787.1\|5161592_5163191_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_LT855380.1\|WP_029241998.1\|5147271_5148654_-\|MFS-transporter	gnl\|CDD\|273326	TIGR00893, Probable_glucarate_transporter, D-galactonate transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	8.70252e-160
NZ_LT855380.1\|WP_004883154.1\|5142716_5142956_-\|hypothetical-protein	gnl\|CDD\|379161	pfam13396, PLDc_N, Phospholipase_D-nuclease N-terminal. This family is often found at the very N-terminus of proteins from the phospholipase_D-nuclease family, PLDc, pfam00614. However, a large number of members are full-length within this family.	4.79291e-05
NZ_LT855380.1\|WP_088236009.1\|5140825_5141923_+\|DUF3182-family-protein	gnl\|CDD\|378651	pfam11379, DUF3182, Protein of unknown function (DUF3182). This family of proteins with unknown function appears to be restricted to Proteobacteria.	5.82255e-166
NZ_LT855380.1\|WP_004883131.1\|5150401_5151151_-\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	6.24382e-55
NZ_LT855380.1\|WP_088236011.1\|5151251_5152985_-\|ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|226646	COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only].	0
NZ_LT855380.1\|WP_058431854.1\|5155086_5155803_+\|SIMPL-domain-containing-protein	gnl\|CDD\|226002	COG3471, COG3471, Predicted periplasmic/secreted protein [Function unknown].	1.85748e-66
NZ_LT855380.1\|WP_025994187.1\|5153634_5154894_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.41507e-33
NZ_LT855380.1\|WP_088236013.1\|5157790_5159392_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_LT855380.1\|WP_025994188.1\|5153074_5153638_-\|response-regulator-transcription-factor	gnl\|CDD\|226933	COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription].	2.2456e-94
NZ_LT855380.1\|WP_088236012.1\|5156136_5157684_+\|hypothetical-protein	gnl\|CDD\|369266	pfam07217, Het-C, Heterokaryon incompatibility protein Het-C. In filamentous fungi, het loci (for heterokaryon incompatibility) are believed to regulate self/nonself-recognition during vegetative growth. As filamentous fungi grow, hyphal fusion occurs within an individual colony to form a network. Hyphal fusion can occur also between different individuals to form a heterokaryon, in which genetically distinct nuclei occupy a common cytoplasm. However, heterokaryotic cells are viable only if the individuals involved have identical alleles at all het loci.	2.31328e-39

>NZ_LT855380.1|WP_004883139.1|5148819_5149731_-|5-dehydro-4-deoxyglucarate-dehydratase
MNPQELKSILSSGLLSFPVTDFNAQGDFNRAGYIKRLEWLAPYGASALFAAGGTGEFFSLAASEYSEVIKTAVDTCATSVPILAGVGGSTRQAIEYAQEAERLGAKGLLLLPHYLTEASQDGVAAHVEAVCKSVKIGVVVYNRNVCRLNASLLEKLAERCPNLIGYKDGLGDIELMVSIRRRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFVPKLAMDFYHAIARDDHEAVGKYIDDFFLPYLEIRNRKAGYAVSIVKAGAKIAGYDAGPVRAPLTDLTPEECDMLAALMDKQGKQ
>NZ_LT855380.1|WP_029241998.1|5147271_5148654_-|MFS-transporter
MQTSKPTHVRYLILLMLFLVTTINYADRATIAIAGSSIQKDLGISAVTLGYIFSAFGWAYVAGQIPGGWLLDRFGSKKVYAMSIFTWSLFTLLQGYVGEFGISTAIVALFMLRFLVGLAEAPSFPGNARIVAAWFPTAERGTASAIFNSAQYFATVLFAPLMGWIVYTYGWQHVFIVMGAAGIVFSAIWMKVIYSPRSHPRINQAEIDHIASNGGMVDMDQDKSKSKKDGSSGPKWDYIKQLLTNRMMLGIYLSQYCINGITYFFLTWFPVYLVQERGMTILKAGIIASLPAICGFIGGVLGGIISDYLLRKGHSLTFARKAPIICGLLLSTSIVTCNYVDIEWMVVGFMALAFFGKGVGALGWAVMSDVSPKQIAGLSGGLFNTFGNIASITTPIVIGYIISTTGSFKWALVFVGANALLAVISYIFIVGEIKRVELIEPPVKGPLPTDTASNLSEAKS
>NZ_LT855380.1|WP_029241999.1|5145707_5147261_-|galactarate-dehydratase
MNLIQHADSPRYIRLHPLDNVVVVVNDQGVPAGTEFDNGLVTVDNVPQSHKVSTVDLAEGDAVIRYGHTIGYALQPIPRGSWVREDQLRMPSAPALDSLPMSDAVPAKGEPLEGYTFEGYRNADGTVGTRNILGITTTVQCVTGVLDFAVKRIRDELLPKYPNVDDVVALTHSYGCGVAITATDAYIPIRTVRNLARNPNLGGEALVISLGCEKLQAGQVMHEGDSSVDLSEPWLYRLQDSSHGFSEMVEQIMDLAEVRLKKLDLRRRETVPASELILGMQCGGSDAFSGITANPALGYASDLLLRAGATVMFSEVTEVRDAIYLLTSRAQDQDVAQALVREMDWYDRYLAKGEADRSANTTPGNKKGGLSNIVEKSLGSIVKSGSSAINGVLGPGERVNGKGLIFCATPASDFVCGTLQLAAGMNLHVFTTGRGTPYGLAMAPVVKVSTRTELAQRWPDLIDIDAGRIATGRASIEDLGWELFHYYLEVASGKKKTWTEHYRLHNDITLFNPAPIT
>NZ_LT855380.1|WP_167383129.1|5144041_5145172_-|gluconolaconase
MVALGSQAVQAATPAKLPEDKPVGKIEQVFAFHDAMPTGVSVTETGRIFVNFPRWGDKVPFTVGELRDGKVVPYPDSALNQADPQHPDKGFISVQSVVADGLGHLWILDTAAPEFSKPVAGGAKLVAVDLKTNKVVKTLVFPENVILSGTYVNDMRFDFSAGKEGVIYVTDSSVSGPGAIIVMDIATGKAMRRLSGAASTSADPAFVPRVEGQVLKMRNADGTSKPFAVASDGIALSSDRQTLYFSPLSSRHLYSVPTKLLRDPAVTEEQLVAAVQDLGEKGPSDGLEADSEGAVYAGDYEDNSIRKRLADGTWQTVAHDPRMLWPDTLSVANDGYLYFIVNQLHRQGLFHGGKDLREKPYSLFRVKIDAKPARTR
>NZ_LT855380.1|WP_043306779.1|5143178_5143805_+|DUF1282-family-protein
MNAFIVKLFTRPAHAWRDIRDEEEHSPRQYLPHLILLGLIPAVCLYIGTTQVGWSMTLEDRVWLSTKSALQLCALLYIAILAGTALMGTFIRWLSRTSEARPTLNQCIGFATYTITPFFIAGLAGLYPSRWLMILVLGLAAIHSTFLLIIGIRTFMRLPPGNAPLYAAAVWGVGVLVLVTILVSTILLWYHVLTPDYVRTVLGDVPAG
>NZ_LT855380.1|WP_004883154.1|5142716_5142956_-|hypothetical-protein
MPWISENHLWLFTAITALIVISDIWAVMRVRKSVTESSNKLMWIIVIVAVPILGVLALLVAGPRHVDTPAKPEQQSTKY
>NZ_LT855380.1|WP_088236010.1|5141919_5142690_+|alpha/beta-fold-hydrolase
MNVRSEIIEIKVGSQSISGSIVTPCEKFPGILFVHGWGGSQQRDLARAKNITGLGCVCLTFDLRGHERTEGLRATVSREQSLEDLLAAYDRLVSHPSVDPEAIAVIGTSYGGYLATILSAMRPVKWMALRVPALYWDADWDMPKQELDRDRLAHYRRSAVTAADNRALAACKEFRGDVLLIESERDDYVPHATLMSYRSAFELAHSLTYRLVDGADHALSSDISQSVYSSMLTNWISEMVIGARLVDYPHHSAKYS
>NZ_LT855380.1|WP_088236009.1|5140825_5141923_+|DUF3182-family-protein
MTGTVTGKTDVVLLPTRKALSTHETVVHQVLAQKLATLLGAEFVGLYDELIHRGRNLYFVPSETLIERDHPGIRSADDLFGGVIAEPFMATKALSHPLPESATHKPPGWSDAFHRQAAQAVLAGFSVFAEQDALKVGTQMLANGPVRLKPVLATAGRGQVVVTTEAELAEAISWQNLDEVREYGLVLEENLTEVVTFSVGQVQVAGLTASYYGTQDLTRDNQGETVYGGSRLHLVRGDYQALLRLPLDDSVRHAVQQALAYESAAFACLPGFIASRRNYDIAQGTNAQGQQCSGVLEQSWRIGGASAAEVEALLLFNADPALQQVTVSTHEVYGKTTLPADAQVLYEGDDPQVGFISKFVQVEPL
>NZ_LT855380.1|WP_029242004.1|5140384_5140786_+|termination-factor-Rho
MPAANSKKDATANKDKYTDKQKRKAEHIEESYEEKGVSKGEAEARAWATVNKQSGGGERKGGSGTRTPASSKSAARKDSAKRAVATKLGEPRHNQSLESQTKVDLMQRARGLNIAGRSTMNKQELISALKKAS
>NZ_LT855380.1|WP_088236008.1|5139951_5140155_-|hypothetical-protein
MSIISKWALQAVVLFLLGWMATLTTHWSHSVVSGTGSDRLAELNSGALSNPAALATSDSGQPRSQVE
>NZ_LT855380.1|WP_004883131.1|5150401_5151151_-|FadR-family-transcriptional-regulator
MENQSAPPRARRKHRSLAQELVTELSERIRSGQLKRGDKLPTESAIMEEQGVSRTVVREAISRLQASGLVETRHGIGTFVLDTPSPSGFRIDPATIVTLRDVLAILELRISLEVESAGLAAQRRSAEELAAMRAALDALNESAAHATDAVASDFQFHLQIALSTGNRYFTDIMTHLGTSIIPRTRLNSARLAHDDQQHYMDRLSREHEEIYEAIARQDSDAARAAMRLHLTNSRERLRHAHEEAESQRA
>NZ_LT855380.1|WP_088236011.1|5151251_5152985_-|ABC-transporter-ATP-binding-protein/permease
MKRNAEYSVVNDTVKGAFFPRVWKLITPYWRSEEKTMAWVLLASVVALSLFSVQMSVMFNSWYREFYNALQNKDTGAFTHLILYFSGLAAIAIFAAVYRLYLTQMLTIRWRRWLTEQHFARWLAHKNYYHLEQGGYTDNPDQRLSEDLNEFTTSTLHLGLGLMSAVVSLVSFSVILWGVSGSIELFGITIPGYMFWAAMLYAIVGSFLTHWIGRRLIPLNNQQERYEADLRYALVRVRENAESIALSDGEKNENQRLSGRFSMIWHNVLTSMKVQKRLTFFTSGYGQIAIIFPFVVAAPRYFAGKIELGDLMQINSAFGNVQENFSWFISAYDTLASWRATSDRLLSFRQAMSDHEAQVPSIQRVQTGNAVDLKDLGLTLASGRQLLQDAHLHIGQGEKVMLSGRSGSGKSSLLRALGGLWPKGTGKIGIPEGRALFLPQRPYLPIGTLREALSYPQPPEKFPAERYAEALRKCRLEPLVARLDDSDHWQRVLSPGEQQRMAFARALLLTPQWLYMDEATSAMDEEDEAAMHHAIFEEIPGLTLLSVGHRSSLKRFHDRHVQVEGGQLIERRASEPA
>NZ_LT855380.1|WP_025994188.1|5153074_5153638_-|response-regulator-transcription-factor
MSDEEIQVDGEELPHLLLVDDDATFTRVMARAMSRRGFRVSTAGSAEEGLILAQQDIPEYAALDLKMDGDSGLVLLPKLLEMDPDMRVVILTGYSSIATAVEAIKRGACNYLCKPADADDVLAALLSEHANLDTLVPENPMSVDRLQWEHIQRVLTEHEGNISATARALGMHRRTLQRKLQKRPVRR
>NZ_LT855380.1|WP_025994187.1|5153634_5154894_-|HAMP-domain-containing-histidine-kinase
MLAPVQMLSATRQNLWRLTFIRILVLAAQAGSVGIAWLFDFLPLPWLQLSITLGCSLILCLLTVIRLRTSLPLTELEYALQLALDLLIHSALLYYSGGSTNPFVSYYLVPLTIAAATLPWRYSLILSGFALGLYTFLMVQSYPLETYPIARENMQVYGMWLSFVLAAGVITFFAAKMAEELRRQDQLRAERREEGLRDQQLLAVATQAAGAAHELGTPLATMSVLLKEMRQDHSDPALQDDLAVLQEQVKQCKQTLQQLVRAAEANRRMAVDYQPATQWLDESLNRWHLMRPEVSYRFQKLGKDEVPMLAPPPDLTQALLNLLNNAADACPDGLEVNLDWDSTEVCISIRDHGAGVPLAIAEQIGKPFFTTKGKGFGLGLFLSKASVTRAGGSVKLYSHEEGGTLTELRLPRDTRGEEA
>NZ_LT855380.1|WP_058431854.1|5155086_5155803_+|SIMPL-domain-containing-protein
MFTLRPAATLFALAAVTLSSLPAMAEEARYNQISLRAEVNQEVQRDLMMVTLYTEAQDSDPAKLAAQVTETLNKALGQARQAKDVKIRQGSRNSYPIYDDKGQKITGWRERAEVRLESADFAALSKLTGELLGDLKMGGMDFSISPATRKASEDTLLKDAVTAFKARAQLVTEALGGTGYKLVNLNLNTSGYPQPYLRAPVAMMMKSSREDAAPTPDVEAGTSQVSVAADGVIEVAVP
>NZ_LT855380.1|WP_088236012.1|5156136_5157684_+|hypothetical-protein
MNPQDPTRHQPAHDQHDNIAEPLPVPLRFEAGEGDEHRHTHGSIEAVLETAGFRKDEIRAIYYGNWLRDHSQLVDPKLVRAPDMPKSFPDLLSREALTGIVDVLAVKAFTDLMKIDRSRFIVTPQRLGVYRAAEHIDNPRAINPAPANPKSRDADFEDWTLPDDPILQVDPETSMKRYLQRSVDLMATDLDIAVQAGPSSTDGLRAMGAALHILEDFFAHSNFVELSLIKLGHTDVLPWTSEADCRHRLPLVTGSFGGSDIIASLAAPLGKILFPNKDKPFEALQPGVRYERDQVIQILLGEHPDENLLRAFEEFLKARDGWALLPFSEQVERFYAFIATPGRLLGNAVGSVLLGLMAMLGNSIDDLQTGLGDDPHTNGSTDPSHSQLAKDHAEHPLHEPAALLARHAVLQVGQAVLGQWHSVDETEHPSQVAARFFAHAMDTDWQDTLLREWADAHPEQVRRATLKNELDQLHRHIQSHASEALQQFEHSSDNFLDTFFKSTSLSDLWKKITGK
>NZ_LT855380.1|WP_088236013.1|5157790_5159392_+|ABC-transporter-substrate-binding-protein
MGHTIFKPLLLTTALLACAPLAQAATTLVYCSEASPAGFDPSQYTSGTDFDASAETVFNRLTQFKRGGTEVEPGLATRWDVSSDGLTYTFHLREGVKFHTTDYFKPTRTFNADDVLFTFNRLLDPNHPFRKAYPSESPYFTDMGLNTTIKQVEKIDANTVKFTLNNIDAAFVQNLAMSFASIQSAEYADQLLKEGKAQDLNQKPVGTGPFVFKRYQKDSQIRYTGNTEYWKPEDVKIDNLIFSISSDAAVRLQKLKAGECQVSGYPRPQDIEEVQKDPKLKVLSQPGFNLGFLAYNVTHPPLDQLKVRQALDMAIDKQAIIKAVYQSAGQLAENALPPAQWSYDPTIKDAPRDLTKAKQLLKEAGVAPGTKIDLWAMTVQRASNPNARMSAQMIQSDWDKIGIKANIVSYEWGEYIKRAKAGEHDAMIYGWTGDNGDPDNWLGVLYSCAAVKGSNYAKWCDPAYDKLVQQAKLTTNRDERIKLYQQAQHILKQQVPITPIANSRVFQPMHKEVQDFKISPFGLTPFYGVSLSK
>NZ_LT855380.1|WP_029244387.1|5159656_5161279_+|ABC-transporter-substrate-binding-protein
MLKHAVIPFLVGATLLASAPFAHAASNLVFCSEGSPAGFDPAQYTTGTDFDASAETMFNRLAQFERGGTAVQPGLATSWDISDDVLTYTFHLRKGVKFHTTPYFKPTREFNADDVLFTFNRMINPDMPFRKAAPTEFPYFTDMGMDKNIAKIEKVDDYTVKFVLNTVDAAFIQNLAMSFASIQSAEYGDQLLKEGKAADINQKPVGTGPFVFKSYQKDSNIRFTGNKDYWKPEDVKIDNLIFAITTDPSVRIQKLKKGECQITAYPRPADLEPLKADKNLKMPDQAGFNLGYIAYNVMDKIKGEDRENPLSQLKVRQALDMAVNKQQIIDSVYQGAGQLAVNAMPPTQWSYDTTIKDAKYDPEKAKALLKEAGIKEGTEITLWAMPVQRPYNPNAKLMAEMLQSDWKKIGINARIVSYEWGEYIKRAKNGENGAMLIGWSGDNGDPDNWLGTLFGCDALNGNNFAKWCDKPYDAIIKQAKSTPDQAKRTELYKQAQHLLKDAVPMTPIAHSTVYQPMSTKVQDFKISPFGLNSFYGVSVK
>NZ_LT855380.1|WP_043306787.1|5161592_5163191_+|ABC-transporter-substrate-binding-protein
MRKTLAMTSCLSLGLLALTPMTGMASNLVFCSEASPAGFDSAQYTSATDNDASEPIYNRLTEFKQGDTTVVPGLATSWDVSQDGLVYTFHLRKGVKFHSNKTFTPTRDFNADDVLFTFNRMLKPDHPFRVAYPTEFPYFTGMGLNKKIKSVEKTDPLTVVFTLNTVDAAFIQNIAMNFAGILSAEYAEQLMASGDARDINQQPIGTGPFVFQRYQKDSQIRYRGNKEYWDPSRVKIDQLIFAINTDASVRVQKLRKNECQVTLNPRPADLEALRSDKALNVMERPGFNLGYISYNVRHEPLGNLQVRQALDMAVNKKAIINAVYQGAGQLAVNAMPPTQWSYDDTIKDAAYDPEKAKQMLRDAGIKEGTELTLWAMPVQRPYNPNAKLMAEMLQSDWAKVGIKVRIVSYEWGEYLKRTKNGEHDISLIGWTGDNGDPDNWLGTLYSCAAIGGNNYSMWCDEKYDALIKAAIATTDREQRTDLYKQAQRYLKEQVPITPIAHSTVNQPLRKEVEGFHVSPFGRNNFSGVSVAE
>NZ_LT855380.1|WP_058431857.1|5163346_5164762_+|OprD-family-porin
MKTTSTALLALSLSSFGAMVQAEPVSQAFVPTGLSTKNAQAEANGFLEDQHLTGTTRNWYANELFRRDNRFTYTKDGVDKETPRRINWQQGTIVNYTSGFTQGTVGFSTELALYNAVALERDIDDFVPRSNRTLADSDGDAVGQWSKMGLGNVKARVSNTVLTMGRQSVNTPVIAFIGNRALPSSFQGVALQSDELNNLSFQAGSFDRVSPRMEQSLDKFRSEYGDRTKTADRVDMFGADYKPFESLTTSLYASNVEDFWHQYYFGFTHEMGDSKTLAFSTNLNYYKTKDSGQAKQGPIDNDTYSLSFTGTHNAHSLSVAYQEVSGNEYFDYVHDTNAIFLANSLLSDFNGPNEKSLQIAYVLNMASYGVPGLKFNIYQARGWDIDGTNYKGTVYGDSQDIRGVETKTGVRAMDGETHYEYGIGTSYSVQSGPLKATAIRATYTTHRASENQADGNINEFRLVTTIPFNIL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	1583545-1583571	0	1.0
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	5379000-5379026	0	1.0
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	1677950-1677976	1	0.963
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	631390-631416	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	791118-791144	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	1380513-1380539	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	4137789-4137815	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	5190031-5190057	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	5397762-5397788	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	5928233-5928259	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	123954-123980	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	142487-142513	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	454720-454746	2	0.926
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_LT855380.1	5503655-5503681	2	0.926

1. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 1583545-1583571, mismatch: 0, identity: 1.0

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggccgatttgtgtataacgatgag	Protospacer
***************************

2. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 5379000-5379026, mismatch: 0, identity: 1.0

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggccgatttgtgtataacgatgag	Protospacer
***************************

3. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 1677950-1677976, mismatch: 1, identity: 0.963

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcggatttgtgtataacgatgag	Protospacer
****** ********************

4. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 631390-631416, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcagacttgtgtataacgatgag	Protospacer
****** **.*****************

5. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 791118-791144, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcagacttgtgtataacgatgag	Protospacer
****** **.*****************

6. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 1380513-1380539, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcggatttgtgtataacgctgag	Protospacer
****** *************** ****

7. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 4137789-4137815, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcggacttgtgtataacgatgag	Protospacer
****** **.*****************

8. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 5190031-5190057, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcggacttgtgtataacgatgag	Protospacer
****** **.*****************

9. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 5397762-5397788, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggctgacttgtgtataacgatgag	Protospacer
******.**.*****************

10. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 5928233-5928259, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcggacttgtgtataacgatgag	Protospacer
****** **.*****************

11. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 123954-123980, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcggacttgtgtataacgatgag	Protospacer
****** **.*****************

12. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 142487-142513, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcggacttgtgtataacgatgag	Protospacer
****** **.*****************

13. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 454720-454746, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcggacttgtgtataacgatgag	Protospacer
****** **.*****************

14. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to position: 5503655-5503681, mismatch: 2, identity: 0.926

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggcagacttgtgtataacgatgag	Protospacer
****** **.*****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LT855380_1	1.1\|2429607\|27\|NZ_LT855380\|CRISPRCasFinder	2429607-2429633	27	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	158697-158723	5	0.815
NZ_LT855380_2	2.1\|5150138\|27\|NZ_LT855380\|CRISPRCasFinder	5150138-5150164	27	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	245909-245935	5	0.815

1. spacer 1.1|2429607|27|NZ_LT855380|CRISPRCasFinder matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

cgaggccgatttgtgtataacgatgag	CRISPR spacer
cgaggccgatttctgtgtaacgaaaaa	Protospacer
************ ***.****** .*.

2. spacer 2.1|5150138|27|NZ_LT855380|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gcccgccccgacactgatcgtgcccac	CRISPR spacer
cttcgccacgacactgatcgtgcccgc	Protospacer
 ..**** *****************.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

583230 : 654795

Pseudomonas_phage(45.45%)

integrase,tRNA,plate,tail

attL 576908:576923|attR 656437:656452

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
576908:576923	attL	NA	NA	NA	NA
WP_010924794.1\|583230_584193_-\|integrase	tyrosine-type recombinase/integrase	A0A166YH27	Gordonia_phage	5.5e-06	26.6
WP_002556076.1\|584529_584778_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_003304103.1\|584790_585141_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_103365183.1\|585792_587178_-	P-type conjugative transfer protein TrbL	NA	NA	NA	NA
WP_088234448.1\|587381_588137_-	P-type conjugative transfer protein TrbJ	NA	NA	NA	NA
WP_088234449.1\|588177_588552_-	conjugal transfer transcriptional regulator TraJ	NA	NA	NA	NA
WP_088234450.1\|588844_589123_-	conjugal transfer protein TraK	NA	NA	NA	NA
WP_088236353.1\|589189_589915_-	phage replication protein	NA	NA	NA	NA
WP_003316232.1\|590036_590255_-	hypothetical protein	NA	NA	NA	NA
WP_167383072.1\|590555_591629_-\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	1.7e-48	37.5
WP_167383073.1\|591887_594338_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	2.4e-13	33.7
WP_058431050.1\|594757_596608_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	2.0e-36	34.7
WP_088234453.1\|596675_598631_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	5.3e-72	37.7
WP_002551877.1\|599036_599252_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_058431048.1\|599450_600476_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.6e-104	56.1
WP_004887799.1\|600484_601054_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_004887801.1\|601128_601482_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_088234454.1\|601472_602000_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_043305471.1\|602409_603642_-	multifunctional CCA addition/repair protein	A0A1V0E714	Klebsiella_phage	1.3e-76	42.7
WP_088234455.1\|603738_605301_-	SpoVR family protein	NA	NA	NA	NA
WP_004885330.1\|605297_606569_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	4.9e-10	38.9
WP_004885332.1\|606705_608628_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_004885333.1\|608911_609235_-	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
WP_088234456.1\|609231_610134_-	symmetrical bis(5'-nucleosyl)-tetraphosphatase	A0A291L9W7	Bordetella_phage	4.7e-07	40.5
WP_004885335.1\|610133_610514_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_004885336.1\|610630_611437_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_088234457.1\|611433_612423_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_057409966.1\|612419_613742_-	molecular chaperone SurA	NA	NA	NA	NA
WP_088234458.1\|613722_616503_-	LPS-assembly protein LptD	NA	NA	NA	NA
WP_088234459.1\|616632_617658_+	phosphotransferase	NA	NA	NA	NA
WP_088234460.1\|617699_618374_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_088234461.1\|618370_619138_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_058431035.1\|619477_620443_-	DUF3530 family protein	NA	NA	NA	NA
WP_058431075.1\|620510_622559_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_004885362.1\|622555_623185_+	response regulator transcription factor	NA	NA	NA	NA
WP_025995960.1\|623481_624606_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-27	34.0
WP_004885367.1\|624688_625723_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_004885368.1\|625801_627049_+	ABC transporter permease	NA	NA	NA	NA
WP_004885370.1\|627060_627885_+	ABC transporter permease	NA	NA	NA	NA
WP_029243361.1\|628059_628734_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_025995962.1\|628730_629549_+	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_029243360.1\|629619_631101_+	anthranilate synthase component I	NA	NA	NA	NA
WP_088234462.1\|631480_633412_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_004885381.1\|633525_633768_-	transcriptional regulator	A0A2H4J8B4	uncultured_Caudovirales_phage	1.9e-16	50.0
WP_088234463.1\|634085_634343_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_025995966.1\|634491_635103_-	helix-turn-helix domain-containing protein	A0A0M4QWY1	Salmonella_phage	1.0e-50	50.3
WP_088234464.1\|635278_635716_+	hypothetical protein	A0A2H4J8A5	uncultured_Caudovirales_phage	7.0e-25	48.2
WP_004885392.1\|636020_636410_+	hypothetical protein	A0A059VK40	Pseudomonas_phage	1.5e-42	74.8
WP_025995968.1\|636390_636729_+	hypothetical protein	A0A059VJW1	Pseudomonas_phage	6.4e-18	53.2
WP_058431030.1\|636815_637406_+	hypothetical protein	B5TK65	Pseudomonas_phage	4.7e-56	56.1
WP_004885397.1\|637402_637588_+	DUF2635 domain-containing protein	B5TK66	Pseudomonas_phage	1.5e-13	76.6
WP_088234465.1\|637606_639103_+\|tail	phage tail protein	B5TK67	Pseudomonas_phage	1.3e-224	77.1
WP_029243354.1\|639170_639518_+\|tail	phage tail protein	B5TK68	Pseudomonas_phage	2.5e-41	67.8
WP_025995972.1\|639514_639811_+\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	1.6e-33	76.3
WP_088234466.1\|639941_642224_+\|tail	phage tail tape measure protein	U5P420	Shigella_phage	1.3e-82	41.7
WP_088234467.1\|642220_643714_+	hydroxyacid dehydrogenase	B5TK71	Pseudomonas_phage	4.6e-100	41.2
WP_029243351.1\|643717_644824_+	hypothetical protein	B5TK72	Pseudomonas_phage	3.2e-106	57.4
WP_004885410.1\|644820_645330_+\|plate	phage baseplate assembly protein	B5TK73	Pseudomonas_phage	1.8e-64	73.2
WP_004885412.1\|645329_645728_+	phage GP46	B5TK74	Pseudomonas_phage	5.6e-45	65.9
WP_058431025.1\|645717_646758_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	2.4e-132	70.3
WP_025995979.1\|646745_647345_+	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	9.2e-84	71.4
WP_088234468.1\|647355_649158_+\|tail	phage tail protein	A4PE45	Ralstonia_virus	4.6e-38	58.7
WP_088234469.1\|649168_649681_+\|tail	phage tail protein	NA	NA	NA	NA
WP_088234470.1\|649816_650821_+\|tail	phage tail protein	NA	NA	NA	NA
WP_029243347.1\|650844_651390_+	glycoside hydrolase family 19 protein	A0A2H4JHX4	uncultured_Caudovirales_phage	7.1e-67	70.6
WP_058431020.1\|651386_651896_+	lysozyme	B5TK84	Pseudomonas_phage	3.6e-28	49.7
WP_029243345.1\|652291_652891_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.6e-72	64.2
WP_057410148.1\|652912_653962_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.2e-110	57.0
WP_088234471.1\|653958_654795_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.3e-69	55.4
656437:656452	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3588997 : 3600482

uncultured_Caudovirales_phage(75.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088235501.1\|3588997_3590794_-	type I secretion system permease/ATPase	F2Y1V6	Organic_Lake_phycodnavirus	4.2e-15	28.7
WP_029244542.1\|3590867_3591257_-\|protease	AprI/Inh family metalloprotease inhibitor	NA	NA	NA	NA
WP_029244543.1\|3591314_3592754_-\|protease	serralysin family metalloprotease	NA	NA	NA	NA
WP_004884720.1\|3593250_3593922_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.9e-106	91.9
WP_025993112.1\|3594270_3594663_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.1e-57	81.5
WP_058430527.1\|3594664_3595027_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.0e-37	66.9
WP_088235502.1\|3595026_3595323_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.6e-25	59.6
WP_029244549.1\|3595319_3595655_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	3.0e-44	75.7
WP_088235503.1\|3595651_3596653_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	4.8e-162	82.3
WP_029244551.1\|3596762_3597761_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_025993118.1\|3597806_3599201_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_004884697.1\|3599201_3600482_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.1e-97	53.0

DBSCAN-SWA_3

5737899 : 5815927

Pseudomonas_phage(60.61%)

capsid,portal,head,tRNA,terminase,lysis,transposase,tail,integrase

attL 5749419:5749447|attR 5822956:5822984

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025993333.1\|5737899_5738355_+\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_004883102.1\|5738678_5739170_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_029243875.1\|5739208_5739460_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	3.9e-12	38.5
WP_004883098.1\|5739462_5739876_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_025993335.1\|5740021_5741554_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_004883095.1\|5741707_5743018_+	murein hydrolase activator EnvC	NA	NA	NA	NA
WP_025993337.1\|5743051_5744383_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	6.7e-26	29.8
WP_088236200.1\|5744386_5745169_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_088236201.1\|5745172_5745928_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_025993341.1\|5746117_5746888_-	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_029243878.1\|5746923_5747661_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_004883087.1\|5747684_5747945_-	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_029243879.1\|5747950_5748589_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_004883084.1\|5748588_5749182_-	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
5749419:5749447	attL	NA	NA	NA	NA
WP_088236202.1\|5749737_5750934_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_088236203.1\|5751200_5752211_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_088236477.1\|5752390_5753290_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_043306308.1\|5753397_5755059_-	OFA family MFS transporter	NA	NA	NA	NA
WP_029241407.1\|5755322_5755727_+	acetyl-CoA sensor PanZ family protein	NA	NA	NA	NA
WP_088236204.1\|5755830_5758053_+	AsmA family protein	NA	NA	NA	NA
WP_004883066.1\|5758250_5759318_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_004883065.1\|5759314_5759587_+	oxidative damage protection protein	NA	NA	NA	NA
WP_088236205.1\|5760177_5760423_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_004883057.1\|5760605_5760887_+	hypothetical protein	NA	NA	NA	NA
WP_029244072.1\|5761151_5762498_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_088236206.1\|5762669_5763155_+	hypothetical protein	NA	NA	NA	NA
WP_088236207.1\|5763420_5764812_-	GABA permease	NA	NA	NA	NA
WP_029244070.1\|5765349_5766123_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.6e-19	31.6
WP_088236208.1\|5766136_5766907_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_043306318.1\|5766973_5767669_+	ABC transporter permease	NA	NA	NA	NA
WP_004883040.1\|5767665_5768355_+	ABC transporter permease	NA	NA	NA	NA
WP_088236209.1\|5768408_5769623_+	methyltransferase	NA	NA	NA	NA
WP_043306320.1\|5769924_5770251_-	hypothetical protein	NA	NA	NA	NA
WP_088236210.1\|5770705_5771029_-	hypothetical protein	NA	NA	NA	NA
WP_088236211.1\|5771935_5772949_-	J domain-containing protein	A0A2K9L1L4	Tupanvirus	9.0e-07	41.7
WP_088236212.1\|5774426_5774897_+	hypothetical protein	NA	NA	NA	NA
WP_145958191.1\|5775541_5776201_+	hypothetical protein	NA	NA	NA	NA
WP_088236214.1\|5776202_5778350_+	hypothetical protein	NA	NA	NA	NA
WP_145958192.1\|5778423_5779398_-	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	3.8e-119	63.7
WP_088236215.1\|5779370_5780081_-	hypothetical protein	A0A2I7RNK1	Vibrio_phage	1.2e-37	37.8
WP_088236216.1\|5780077_5780614_-	DNA-binding protein	A0A0U4J942	Pseudomonas_phage	1.6e-47	56.7
WP_088236217.1\|5780610_5781543_-	hypothetical protein	NA	NA	NA	NA
WP_088236218.1\|5781532_5782036_-	hypothetical protein	NA	NA	NA	NA
WP_088236219.1\|5782032_5784375_-\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	5.5e-108	52.2
WP_088236220.1\|5784383_5784908_-\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	2.9e-73	75.9
WP_088236221.1\|5784904_5786074_-	hypothetical protein	A0A0U4JJ14	Pseudomonas_phage	6.7e-155	70.0
WP_003342289.1\|5786070_5786388_-	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	1.3e-36	78.4
WP_088236222.1\|5786387_5788757_-\|tail	phage tail tape measure protein	A0A0U4IJ81	Pseudomonas_phage	5.2e-114	42.9
WP_003342293.1\|5788762_5788906_-	hypothetical protein	A0A0U4B0S4	Pseudomonas_phage	1.1e-14	73.9
WP_003342295.1\|5788926_5789217_-	hypothetical protein	A0A0U4B0P2	Pseudomonas_phage	1.1e-21	64.4
WP_088236223.1\|5789250_5789730_-\|lysis	lysis protein	A0A0U4JXC2	Pseudomonas_phage	1.4e-18	43.7
WP_088236224.1\|5789726_5790254_-	lysozyme	NA	NA	NA	NA
WP_004415377.1\|5790250_5790457_-	hypothetical protein	NA	NA	NA	NA
WP_004407224.1\|5790456_5790666_-	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_003342306.1\|5790665_5791118_-	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	7.2e-57	72.8
WP_088236225.1\|5791121_5792234_-	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	1.3e-136	67.1
WP_088236226.1\|5792248_5792917_-	virion morphogenesis protein	A0A0U4ISN1	Pseudomonas_phage	4.5e-55	55.7
WP_003420277.1\|5792906_5793350_-\|tail	tail protein	A0A0U4IBS7	Pseudomonas_phage	8.4e-50	65.1
WP_088236227.1\|5793346_5793808_-\|head	head completion/stabilization protein	A0A0U4J933	Pseudomonas_phage	1.8e-42	58.8
WP_003342323.1\|5793843_5794140_+	hypothetical protein	NA	NA	NA	NA
WP_088236228.1\|5794281_5795004_-\|terminase	terminase	A0A0U4JEJ1	Pseudomonas_phage	4.7e-82	70.3
WP_024662766.1\|5795000_5796023_-\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	8.5e-122	65.9
WP_003413628.1\|5796024_5796957_-	hypothetical protein	A0A0U4JVV6	Pseudomonas_phage	6.9e-62	47.3
WP_088236229.1\|5797118_5799173_+\|terminase	terminase	A0A0U4JIZ9	Pseudomonas_phage	4.2e-269	71.1
WP_088236479.1\|5799069_5799951_+\|portal	phage portal protein	A0A0U4B0L9	Pseudomonas_phage	6.5e-102	78.3
WP_005737198.1\|5800026_5800287_+	ogr/Delta-like zinc finger family protein	A5X9H0	Aeromonas_virus	1.5e-14	41.0
WP_162839122.1\|5800353_5800530_-	hypothetical protein	NA	NA	NA	NA
WP_044422709.1\|5800627_5800975_-	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	2.1e-16	43.8
WP_032633662.1\|5801067_5801268_+	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	2.9e-10	54.0
WP_088236230.1\|5801267_5801777_+	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	4.2e-45	58.3
WP_003420293.1\|5801773_5802136_+	hypothetical protein	NA	NA	NA	NA
WP_088236231.1\|5802206_5802446_+	hypothetical protein	NA	NA	NA	NA
WP_088236232.1\|5802442_5805136_+	bifunctional DNA primase/helicase	A0A2H4J936	uncultured_Caudovirales_phage	2.7e-300	56.2
WP_088236233.1\|5805158_5805554_+	hypothetical protein	NA	NA	NA	NA
WP_088236234.1\|5805626_5805860_+	hypothetical protein	NA	NA	NA	NA
WP_088236235.1\|5805936_5806149_+	hypothetical protein	NA	NA	NA	NA
WP_088236236.1\|5806145_5807294_+\|integrase	integrase	V9IQN0	Stenotrophomonas_phage	7.4e-74	40.5
WP_088236237.1\|5807480_5808929_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_088236239.1\|5810398_5810869_+	hypothetical protein	NA	NA	NA	NA
WP_088236240.1\|5811726_5813502_+	hypothetical protein	NA	NA	NA	NA
WP_088236480.1\|5814040_5814397_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	8.3e-16	40.2
WP_088236241.1\|5814415_5815927_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.2e-84	37.1
5822956:5822984	attR	NA	NA	NA	NA

DBSCAN-SWA_4

5863819 : 5916760

Leptospira_phage(33.33%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088236272.1\|5863819_5865373_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	3.6e-79	34.8
WP_088236273.1\|5865403_5866231_-	hypothetical protein	NA	NA	NA	NA
WP_088236274.1\|5867227_5867968_-	hypothetical protein	NA	NA	NA	NA
WP_145958198.1\|5870104_5870608_-	hypothetical protein	NA	NA	NA	NA
WP_167383131.1\|5870617_5873236_-	chitinase	A0A0X8WP64	Ralstonia_phage	1.1e-16	33.8
WP_088236277.1\|5873718_5874714_-	sel1 repeat family protein	NA	NA	NA	NA
WP_004882988.1\|5874743_5876780_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.7e-36	27.1
WP_029244040.1\|5876801_5877809_-	serine/threonine protein kinase	A0A2R8FEI0	Brazilian_cedratvirus	1.6e-11	33.9
WP_004882986.1\|5877805_5878534_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_058431375.1\|5878533_5882061_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004882984.1\|5882074_5882950_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_004882983.1\|5882955_5884287_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004882982.1\|5884289_5884790_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004882981.1\|5884795_5885992_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_004882980.1\|5886009_5886150_-	hypothetical protein	NA	NA	NA	NA
WP_004882979.1\|5886237_5887755_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_088236278.1\|5887765_5890414_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	6.3e-92	30.5
WP_004882977.1\|5890427_5891435_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_025993982.1\|5891398_5893186_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_029244037.1\|5893258_5893636_-	hypothetical protein	NA	NA	NA	NA
WP_088236483.1\|5893874_5894285_-	hypothetical protein	NA	NA	NA	NA
WP_088236279.1\|5894884_5895856_-	hypothetical protein	NA	NA	NA	NA
WP_088236280.1\|5895866_5896391_-	hypothetical protein	NA	NA	NA	NA
WP_003413694.1\|5896401_5896809_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004882972.1\|5896822_5898301_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004882971.1\|5898329_5898836_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004882970.1\|5898868_5900425_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_004882969.1\|5901214_5901733_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_088236281.1\|5901866_5903909_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	8.9e-38	27.3
WP_029242937.1\|5903898_5904642_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_088236282.1\|5904638_5909606_+	type IV secretion protein Rhs	A0A2H4JHK7	uncultured_Caudovirales_phage	1.5e-33	60.3
WP_127051615.1\|5909602_5910082_+	hypothetical protein	NA	NA	NA	NA
WP_088236283.1\|5912399_5912756_+	hypothetical protein	NA	NA	NA	NA
WP_088236285.1\|5913862_5914333_+	hypothetical protein	NA	NA	NA	NA
WP_088236484.1\|5914873_5915230_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.8e-16	40.2
WP_088236286.1\|5915248_5916760_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.5e-85	36.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LT855380

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection