CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LT906476	Legionella pneumophila strain NCTC11286 chromosome 1	2 crisprs	csa3,DEDDh,DinG,cas3,PD-DExK,WYL,RT	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LT906476_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT906476_1

2320347-2320437

Unclear

Consensus_repeat	Method
GGCTCTTCCCCAAATCCGGGGGCA	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of NZ_LT906476_1

>merge|NZ_LT906476|1|2320347-2320437|CRISPRCasFinder
GGCTCTTCCCCAAATCCGGGGGCACTAATCAAGAACACAAAACTTTAACCCTTAACCTATAGTTTTCGGCTCTTCCCCAAATCCGGGGGCA

>NZ_LT906476|1|1|2320347-2320437|CRISPRCasFinder
GGCTCTTCCCCAAATCCGGGGGCA	CTAATCAAGAACACAAAACTTTAACCCTTAACCTATAGTTTTC
GGCTCTTCCCCAAATCCGGGGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT906476.1\|WP_016356968.1\|2312372_2312858_+\|DUF1845-family-protein	unknown	unknown	gnl\|CDD\|378089
NZ_LT906476.1\|WP_016356970.1\|2315721_2316621_+\|integrase-domain-containing-protein	unknown	unknown	gnl\|CDD\|372340
NZ_LT906476.1\|WP_027224833.1\|2321773_2322352_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_014844326.1\|2326097_2327504_+\|ATP-dependent-RNA-helicase-DbpA	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|236977
NZ_LT906476.1\|WP_014844324.1\|2323614_2323911_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|226194
NZ_LT906476.1\|WP_016356969.1\|2314925_2315729_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_014326976.1\|2316956_2317217_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_014844329.1\|2329522_2329984_-\|cyclic-nucleotide-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|237999
NZ_LT906476.1\|WP_076613127.1\|2328663_2329182_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_LT906476.1\|WP_014844327.1\|2327660_2328572_+\|cation-diffusion-facilitator-family-transporter	unknown	unknown	gnl\|CDD\|226474
NZ_LT906476.1\|WP_014326978.1\|2317887_2318505_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_027224832.1\|2320443_2321619_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_LT906476.1\|WP_027224835.1\|2323370_2323625_+\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	unknown	unknown	gnl\|CDD\|274227
NZ_LT906476.1\|WP_014326973.1\|2313298_2314267_-\|DUF3644-domain-containing-protein	unknown	unknown	gnl\|CDD\|378842
NZ_LT906476.1\|WP_016356972.1\|2318537_2319029_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_025519966.1\|2312942_2313152_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_014326980.1\|2319039_2319858_-\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	unknown	unknown	gnl\|CDD\|182825
NZ_LT906476.1\|WP_010947832.1\|2325648_2325858_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_LT906476.1\|WP_027224834.1\|2322456_2323023_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_016356971.1\|2317279_2317786_+\|antirestriction-protein-ArdA	unknown	unknown	gnl\|CDD\|377800

Protein	Function_ID	Function_description	E-value
NZ_LT906476.1\|WP_016356970.1\|2315721_2316621_+\|integrase-domain-containing-protein	gnl\|CDD\|372340	pfam12835, Integrase_1, Integrase. This is a family of DNA-binding prophage integrases found in Proteobacteria.	8.38322e-11
NZ_LT906476.1\|WP_027224835.1\|2323370_2323625_+\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	gnl\|CDD\|274227	TIGR02606, Antitoxin_ParD, putative addiction module antidote protein, CC2985 family. This bacterial protein family has a very similar seed alignment to that of pfam03693 but is a more stringent model with higher cutoff scores. Proteins that score above the trusted cutoff to this model almost invariably are found adjacent to a ParE family protein (pfam05016), where ParE is the killing partner of an addiction module for plasmid stabilization. Members of this family, therefore, are putative addiction module antidote proteins. Some are encoded on plasmids or in prophage regions, but others appear chromosomal. A genome may contain several identical copies, such as the four in Magnetococcus sp. MC-1. This family is named for one member, CC2985 of Caulobacter crescentus CB15. [Cellular processes, Other, Mobile and extrachromosomal element functions, Plasmid functions].	1.27591e-15
NZ_LT906476.1\|WP_014844326.1\|2326097_2327504_+\|ATP-dependent-RNA-helicase-DbpA	gnl\|CDD\|236977	PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional.	0
NZ_LT906476.1\|WP_010947832.1\|2325648_2325858_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	3.52513e-27
NZ_LT906476.1\|WP_016356971.1\|2317279_2317786_+\|antirestriction-protein-ArdA	gnl\|CDD\|377800	pfam07275, ArdA, Antirestriction protein (ArdA). This family consists of several bacterial antirestriction (ArdA) proteins. ArdA functions in bacterial conjugation to allow an unmodified plasmid to evade restriction in the recipient bacterium and yet acquire cognate modification.	6.53039e-40
NZ_LT906476.1\|WP_014844329.1\|2329522_2329984_-\|cyclic-nucleotide-binding-domain-containing-protein	gnl\|CDD\|237999	cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels.	1.11581e-23
NZ_LT906476.1\|WP_076613127.1\|2328663_2329182_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.73229e-05
NZ_LT906476.1\|WP_016356968.1\|2312372_2312858_+\|DUF1845-family-protein	gnl\|CDD\|378089	pfam08900, DUF1845, Domain of unknown function (DUF1845). This family of proteins are functionally uncharacterized.	0.000775231
NZ_LT906476.1\|WP_027224832.1\|2320443_2321619_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	8.4756e-65
NZ_LT906476.1\|WP_014326973.1\|2313298_2314267_-\|DUF3644-domain-containing-protein	gnl\|CDD\|378842	pfam12358, DUF3644, Protein of unknown function (DUF3644). This domain family is found in bacteria, and is typically between 65 and 80 amino acids in length.	2.39606e-26
NZ_LT906476.1\|WP_014844327.1\|2327660_2328572_+\|cation-diffusion-facilitator-family-transporter	gnl\|CDD\|226474	COG3965, COG3965, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	2.15747e-100
NZ_LT906476.1\|WP_014326980.1\|2319039_2319858_-\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	gnl\|CDD\|182825	PRK10904, PRK10904, adenine-specific DNA-methyltransferase.	1.03134e-118
NZ_LT906476.1\|WP_014844324.1\|2323614_2323911_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	3.80144e-18

>NZ_LT906476.1|WP_014326980.1|2319039_2319858_-|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase
MDSITRIRPFLKWAGGKFQIISKIRSSLPEGSRLIEPFLGSGSVFLNTNYEQFLLADINADLINLFQHLKVEKSDFIYFCKKFFNTDSNSQSVYLSLRSEFNSTKDSYLKSALFLYLNRHSFNGLIRYNSSGKFNTAFGDYKQPYFPENEMFTFIQKAEKAEFRCADYKVIMKEAVKGDVIYCDPPYAPLSASANFTKYHSTSFGLEDQRQLVELAKELAAKGVPVIISNHDTTFIQSLYQGSRIVSFDVQRNISCNGSARTRAREVLALFD
>NZ_LT906476.1|WP_016356972.1|2318537_2319029_-|hypothetical-protein
MKQGGSYANSSGGVLEGLVEFALTKKGFTVVRYKDWRLNPSSYSEELLLKNVPYEGLYKHASATEFVLMSKAYNLNTRIECKWQQVSGSVDEKLPYLFLNCSEKMVEPHIIILLDGGGAKPGAIEWLRDACEKFNLKEATTSKRKIDLMSMTEFVQWVNSVFK
>NZ_LT906476.1|WP_014326978.1|2317887_2318505_-|hypothetical-protein
MLEDLNAINSGMVEFGCSLLGKSLYDLTFAPMGGECVHPYAYSSLVQALEILMKAAIAEKHPLLIYEKIPKLTSKNDQLNEFFKKARSRSFLDLPDLLALTTNYQIEYNLLEIAWINRCKIIHIGHSFSLDYTYSGLELTFNVIDPFIYKFWNRSSIDETTSFDSETPIYLVEHCLDYNINFKMRKGQIDKDEDIFPRITEQHYY
>NZ_LT906476.1|WP_016356971.1|2317279_2317786_+|antirestriction-protein-ArdA
MDTPQIYVACLAAYNNGILHGEWIDATQDANTIYDEIHEMLAKSPIEDAEEFAIHDFEGFGGAQISEYDSINDVAELASFIMKHGELGAELFSYYSIEDAERMLEENYHGAYDNEVDFARALFDDCYSSTIPEDLLFYFDYEAFARDLFISDYLSVEADGQTHVFSNY
>NZ_LT906476.1|WP_014326976.1|2316956_2317217_+|hypothetical-protein
MDDSFFNHLGETSLMWWFSQFLEKIMENVSSTISRKEYVFFDLACCINEFHALHEELSAQDIEEIKRLSKKLHSLLEDQHPRLNLV
>NZ_LT906476.1|WP_016356970.1|2315721_2316621_+|integrase-domain-containing-protein
MSNTKLRSAKFSINELVKKAYNHSYASQSDMRHMLFRCVKDLHELGYKIGHIKGLKAKHIYVLVEHWKSEGKNTGTIKNYMAKLRKTACLLDNPMLIKPENGAYNIGQRSYVSSINKAIHHIDLSRCTDPYIRLSLEGQMLFGLRREESMKFTLSEAHHGDSLTIKPSWTKGGIGRTLNITNEAQRQWLTKVSQQVKTGESLIPSNRTYKQHLSHYEEQAKIMGVSKLHGLRHAYAQRRYRELTQLFDSKNKGMLCPFEGGKKFQDMNPIEKAMDRKARQMISLELGHSRISITRIYCG
>NZ_LT906476.1|WP_016356969.1|2314925_2315729_+|hypothetical-protein
MRKSQLRQQVDQYCKHNHTGSFRAKKHRHFVLHKMIRDLYHIGHVPSKWHAVTHDHMVRLVAHWQKEEIKPKTIMKYMTLIRRFFQSIDHTIDNISNQNLGIKCAQLRSKTILFPNNHLEILKNPIAKIVIEFQIYFGLTLSEAMRLNPAIHIQENSLWITRDIATNSHDRRIPVRNDKQAQANKTLQTLCKEESLILTFGYHSVRGAYSHAIKKIGLSSSRSYRCFYAKSMYPELCQILSPYLAKQTIMREMGLQSRRTLWSYLHE
>NZ_LT906476.1|WP_014326973.1|2313298_2314267_-|DUF3644-domain-containing-protein
MAKQRKRSVFSIKNELIKKSQEAALAAIQLYNNPLITFKSESFIVLMNIAWTYLLHAYFRKNNVEYRYYNSPKSRKLFIKTKHGAYKYWELEKCLNHESCPLEKAIKDNLLFLIGIRHEIEHQMTSKIDSFFSAKFQACCINYNSTLKNLFGNDYGLEKITPIALQLFSFGESQVDELIEKKELPKNLLDFISDYETDCDSLTDSRYSYRVFYMRINTNHENQADRAYRFIDEKSASGMAIDNILFKYKQYKKLTQNEVIDIIKKQGKNFDKTAHQNLWKRLWKDASTRNIQAKQYGELVVNNQWLWYQETWIPKILELLSE
>NZ_LT906476.1|WP_025519966.1|2312942_2313152_-|hypothetical-protein
MKKLIFILLCFPTMIFANPAQESKNIETFKQLCKNGKDVSMREHYCKLLEQQKKAEAIFKDFEKNKSST
>NZ_LT906476.1|WP_016356968.1|2312372_2312858_+|DUF1845-family-protein
MKAEITLNLRTREVYKLFERKISGDRLFIDVILHKMNIVIGQNRKPNPMALKMLSEMEQQLNSLTNAFSSEIRRFEELLAKKKEFKDKQINFVVQFHPKIIVCNPLSIKLAELIEVYDQLIATLKLLRLAGCFETDQAYFIHMKQKQKLTNQSLSKIILAE
>NZ_LT906476.1|WP_027224832.1|2320443_2321619_-|ISL3-family-transposase
MPKKDCILNLPGYSIKKVSGENPVYIEVSYRNVVRCIYCGNKKLRKKDSFIRRIRHESIGLRRSYLCIKAHKYYCSVCSRYFNQRFPGIGKYQRASESLRKQVFHYHSKGVSQKDLARDLKLGKSTVERWYHYGYELRYKKIATRSCPRVLGLDEHSFNRKVGYATTFCDLAKHKIFDVVEGRSEKDLEGYLNTLEGKEKVQVVCIDLSSSYRKLIRRYFPNAMIVADRFHVIRLLNQFCLQTYQQIDPEMKYQRGLLAALRTNPNNLSVKRLNKRERYLQQQPVIAALYNFKQRLHRLLMRKHRTAKQCTRLIPLFLKLVASLKESPFESLKTLGRTLYQWREEVVRMWRFTKNNGITEGFHRKMKLIQRRAYGFRNFENYRLRVRVLCG
>NZ_LT906476.1|WP_027224833.1|2321773_2322352_+|hypothetical-protein
MVNITGGNINKKIYDEYLFYYQSRLPKDAHRHAPVLANVSVFLSNPSLITQALAVLEQEVKFLWDFENSTRTADKQLKLNQSIQFCRFMNLLWPVPNEELISNKTNNLLSKVLLYREQKHGFNFDENLSQRPVPTFVGFVDKKEADKVLEKNQLWSEENKLSPLFFHGKETHRLQLNLIMIAVELGLLDIGG
>NZ_LT906476.1|WP_027224834.1|2322456_2323023_+|hypothetical-protein
MNLRHPLILRKTPAIITDNMEHNSQYIYGMDPFYFHSYLMSIARKDYPYLAQCVTEKFCKSAFKLNQIENALGYKYGNDELRALGTNERDIMSTLERLAKAYNTNIHVITSEHILQYQQAKKEGKAFNEVTNSKKLEIRAGTIKSNGFTFKDTVGVVLFKKPYQGWQEYKKHKNSHSIMEASEKKRGI
>NZ_LT906476.1|WP_027224835.1|2323370_2323625_+|type-II-toxin-antitoxin-system-ParD-family-antitoxin
MTRTMTVDLGNELRNYVESLVRSGDYRSNSEVLRESLRLLREKQAESKLEQLRHLIDEGAASGKPETWDAHDFLKKMKKKSHVK
>NZ_LT906476.1|WP_014844324.1|2323614_2323911_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKRTEDYILAIDLSFQRLADDPLIARKCDYIRPELRAFNVGSHIIFFKTTDYGISVIRVLHQSMDFNRHL
>NZ_LT906476.1|WP_010947832.1|2325648_2325858_+|cold-shock-protein
MSKTVNGVVKWFNEIKGFGFIEQEGGPDVFAHFKEISSSGFKTLTEGQRVQFIVTQGAKGLQAQNITAL
>NZ_LT906476.1|WP_014844326.1|2326097_2327504_+|ATP-dependent-RNA-helicase-DbpA
MIQSEHNDQHLSFSQFPLRQELIKSLASSNYENMTPIQMQSLPIILRNEDIIAQAKTGSGKTAAFALCLLNNLKISFFAVQALVLCPTRELAEQVSQAIRRLACLMPNVKIINLSGGIPMQPQLDSLRHGAHIIVGTPGRILKHLKNASLDLSQVKALVLDEADRMLDMGFFDDIKNIISVCPKQRQTLLFSATYPEEIKRLSKQFMKDPKEVHVVTPPEEIDIEQHFYEVSRHTQKFPLLKSLLLHYRPVSVLIFCNTKQETVEVTDQLINEGFSAIALNGDMEQIERDLAVLRFANQSCSILVATDVAARGLDIKELSAVINFDLAFDHDVHIHRIGRTGRAGSKGIALSIVTPADAQRICAIEDNYPHPIHWRNINELENHNTARLVPEMVTLCIASGKKDKIRPGDILGALTKDAGLASNTIGKINITAMYSYVAIHHSQADKAYQYLQSGKLKGRKVNVRKIN
>NZ_LT906476.1|WP_014844327.1|2327660_2328572_+|cation-diffusion-facilitator-family-transporter
MTIQKGLHERRALKISIAVTFLLAVVGILFGLLSGSLAIVFDGMFNMVDTVISILAFFVARLLTSKGNRRFQYGYWHIEPMVLVLNGSILILLCTYALVNAIGSLMSGGHELNFDYAFVFALLVFFLSTGMYFYLVKTNRKIKSEFLRLDIQSWLMSALISTSLLLAFGIAALLHGGAYGYFTPYIDPLILAILTAFLIFVPMAAVRDAMRDIFRMAPVGLDERIREFLDELIKQHDFKTYTSYVAKIGRAQFIEIHIVVPMDYPISSIETLDKIRNEIALAIGEDTPQRWLTIAFTANENWI
>NZ_LT906476.1|WP_076613127.1|2328663_2329182_+|MFS-transporter
MDFLEQHYHLSQIDATLVNGFSTLGYIVGAPFFGVLSHKVKNVIPIMFYAALIESILLAFNILYLHDLHLKMIFYAIVGFFTGAVTIGFSLVKDYVKPTMIGTWIGILNMGQICVGMILSLLFGELLDLFHDNYIWAAIPVILCSFISVYASYWLWKKSQSPELPARAPYKH
>NZ_LT906476.1|WP_014844329.1|2329522_2329984_-|cyclic-nucleotide-binding-domain-containing-protein
MNKADLHNCVLFKGIDEKYIDDFLENCEEVELPEGEFLFHQNEIGDSMYIVEQGELQIILDQNSTDSNPQEEQVIGVLKSGALFGELCVFGQLKRAASIRALVDCRLLKIEGEDFRIRIYSKDLDALLICYNIAKLLSQRFITLLSLRPSLNM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LT906476_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT906476_2

2688325-2688491

Orphan

Consensus_repeat	Method
AAATTTACCGCGATAACAGTAATTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_LT906476_2

>merge|NZ_LT906476|2|2688325-2688491|CRISPRCasFinder
AAATTTACCGCGATAACAGTAATTTTATGAGTTTAACATAAATAAATACACTGAAAATTAGAAAGCCGAGTAAATTTACCGCCATAACAGTAATTTATGGGGAATTAATGCAAAAAAATGCAATAATAAATTTATTTTAATCATTTTTACTGCTATAACAGTAATAT

>NZ_LT906476|2|2|2688325-2688491|CRISPRCasFinder
AAATTTACCGCGATAACAGTAATTT	TATGAGTTTAACATAAATAAATACACTGAAAATTAGAAAGCCGAGT
AAATTTACCGCCATAACAGTAATTT	ATGGGGAATTAATGCAAAAAAATGCAATAATAAATTTATTTTAATC
ATTTTTACTGCTATAACAGTAATAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT906476.1\|WP_027224433.1\|2682328_2683675_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_027224428.1\|2689041_2689974_+\|HipA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377920
NZ_LT906476.1\|WP_015961553.1\|2681524_2682160_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_LT906476.1\|WP_027224430.1\|2687152_2688070_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_LT906476.1\|WP_015961552.1\|2680125_2681520_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_LT906476.1\|WP_014844541.1\|2699064_2699973_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_LT906476.1\|WP_027224434.1\|2679862_2680123_-\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239560
NZ_LT906476.1\|WP_014844539.1\|2696318_2697218_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_013101792.1\|2688512_2688740_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|213767
NZ_LT906476.1\|WP_042233675.1\|2683664_2684372_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381179
NZ_LT906476.1\|WP_027224432.1\|2684639_2685866_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_LT906476.1\|WP_014844538.1\|2695997_2696291_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|277194
NZ_LT906476.1\|WP_027224426.1\|2692704_2693649_+\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_LT906476.1\|WP_027224431.1\|2686500_2686974_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_027224427.1\|2690102_2692670_+\|magnesium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319772
NZ_LT906476.1\|WP_014842401.1\|2684422_2684620_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_027224429.1\|2688736_2689045_+\|HipA-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|274416
NZ_LT906476.1\|WP_106202151.1\|2693913_2695695_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319844
NZ_LT906476.1\|WP_014844540.1\|2697379_2698819_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906476.1\|WP_027224435.1\|2678621_2679830_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340863

Protein	Function_ID	Function_description	E-value
NZ_LT906476.1\|WP_027224432.1\|2684639_2685866_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.6053e-13
NZ_LT906476.1\|WP_027224430.1\|2687152_2688070_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.68537e-55
NZ_LT906476.1\|WP_015961552.1\|2680125_2681520_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.15645e-28
NZ_LT906476.1\|WP_014844541.1\|2699064_2699973_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.67439e-50
NZ_LT906476.1\|WP_027224434.1\|2679862_2680123_-\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239560	cd03478, Rieske_AIFL_N, AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox). The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. AIFL shares 35% homology with human AIF (apoptosis-inducing factor), mainly in the Pyr_redox domain. AIFL is predominantly localized to the mitochondria. AIFL induces apoptosis in a caspase-dependent manner.	1.28129e-10
NZ_LT906476.1\|WP_013101792.1\|2688512_2688740_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|213767	TIGR03070, couple_hipB, transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems. [Regulatory functions, DNA interactions].	1.63778e-24
NZ_LT906476.1\|WP_027224428.1\|2689041_2689974_+\|HipA-domain-containing-protein	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	1.81154e-59
NZ_LT906476.1\|WP_027224426.1\|2692704_2693649_+\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	6.70438e-18
NZ_LT906476.1\|WP_014844538.1\|2695997_2696291_-\|hypothetical-protein	gnl\|CDD\|277194	cd15841, SNARE_Qc, SNARE motif, subgroup Qc. SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) proteins consist of coiled-coil helices (called SNARE motifs) which mediate the interactions between SNARE proteins, and a transmembrane domain. The SNARE complex mediates membrane fusion, important for trafficking of newly synthesized proteins, recycling of pre-existing proteins and organelle formation. SNARE proteins are classified into four groups, Qa-, Qb-, Qc- and R-SNAREs, depending on whether the residue in the hydrophilic center layer of the four-helical bundle is a glutamine (Q) or arginine (R). Qc-, as well as Qa- and Qb-SNAREs, are localized to target organelle membranes, while R-SNARE is localized to vesicle membranes. They form unique complexes consisting of one member of each subgroup, that mediate fusion between a specific type of vesicles and their target organelle. Their SNARE motifs form twisted and parallel heterotetrameric helix bundles. Examples for members of the Qc SNAREs are C-terminal domains of SNAP23 and SNAP25, syntaxin 8, syntaxin 6, and Bet1.	1.22334e-13
NZ_LT906476.1\|WP_027224427.1\|2690102_2692670_+\|magnesium-translocating-P-type-ATPase	gnl\|CDD\|319772	cd02077, P-type_ATPase_Mg, magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA. MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_LT906476.1\|WP_027224429.1\|2688736_2689045_+\|HipA-N-terminal-domain-containing-protein	gnl\|CDD\|274416	TIGR03071, couple_hipA, HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.	5.37248e-44
NZ_LT906476.1\|WP_015961553.1\|2681524_2682160_-\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	5.31538e-37
NZ_LT906476.1\|WP_106202151.1\|2693913_2695695_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319844	cd07544, P-type_ATPase_HM, P-type heavy metal-transporting ATPase; uncharacterized subfamily. Uncharacterized subfamily of the heavy metal-transporting ATPases (Type IB ATPases) which transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_LT906476.1\|WP_042233675.1\|2683664_2684372_-\|hypothetical-protein	gnl\|CDD\|381179	cd19916, OphMA_like, tetrapyrrole methylase family protein similar to Omphalotus olearius omphalotin methyltransferase (OphMA) and Dendrothele bispora dbOphMA. OphMA, is the precursor protein of the fungal cyclic peptide Omphalotin A. Omphalotin A is a potent nematicide, having 9 out of 12 of its residues methylated at the backbone amide. Omphalotin A derives from the C-terminus of OphMA (also known as OphA). OphMA catalyzes the automethylation of its own C-terminus using S-adenosyl methionine (SAM); this C terminus is subsequently released and macrocyclized by the protease OphP to give Omphalotin A.	5.61241e-84
NZ_LT906476.1\|WP_027224435.1\|2678621_2679830_-\|hypothetical-protein	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7029e-13

>NZ_LT906476.1|WP_027224430.1|2687152_2688070_+|LysR-family-transcriptional-regulator
MDKLNLNLLRALYALLTCRHLTLASKKMGISQSSMSIYLKQLREHFHDDLLVRGQGNIMQLTPLANSLIGKARQALSLIETLFNTIETFNPLISERSFSIGMTDLMSILLTPSLIKRLEQEAPGVKLNIKHPSYLNTVEVFESGDIDLMIGMFERVPEGLKQQKLFQDEAVIVGGNNHPGIQKGKICIEELFKYPLIQFSLRETPFYNYFDRYLRQLGHDKRVSISLGQGIMPLFVLTDSHYLTLSIRKVAEKLSHLIPLSIASVPFEVDSFNCYQYWHQKDDADPGHRWLREMVLSIAKKSYLK
>NZ_LT906476.1|WP_027224431.1|2686500_2686974_+|hypothetical-protein
MRSRTEKLSSKRSIINHDHLITDEACMIGIYREGGDLSIYAESSEGIEHFSINRGNSLDMVILPHTLVGTWGHHQLLRTVEQAAQIRALRIRSHDYIEQSVTRKELEQFKEVFMLACKEEISNQPEIEDYLQTALGKLHGEPEMTYKPKFTEQCSIL
>NZ_LT906476.1|WP_027224432.1|2684639_2685866_-|MFS-transporter
MRNFFKNISALYLDVPKLTKTLLPIIILEHLVASFCLNISAYFKKVNYFQYEQIGEFISCYYWGCLFGSLIGGALTLYYKTSKISGWGLMLLGVCLFGLMNSISLWLIAISMFLVGFIGTITATANLTSLIRSVKDNEKLKLKVISLDLIIFNLCFSFVTFVLLDLSPLYILKYVQIMICLLVFVGIGSLIFYQDSIFNPPKLGSLGFKIILPERKQEFMLLMSMVLFFGLIFSMVKVVFAPTLIERFGSNMMSVIAASINPWVVFLIQPLIVGRIKNSNSIWFLGIGGLIVGLSYFMFGMVNSFELTAIVLVLLTFGEMMFGPLSKHFNIQLYRSGQEGVATGIWRAVFLGSGAIGPGLSGYVAEYYGTYVVWDCCALLGLLCFVFSLYLRKIQIKMPYSKLVLDNQ
>NZ_LT906476.1|WP_014842401.1|2684422_2684620_-|hypothetical-protein
MNTYEKLVYLATEPIDNKVVLCDKKGSKLKSSLAVQEELKDEFIHADLSIDIRRACETHLSFVLR
>NZ_LT906476.1|WP_042233675.1|2683664_2684372_-|hypothetical-protein
MTLEVQSVIQKCDCVIYLVNEPAIKRWIDENSKKAISLDAIYFSFQERKEAYQAICQEVINIVTKNQNTCFIIYGHPLILSNSAEQLIKEIKEESLDLEIEILPGISSIDTLLCDLCIDPGNGGLQAFEATEFINTNYKINTNSHLILWQIGVVGVKSIIQNDKDLVDSIERKIAIFQLQRKLLDWYNETHPIVLYVASIYPQIPCEKFDICLSNLDKVNIPRLATAYIKPDLIP
>NZ_LT906476.1|WP_027224433.1|2682328_2683675_+|hypothetical-protein
MFTTIDNNEGIVQTYWTEVRNKFEKADPYLSKLIDNVSPDKLPIYLLYFPYGMLKGDTKSSYMPLLDGGYIKLSDTGVDKKIVNDLGYGMYSSPLGMVLDKFIEYFIEFDDKIFTYYISGPGTIFNTGMLLKNKNSRNYSPNGVLKATAGARTAFMLPSINSHNGINKLSKLVNQDLTTPRNHNDHFELFKAINQHDNSNWKVCLAYFSEKWVKHLLTDPAWVEIKNYMLEAKNKNDSFSVNSAYYDIFYSKAQKDRNLRTSSPYLTNTAIHLIKIALGEHPGYVPATTANFLPIESIQKFISESFQLKRTPTIMVPHSLVYEKEKEPVYYSLQNPTTPHFLTKKNEKVTANQEIDIIYRILNKFIEEMSKQDSLLAGTVFSDISDHIRFNYFHNYPPKDSNLINNSRQLSKLDPRFNFSSYKNGESEFCFEGQFLRGCIQIQPNVKE
>NZ_LT906476.1|WP_015961553.1|2681524_2682160_-|flavin-reductase-family-protein
MFLQTSQKLPKGMFKACVVPRPIAWIGTKDSEGNHNLSPFSFFNIVCEEPPMVMFATTGAHNSGGAKDTLKNVEDTKEFTVNLVSYGSKEAMNITSLDFSRGISEFDMAEVDHLPSRLIQTPRVKESPISLECVYHESIQLPIPIHSNLINRMVIGKVVGIHLKPEILTKDKRIDTNKLNLIARVGYNSYTKVKAHFDLNRPCGCCNKLMD
>NZ_LT906476.1|WP_015961552.1|2680125_2681520_-|iron-containing-redox-enzyme-family-protein
MNKIINKLEANTPSKHIQQHFKELLNIYLHNPCFTDAAFLNPPNPYVRPLRTSDTLNINYDSAVALPEVYTNKNLIINKLLLNIYEQDLLFLANGNACEAKKDFANFYNPYYTAIGKALLPKLEQLAFNFLKDEIEIIGNWTKPKLLDYLINTILEQEKETSELCEAIVGSNNPIRAAKMLLIQMAPDFLSEASAMARALPGSFGIEQSELMKVFIDEYGYGVHETKHSTLFEATMLSANLNPTIHYYYNDYLATSLMLVNYFHCICKNKSDWFKYIGTLYYTEASIPHFNKQISKTLKNILPNINTKYFDEHVHIDKHHRRMVLEKIIATSIDKYGEEIIEDILFGFEAFKLLQNLADTDLAKQIQFSDQLDESYFPSNYTLLAESLTFNETELEITSAHLHADDELFQVTRGELIFYPNSLSPIILKANHRIVIPKGRLHSTVSQSANTQYVVQPIEISTGA
>NZ_LT906476.1|WP_027224434.1|2679862_2680123_-|Rieske-2Fe-2S-domain-containing-protein
MINKKHILNNRYFCKNDENYFIVKLNNKRFAIPDKCPHRGGPLSLGNICRESQRIQCPWHDGYFKISSLIKSAIPAVRVKDQIFYI
>NZ_LT906476.1|WP_027224435.1|2678621_2679830_-|hypothetical-protein
MVRHLKLIIILAFTLAGDILFGLALIWRVLALDGSAKTLGLFLCVITLVTFALQKSSVGFRRMLEKTPRRSFMWIRGVGVGFSIIFIPLLWHETTWLLYLVGAIATIINFLSILTLEAMMAHEVLEKRISSNKASRILQIAILTSSFLGASLLGTILALGNIVAVLLFCIATYLVGAICFSTQSDVGIQKISQVQTAKTASNQKMTYGNNLSVLRLAFIGLTLLMTQISAFNFLLPLIAQHEKFWTASQYGFIDAAAELGGLLATIIMFEKGIFSKLWIFAFLGIALVDILFFAVTDIYLISTATLFLGFCVSCFRIKQREYIYDSVSNTEEILEWTGRITAMTAIIKALTPLGLAFFISQPSFDLMIIGIVVGTVMLIVTSVLYFYTNKEFKQQIPSYSAV
>NZ_LT906476.1|WP_013101792.1|2688512_2688740_+|helix-turn-helix-transcriptional-regulator
MPTHEIANLVHYYRKQSGLSQQELAHLAGVGKTVIYDIEKGKESVRLNTLLKVLDVLNIQMKFETPFPQTTDNNS
>NZ_LT906476.1|WP_027224429.1|2688736_2689045_+|HipA-N-terminal-domain-containing-protein
MRKAYVSVNGIKAGILEELQSGKYQFSYFDDYHGAPVSLTMPLTNKVYDFDVFPPFFEGLLPEGIMLEALLRKYKIDKNDYFGQLIIVGQDVVGAVTIEEIR
>NZ_LT906476.1|WP_027224428.1|2689041_2689974_+|HipA-domain-containing-protein
MKRCPITYEKISDQENYSQRGLRLLSPQLKNLSPLDLSADEQRQEAIARVGKMSIQGVQKKLSAKLKIKEGSFEIVDQNGHYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKSSMEKVIAIIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITRDRKISISPAYDLLNSTIAQKNTKEEIALPLKGKKNNLTKSDFLNYFAVEKLGLNQNVINGIAQEFHQAIPEWRELISFSFLSQPMQEKYLQLLDQRCKRLNF
>NZ_LT906476.1|WP_027224427.1|2690102_2692670_+|magnesium-translocating-P-type-ATPase
MKINLDLNDLSTYDQDLLLNELNSSLEGLNNFQAQKRLTQYGTNEILRKPYHLIIIEAISHSINPLVAILFFAALISAFTGNVVNAAIIISIIIISIGLDYFQSHRALVAIKMLQKKIATTVTVLRENQWLEIPAKELVPGDLFRLSAGDMVPADSILLKSKDLHIHQSALTGESMPVEKEAIPLKTKPKNPLDALNVVFSGSSVIGGSATALAINTGSNSLYGHIAESLKKKPPHTEFEQGMMRFSTFIMKMVFLLVIFVFSINIYMHRPLLDSLLFAVALAVGLTPELLPMITTVTLASGAVRMSKKKVIIKNLSAIQNFGSIDILCSDKTGTLTSGEMNLTKYLDFSGKQSEFVMLLAYLNSVYITEIKSPFNIAVLKKARLNPLDLAILKHDHPDIQPYHKVDEIPFDFERRRSSVIVSKNENHLFICKGAPENIMSVCSYYDFAGERELFTEKEQKQCELLFQSLSSEGYRVLAIAYKLMDRQLKYTQSDEKEMIFAGFLAFTDPLLEDIPKVIKDLRHEGINIKILSGDNLIVTQHICQKVGMDTSRILTGEEISKISDDALPPLAEQIDIYARINPMQKQRIISALKKRGHVVGYLGDGINDVPSLHQADVGISVASAVDIAREAADIVLLEHHLKVLLNGIIEGRKSFRNVMKYLMMGTSSNFGNMISMAIAVLFLPFLPMLPRQILLNNLLYDISQITIPTDHVDPSSIHRYKRLDINIIRQFMFYVGPISSVFDFLTFFVMLKIFSANEALFQTGWFVESLATQTLVIFIIRTAKKPWQSMPSLPLTTTVLLIVMVGIWLPFSPFSGLFGFVPLPPLYFLFLVTATFTYLFLVELIKKKIMRKLY
>NZ_LT906476.1|WP_027224426.1|2692704_2693649_+|flippase-like-domain-containing-protein
MIKWISGFIILVVLIIVIGHFSQLRVFLGLIEQMKFSWLFFAVIFQSGTYMSLAAVWRLALRWFGEQISFFQLFLLSFSQLFVNQTIPTSGLSGVTIMTKFLLGRLITPKAIALAIALNVFSRQVAYLTSFIASIVVFWFYNELNKTLISLSLIFILIMVAVLILAALLWQQALKLKIPKLLNKYTSIRILINEIKKLDPKIVLNFKLFFPAVVFSVAIFIFDSLTLWTILKSLNLDLNFRLIFAAQVIASSIASLSFFPGGLGIFEGSLTGLLTFLGLSIEQAFTATILFRGFTYWLPMLPGFLLTQKELLRI
>NZ_LT906476.1|WP_106202151.1|2693913_2695695_+|heavy-metal-translocating-P-type-ATPase
MKIINVPYINVPLILIIIIGGLPLFIQISIKLVQGDLGADTLAALSLITGVILHEYLAACLIILMLASGQTLEVYARRKASSVLQALISRMPSKVHIRKNEQITDIPLSETQIGDEIIIYPHETCPVDGEVIDGHGTMDESYLTGEPYLIAKAPGVTVLSGAINGEALLVVKASKRPSDSRYAAIVEVLKEAEQKKPTLRRLGDQIGAIFTPIALFFALLAWYFSGDPIRFLSVLVIATPCPLLIAIPITIISAVSMAAKQAIIIKDPTILERLPTCQTAIFDKTGTLTYGKPTLTKIITTETYSHSDILQYAASLERYSKHPLSNSILDAAKERGLTLLQASEVFEKPGQGLLGKINDHSVQVTSRKKFLAKHPEEVGFLPEHSSGLECLILIDEQFAAVLQFHDAPREESHSFIHHLAPSHQFKKIMLVSGDRESEVKYLGKLLELTEIYSSQSPEQKLKIVRDETRKAPTLYMGDGINDAPALTAATVGIAFGQYSNVTAEAAGAVIMENTLNKVDELMHLSINTRKIALQSAIGGMLLSIIGMSFAALGFINPVTGAILQELIDILAIINALQLTWGSRVKIDLPGYKA
>NZ_LT906476.1|WP_014844538.1|2695997_2696291_-|hypothetical-protein
MKKNSSTKKILSSLSDTELQEKQELMMSEQDEQLDILLKTVTRTHEIAEAIQEELTSQNKLIDGLNEHVEKTDGKVKNTTKKVEALIPEVRSSCFLM
>NZ_LT906476.1|WP_014844539.1|2696318_2697218_-|hypothetical-protein
MFSPLQDPWSELEELGFNPEYLKRLKERAATSIEMTKNIEMLADYYEQFKEVGFTDSDLARIVSLVSFTADNRLANIGSRMMITLVCGGLNLVKAPLHFKPHKLTNMMLSLNGLEKLRTLVEMSKESGFTPLKNQAEFKAIFEKRCKKFPMLRVLWCYSDANESYMEYRKQDAIYKDWLSEEELHQLNRLSRISKTRDLHYWKRDTVRPVLLGDNYYSREDFGQTREEFEKAQDNPDAVESWCDSWANPFDQNPDSALTQSQEKSNQRNASKIPFFTVYENNGKSGVVDEQQSSNAFSN
>NZ_LT906476.1|WP_014844540.1|2697379_2698819_+|hypothetical-protein
MENKTKALNFLNRIERCLVPQSNPQIMKQLLSALGLDKLTTGNEEYKFFIQTIKKKSIDLNPLISKVKSDILNNDPLWTLLDYIEANELIDDAEIENASSTIQLQINLLCLLEAITITMANSNDFAHDIYNHMMKQRGKGATGNPFYNFLFGIPSRATLFERLKLISIDPGLTSIIFHRQMGENPETQADLDDFVSQNSLSGWNADIELANFDVASTSTLPAMGVNILEAVWEDATGHNKNTGGILNAQAGLGLIRVMEEQEYTTSFKLAETTLPQGTTLHSDFGYSLIPELKVDNSPKKVSQFHIDKQWMNLYNSWNLLFVIGNIDSVFVPLKLLMPSVFSAEPSNYKETRVLTLFLVANLFLNQQTLNNPLFSNNFSFRNGTVIMKKWGEINKNHASELLQQCKELDDLYNHVLGKNPHLNFGLKLFSYFQDSHQFRLTKKAQPSTSIDYSFFSGNTPSENNSEKMGVALHSSLYTK
>NZ_LT906476.1|WP_014844541.1|2699064_2699973_+|LysR-family-transcriptional-regulator
MNILSCLKGFITTVDCKSFSKAAQKLYISPSKLSKQITWLEEELKVTLLIRSTTRLTVTDSGHRLYEKSLQLFEQLEAVKVIATPDQLELNGVIRLYLTVTPAIPYLTTLSIQFMRQYPKIEVDIIVGSDTKELYSSTFDLAISFDDVKHSKLVCKRLFSIQRKVFASPGYIAQHGLPQTLDELPKHNCLINTLYGLQNKWVFNKKIIHVSGNFKSNNAGVLKQAAVADVGILWAPYFSVYEEIKNETLIPVLPQESSPDINLYAICPKSTVDEQKINLLLNFFCEKALSENIATSFIDGNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

525234 : 556887

Alteromonas_phage(16.67%)

tRNA,holin,integrase,protease

attL 528775:528790|attR 554781:554796

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011945640.1\|525234_525912_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_027219171.1\|525923_527048_+	M42 family metallopeptidase	NA	NA	NA	NA
WP_011945642.1\|527125_528613_+	Dot/Icm T4SS effector AnkC/LegA12	NA	NA	NA	NA
528775:528790	attL	NA	NA	NA	NA
WP_027219172.1\|528821_529964_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_011213116.1\|529966_530881_+\|protease	protease modulator HflC	R4VJU7	Alteromonas_phage	8.7e-09	29.1
WP_027219173.1\|531015_532311_+	adenylosuccinate synthase	A0A285PX35	Cedratvirus	2.4e-73	34.9
WP_027219174.1\|533436_533766_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_080271422.1\|533743_533938_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_050486545.1\|534104_535271_+	EAL domain-containing protein	NA	NA	NA	NA
WP_050486546.1\|535281_536004_+	response regulator	NA	NA	NA	NA
WP_050486547.1\|536031_538557_+	response regulator	A0A1V0SGX0	Hokovirus	4.2e-69	33.9
WP_011213119.1\|538683_539142_-	arginine repressor ArgR	NA	NA	NA	NA
WP_027219175.1\|539272_540007_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011945648.1\|540003_540651_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_027219176.1\|540634_541303_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-26	38.0
WP_027219177.1\|541299_542517_+	argininosuccinate synthase	NA	NA	NA	NA
WP_011945651.1\|542509_543745_+	argininosuccinate lyase	NA	NA	NA	NA
WP_027219178.1\|543747_544863_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_027219179.1\|544952_546428_-	adenosine deaminase	NA	NA	NA	NA
WP_027219180.1\|546602_547718_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_027219181.1\|547789_549127_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	7.7e-22	27.4
WP_027219182.1\|549207_550350_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_027219183.1\|550336_551881_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_011945658.1\|551983_552280_-	hypothetical protein	NA	NA	NA	NA
WP_013101097.1\|552356_553628_-\|holin	phosphatidylcholine hydrolyzing phospholipase	NA	NA	NA	NA
WP_027219184.1\|553977_554694_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	7.0e-22	38.1
WP_011213133.1\|554704_555502_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
554781:554796	attR	NA	NA	NA	NA
WP_011945662.1\|555534_556887_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA

DBSCAN-SWA_2

930293 : 937132

Acinetobacter_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027225204.1\|930293_931070_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.5e-57	48.2
WP_027225203.1\|931062_932097_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.2e-75	47.6
WP_011945952.1\|932074_932653_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.3e-55	53.2
WP_010946572.1\|932686_933412_-	LPS export ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-17	28.3
WP_011215024.1\|933408_933918_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_011945954.1\|933898_934468_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_011945955.1\|934464_934992_-	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	1.4e-27	47.7
WP_010946576.1\|935005_935968_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.2e-38	34.1
WP_010946577.1\|936334_937132_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.3e-21	33.8

DBSCAN-SWA_3

1312292 : 1318229

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027224128.1\|1312292_1313366_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.6e-30	28.6
WP_027224127.1\|1313350_1313965_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.3e-21	38.4
WP_027224126.1\|1313961_1315170_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.5e-98	48.5
WP_010946914.1\|1315177_1315645_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	9.2e-23	49.1
WP_027224125.1\|1315770_1317408_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.7e-154	52.5
WP_010946916.1\|1317404_1318229_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.8e-53	43.9

DBSCAN-SWA_4

2234406 : 2244534

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027224474.1\|2234406_2236095_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.1e-16	30.4
WP_027224473.1\|2236226_2237234_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011214268.1\|2237357_2238683_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.8e-47	31.2
WP_027224472.1\|2238701_2239850_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.2e-127	58.7
WP_027224471.1\|2240063_2241176_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	3.8e-51	35.2
WP_010947740.1\|2241271_2242411_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.6e-23	26.9
WP_011946925.1\|2242599_2244534_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	1.3e-147	49.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LT906476

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection