CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LT906454	Streptococcus acidominimus strain NCTC11291 chromosome 1	2 crisprs	DEDDh,RT,WYL,cas3,csm6,csa3,DinG	0	1	22	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LT906454_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT906454_1

840703-840791

Orphan

Consensus_repeat	Method
CGCTAAAAATGAGAAGCGAGCGTCGTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LT906454_1

>merge|NZ_LT906454|1|840703-840791|CRISPRCasFinder
CGCTAAAAATGAGAAGCGAGCGTCGTGACTGTTTTCTGATGATAGACTGTTTTAGATGTTCCGCTAAAAATGAGAAACGAGCGTCGTGA

>NZ_LT906454|1|1|840703-840791|CRISPRCasFinder
CGCTAAAAATGAGAAGCGAGCGTCGTGA	CTGTTTTCTGATGATAGACTGTTTTAGATGTTC
CGCTAAAAATGAGAAACGAGCGTCGTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT906454.1\|WP_095122211.1\|841190_841529_+\|metal-sulfur-cluster-assembly-factor	unknown	unknown	gnl\|CDD\|225062
NZ_LT906454.1\|WP_095122236.1\|846257_847187_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133039
NZ_LT906454.1\|WP_095123697.1\|851110_852343_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_LT906454.1\|WP_095122201.1\|831294_831852_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|212030
NZ_LT906454.1\|WP_095122217.1\|842534_843386_+\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NZ_LT906454.1\|WP_017770193.1\|834649_836482_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NZ_LT906454.1\|WP_017770187.1\|831054_831249_-\|ferredoxin	unknown	unknown	gnl\|CDD\|224064
NZ_LT906454.1\|WP_017769891.1\|848004_849216_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224057
NZ_LT906454.1\|WP_017770192.1\|833537_833897_+\|50S-ribosomal-protein-L20	unknown	unknown	gnl\|CDD\|179959
NZ_LT906454.1\|WP_095122242.1\|849233_851102_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377447
NZ_LT906454.1\|WP_017770190.1\|832715_833246_+\|translation-initiation-factor-IF-3	unknown	unknown	gnl\|CDD\|234582
NZ_LT906454.1\|WP_017770196.1\|839561_840674_+\|RNA-polymerase-sigma-factor-RpoD	unknown	unknown	gnl\|CDD\|236413
NZ_LT906454.1\|WP_095122213.1\|841542_842469_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_LT906454.1\|WP_095122229.1\|845116_846268_+\|DUF1972-domain-containing-protein	unknown	unknown	gnl\|CDD\|340858
NZ_LT906454.1\|WP_095122207.1\|837261_837633_-\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|376605
NZ_LT906454.1\|WP_017770191.1\|833281_833482_+\|50S-ribosomal-protein-L35	unknown	unknown	gnl\|CDD\|234676
NZ_LT906454.1\|WP_017769890.1\|847198_848005_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NZ_LT906454.1\|WP_095122209.1\|837756_839553_+\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
NZ_LT906454.1\|WP_095122222.1\|843599_844892_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NZ_LT906454.1\|WP_095122204.1\|831872_832553_+\|(d)CMP-kinase	unknown	unknown	gnl\|CDD\|234579

Protein	Function_ID	Function_description	E-value
NZ_LT906454.1\|WP_095122211.1\|841190_841529_+\|metal-sulfur-cluster-assembly-factor	gnl\|CDD\|225062	COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only].	8.72946e-40
NZ_LT906454.1\|WP_095122236.1\|846257_847187_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133039	cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.54616e-89
NZ_LT906454.1\|WP_095123697.1\|851110_852343_+\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	3.9933e-11
NZ_LT906454.1\|WP_095122201.1\|831294_831852_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|212030	cd00118, LysM, Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.	5.908e-05
NZ_LT906454.1\|WP_095122217.1\|842534_843386_+\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	2.08453e-132
NZ_LT906454.1\|WP_017770193.1\|834649_836482_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NZ_LT906454.1\|WP_017770187.1\|831054_831249_-\|ferredoxin	gnl\|CDD\|224064	COG1141, Fer, Ferredoxin [Energy production and conversion].	2.351e-16
NZ_LT906454.1\|WP_017769891.1\|848004_849216_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224057	COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	3.23198e-122
NZ_LT906454.1\|WP_017770192.1\|833537_833897_+\|50S-ribosomal-protein-L20	gnl\|CDD\|179959	PRK05185, rplT, 50S ribosomal protein L20; Provisional.	4.07723e-67
NZ_LT906454.1\|WP_095122242.1\|849233_851102_+\|hypothetical-protein	gnl\|CDD\|377447	pfam05045, RgpF, Rhamnan synthesis protein F. This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors.	2.65554e-102
NZ_LT906454.1\|WP_017770190.1\|832715_833246_+\|translation-initiation-factor-IF-3	gnl\|CDD\|234582	PRK00028, infC, translation initiation factor IF-3; Reviewed.	5.87584e-87
NZ_LT906454.1\|WP_017770196.1\|839561_840674_+\|RNA-polymerase-sigma-factor-RpoD	gnl\|CDD\|236413	PRK09210, PRK09210, RNA polymerase sigma factor RpoD; Validated.	0
NZ_LT906454.1\|WP_095122213.1\|841542_842469_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	1.69439e-85
NZ_LT906454.1\|WP_095122229.1\|845116_846268_+\|DUF1972-domain-containing-protein	gnl\|CDD\|340858	cd04955, GT4-like, glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in certain bacteria and Archaea.	0
NZ_LT906454.1\|WP_095122207.1\|837261_837633_-\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|376605	pfam01741, MscL, Large-conductance mechanosensitive channel, MscL.	1.10651e-40
NZ_LT906454.1\|WP_017770191.1\|833281_833482_+\|50S-ribosomal-protein-L35	gnl\|CDD\|234676	PRK00172, rpmI, 50S ribosomal protein L35; Reviewed.	6.45491e-18
NZ_LT906454.1\|WP_017769890.1\|847198_848005_+\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	9.6551e-50
NZ_LT906454.1\|WP_095122209.1\|837756_839553_+\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
NZ_LT906454.1\|WP_095122222.1\|843599_844892_-\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.20142e-31
NZ_LT906454.1\|WP_095122204.1\|831872_832553_+\|(d)CMP-kinase	gnl\|CDD\|234579	PRK00023, cmk, (d)CMP kinase.	1.37001e-123

>NZ_LT906454.1|WP_017770196.1|839561_840674_+|RNA-polymerase-sigma-factor-RpoD
MAEKTKETTTFNVQVADFIRNHKQAGTAIDNEVTEKLVIPFSLDAEQIDDLLERLTDGGISITDKDGNPSTKYVVEAPKPEELTDEELLGSNSAKVNDPVRMYLKEIGVVPLLTNEEEKALAIAVENGDLQAKQRLAEANLRLVVSIAKRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDEVIENPVDYTTRVVLREQLDDVLDTLTDREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFMED
>NZ_LT906454.1|WP_095122209.1|837756_839553_+|DNA-primase
MDFCGGDGVILDKQSIAQIKQETNIVDIIGEVVALSKTGHHYIGLCPFHKEKTPSFNVIEDKQFYHCFGCGKSGDVFKFLEDYRHISFKESATILAQRLGMVIEVRTDHSAPSHHPNDKLFQINADATKFFQAVLMTTKLGESARGYLYSRGLTDDLIRHFQIGLAPDEPDYLYRALAKKYDEDTILQSGLFNLSEETNRVYDAFQNRIMFALTNDQGKVIGFSGRIWTDEDQKSHQAKYKNTRATIIFNKSQELYHLDKAKAVIAKKREVYLMEGFMDVIAAYQAGVVNAVASMGTALTPEHVKHLSRYTKKVILTYDGDSAGQQAIAKSLELLSAFSVDVVKLPQDMDPGDYLTATSAEELEHLLEKSRISQVEFWINYLLPDNSDNLQNQIAYVEHIADIIAKEPSITAQNTYINKVADLLPDFDYQQVEQSVNAARLSSRQATSKQVAEPIYLDIPVAKQISALTKTENHLFHRMLFHPVILNDFRLRDDFHFVTKELDILFQLLVQHGEISAYKLSNQSEEVQQAYYSVLEEQLPEDIGDNEIRDLERHRERLLTQKDIRRQSQLIKDTSNQGDQDSALAALEALIAQKRSIE
>NZ_LT906454.1|WP_095122207.1|837261_837633_-|large-conductance-mechanosensitive-channel-protein-MscL
MIKELKAFLFKGNVLDLAVAVIFGAAFGAIITSLVEDIITPLLLNPVLEAVGAERIAELTWNGVAYGSFLSAVLNFLIVGTLLFFIVKAATKIMPKQEEVIEEVLPTNEEILLTEIRDLLARK
>NZ_LT906454.1|WP_017770193.1|834649_836482_+|elongation-factor-4
MNIEDLKRRQEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNYTAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPVINKIDLPAADPERVRTEVEDVIGLDASDAVLASAKAGIGIEEILEQIVEKVPAPSGDVEAPLQALIFDSVYDAYRGVILQVRVKNGIVKPGDKIQLMSNGKTFDVTEVGIFTPKAVGRDYLATGDVGYIAASIKTVADTRVGDTITLAEKPANEPLSGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEILEVSNPSEFPDPTRIDTIEEPYVKAQIMVPQEYVGAVMELAQRKRGDFETMEYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLSMDDDEKK
>NZ_LT906454.1|WP_017770192.1|833537_833897_+|50S-ribosomal-protein-L20
MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKLWITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDAAAFTALADAAKDKLGK
>NZ_LT906454.1|WP_017770191.1|833281_833482_+|50S-ribosomal-protein-L35
MPKQKTHRASAKRFKRTGSGGLKRFRAFTSHRFHGKTKKQRRHLRKASMVSAGDFKRIKAMLTRLK
>NZ_LT906454.1|WP_017770190.1|832715_833246_+|translation-initiation-factor-IF-3
MKIIAKKDLFINDEIRVREVRLVGLEGEQLGIKPLSEAQAIADQANVDLVLIQPQATPPVAKIMDYGKFKFEYQKKQKEQRKKQSVVTVKEVRLSPVIDKGDFETKLRNGRKFLEKGNKVKVSIRFKGRMITHKEIGAKVLANFAEATQDIAIIEQRAKMDGRQMFMQLAPIPDKK
>NZ_LT906454.1|WP_095122204.1|831872_832553_+|(d)CMP-kinase
MKAIQIAIDGPASSGKSTVAKIIAHNLGYTYLDTGAMYRSATYLALKHQLDGSRVNAILDLLATHPIAFNKGTEGQQTVLVGGADVTDAIRQPDVTNNVSWVSALPEVREELVAQQQRIASQGGIIMDGRDIGTVVLPDAELKIFLIASVEERAERRFKENQKKGILTDFETLKEEIAARDYKDSHRAVSPLKAAEDAIVFDTTGVSIDGVVEFIQEKAQKIIDKG
>NZ_LT906454.1|WP_095122201.1|831294_831852_+|LysM-peptidoglycan-binding-domain-containing-protein
MAKKPWESKIFDSNKTKGDKTSRADKNGGFLSTPLLTGLLSVFFLIVVGILIFVFYTSNGGSDETQATSGFYQSSTSKAKTSKSSESAAKDEASNLVSETTETTVADETDQSKTSDSVATESSSDTSASSQTAGNGETIVVQAGEGAASIAARAGISVEKLQALNPQHMTLGYWYANPGDQVFVN
>NZ_LT906454.1|WP_017770187.1|831054_831249_-|ferredoxin
MKVSLIPEKCIACGLCQTYSNVFDYHDNGIVKFTDSDNLIAEFRDDDLATLEAVKNCPTKALML
>NZ_LT906454.1|WP_095122211.1|841190_841529_+|metal-sulfur-cluster-assembly-factor
MSEVINYTEEEIANIKERIFEALEEVIDPELGIDIINLGLIYEIHFEQDGQAQIDMTLTTMGCPLADLITDQIYDVLKDVPEVTEAKVRLVWTPAWSVDRLSRYARIALGIR
>NZ_LT906454.1|WP_095122213.1|841542_842469_+|glycosyltransferase-family-2-protein
METLTLVIPCYDEEETILPFLEETQKIEKALASEVLFDYIFVNDGSKDNTLSVLRDVSKRYINVHYLSFSRNFGKEAALLAGLEAATGDYVTVMDADLQDPPELLIDMFAKIREGYDVVGTRRANRQGEPPIRSFFARTFYWLINRISSTEMVDGARDFRLMTRQVVDSILELGEVNRFSKGLFSWVGYDVTYISFENRERVAGETSWSFWSLLKYSMDGFINFSEAPLNLALWAGSGSFIASIFGILFVVIRKLLVDDPVAGWASMVTIMLFIGGIQLLCLGIIGKYIAKIFLETKKRPIYIVKEKG
>NZ_LT906454.1|WP_095122217.1|842534_843386_+|dTDP-4-dehydrorhamnose-reductase
MILITGANGQLGTELRYLLDERNEEYVAVDVAEMDITDEAKVTEVFNQVKPTLVYHCAAYTAVDAAEDEGKELDYAINVTGTENIAKAAAAHQATLVYISTDYVFDGNKPVGEEWLETDKPDPQTEYGRTKRLGEEAVERFAKNFYIIRTAWVFGNYGKNFVFTMQELAKKHPRLTVVNDQHGRPTWTRTLAEFMTYLAENRKEYGYYHLSNDASEDTTWYDFAVEILKDTDVEVAPVDSSAFPAKAKRPFNSTMSLEKAKGTGFVIPNWKDALQEFYKQEKK
>NZ_LT906454.1|WP_095122222.1|843599_844892_-|IS110-family-transposase
MLSKYVGHQTSSIENDITKTRNHSRQRGNIMRVVFGIDVSKASSEVAIVINSEKIHGYSMTNDAIGFSRLLEDLKTVSNPEIVFEATGVYSRRLQVFLENNDYAYTRLNPLEAKKQLDSLRVRKTDQIDAEKLAQSQFVLNRKPTYVQEKVYQELRDLSRFYQNLTEDIVRTKNRLHKVLQVTFPEIEKLLSTPTGEQYWNLVTAFPSKEYVLALDINKLENSVRYSTSKHISDKRVSALAEKLQNLAKQSYGAVKKTSPMLEEVRYYGKELFRLSEQRQTVLDQMVELAQPLPEYDILLSIPGIAETTATSIIGELGDIRRFQSANQINAFIGIDLRHYESGNLLAKEHITKRGNPYARKILFKCIHNMASASHTNPCHIADFYEKRKRQSQTTSTKPHTIASIHRLIRTMYYLITHNKLYDYASTQNQ
>NZ_LT906454.1|WP_095122229.1|845116_846268_+|DUF1972-domain-containing-protein
MRHIFIIGSRGLPAKYGGFETFVEELVTHQISGQIKYHVACLSDEKTGQHFGFKGADCYTVNPPKLGPARVIAYDMMAIHYALSYIKKHQIKQPIFYILGNTIGRFMKPFAKKIKAVDGKLFVNPDGLEWRRAKWSKPVQAYLKQSEKVMTQVADLIIADNEGIESYIKEAYAWSKTRFIAYGTQTRNSSLTNDDALVRSFYDSWHIKEDDYYLIVGRFVPENNYEAMLKEFIASQTKRKLIIICNHEGNPYFDELAKKTAFQSDPRIQFVGTVYDKELLSYIRESAHAYLHGHEVGGTNPGLLEALAHTDVNLVLDVDFNRKVAQQTALYWAKDEGKLKNLIDSVDIENFRHLGNEAKHHIKSNYTWKKIVGEYEELFLNES
>NZ_LT906454.1|WP_095122236.1|846257_847187_+|glycosyltransferase-family-2-protein
MKVNIVMSTYNGEKYLADQINSIQKQTFKDWHLFIRDDGSSDNTPSIIREIAQKDSRVHFINDGQDENYGVIKSFYHLVKHTSADYYFFSDQDDVWLPEKMEVTLKRAQNEASNTPLLVYTDLTVVNENLEVLQESMIKAQSHHANTELVQELTENTVTGGTMMINKALADKWQVYEDLLMHDWYLALLAAAFGKLVYIDKPTQLYRQHDTNVLGARTWAKRAKNWLKPNTLISKYWWLIKSSQNQAKKLLGQEVPESTAQMIDAYAHLMDKNWMNRWRLLNHYKFKKNRHFHTCVFTLLIVTKLGYKR
>NZ_LT906454.1|WP_017769890.1|847198_848005_+|ABC-transporter-permease
MNYFYKKNRILLREMVKTDFKLRYQGSLIGHLWSILKPLLLFTIMYMVFIRFLRIDDGTPHTAIGVLFALVIWNFFAEATNMGMLSIVSRGDLLRKLSFPNEIIVYSSVAGASINFGINLIVVLIFALLNGIPLNLNFLVLIPLFFELVLLASGIALILSSVFVKYRDIGPIWEVVMQAGMYGTPIIYSITYILQRGHNSVAKFLMLNPLAQIVQDIRHVIVYEGNPRGWDIIGNKLIALIPYIIPFIVFVIGLIVFKKNAKRFAEIL
>NZ_LT906454.1|WP_017769891.1|848004_849216_+|ABC-transporter-ATP-binding-protein
MTKNIAVKVEHVSKYFKLPTESTQSLRTALVNRFKGIKGYKEQHVLKDINFEVEEGDFFGIVGRNGSGKSTLLKIISQIYVPEKGKVTVNGKLVSFIELGVGFNPELTGRENVYMNGAMLGFTPEEIDAMYDDIVDFAELHEFMNQKLKNYSSGMQVRLAFSVAIKAQGDVLILDEVLAVGDEAFQRKCNDYFLERKKSGKTTILVTHDMSAVKKYCNKAVLIENGLVKAYGEPFDVAGQYQLDNTKSNPVKEETAETETNEIVNHRIKDFKAELLVNKVYQPSETIQFKITYNQLVKDDTYLAFTFFDLDTGTPLYNDNSMYIFTSGKGVKEFSYECRLDYFNSIKLRMVVVVKNRDSEILSVTPIEESPIVSIVRMVDQNDLSEVDSADAILKRQGVFKEL
>NZ_LT906454.1|WP_095122242.1|849233_851102_+|hypothetical-protein
MRRLLIYVHYNKYSGFSDYVDYQLEKVAPLFEKVIFVSNSSLEQPVQDYLIHKFHFSELLIRENIGYDFAAWRDGLQILDESELYYFDSITLMNDTCFGPLWNLEVHYNYFEQEPKTDFWGMTNHAEVVTDAVVIPEHLQSYFMVFHKNVVQSGIFLEFFKHVADFKDVQKVIDQYETQLTSILKSAGFQYGVLLDTLSLPNNNQLNFSLYHPKLLLDHRVPFLKVKLFELHQYISPYILSDLRKSSEYPTDFITEHVSRVYYPDSIYKLSQKKLTNKYDAEAELMDHDMKVAYHIHITDIWAFDIILEKLTSLKTTFNLFVTVDSVELETIIKEKLKQFKSPSEIILLVANTFSLQPLYLIGEKLMHYECVGFLNTHVLTTDDFYSGKSWFLELVEMMISKTDSIIATLTNEKNTGLVIPDIPTAFRYNRLVDADMENELVSEMTKIWEQIGAKKEIEFSTFETFVMSYGGALWLKRKVLEEMLKVPMSQLIVKDYTLKNKMTSVLERLPVYLAWNLDLDFKISENPVLLPALIDHKLLNRRKEYQEVIVTKEVQVEVVKEIEVEVVKEVEKTIYPDFYIDMTDLSLSTGLKYLIIAPLRVFKFIMKWNILKMKDKIKDKK
>NZ_LT906454.1|WP_095123697.1|851110_852343_+|glycosyltransferase
MITRAIRSYQQEGTTATIRKIKAYFSNNSQETQQVIHKINMDQLPQMPQFEDLSKADYLNNPYEKPAKLSKNKLNIAWVSPPVGPGGGGHTTISRFVKYLQKQGHHITFYIYHNNTIPQSSKEAQEIFSRSYGIDVDVEDLQDFSNQDMVFATSWETAYAVFNLQSDNLHKFYFVQDFEPIFFGVGSRYMLAEATYKFGFYGITAGKWLTEKVSQYGMEADYFDFGADIDIYKPKTPIIKKKKIAFYARAHTERRGFELGVIALKIFKERNPEYEIEFFGQDMSNYDIPFEFTDRGILNKSELAKVYHESVACLVLSLTNVSLLPLELLVAGCVPVMNDGDNNRMVLGEIDDILYTEAYPVSLAEKLCQTVERSDINEHAQAMCEKYTGLSWDESYKKVETIIRREVLND

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LT906454_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT906454_2

920516-920609

Orphan

Consensus_repeat	Method
AACACCAAGTTCAGTGGTTGAAACACCAAGTTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LT906454_2

>merge|NZ_LT906454|2|920516-920609|CRISPRCasFinder
AACACCAAGTTCAGTGGTTGAAACACCAAGTTCAGCTATGACTGATACAAGCGCATCAACAACACCAAGTTCAGTGGTTGAAACACCAAGTTCA

>NZ_LT906454|2|2|920516-920609|CRISPRCasFinder
AACACCAAGTTCAGTGGTTGAAACACCAAGTTCA	GCTATGACTGATACAAGCGCATCAAC
AACACCAAGTTCAGTGGTTGAAACACCAAGTTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT906454.1\|WP_095122328.1\|911293_912211_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_LT906454.1\|WP_017769519.1\|915397_916615_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|349914
NZ_LT906454.1\|WP_095122323.1\|907228_907924_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100078
NZ_LT906454.1\|WP_095122349.1\|930371_931724_+\|PTS-cellobiose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|181976
NZ_LT906454.1\|WP_017769054.1\|929831_930338_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906454.1\|WP_095122351.1\|931795_932890_+\|DUF871-domain-containing-protein	unknown	unknown	gnl\|CDD\|377567
NZ_LT906454.1\|WP_095122347.1\|929492_929813_+\|PTS-cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|181975
NZ_LT906454.1\|WP_172843144.1\|932960_933983_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_LT906454.1\|WP_095122321.1\|905605_907042_+\|glycoside-hydrolase-family-1-protein	unknown	unknown	gnl\|CDD\|225343
NZ_LT906454.1\|WP_095122326.1\|908998_909280_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT906454.1\|WP_095122345.1\|927502_929491_+\|BglG-family-transcription-antiterminator	unknown	unknown	gnl\|CDD\|226234
NZ_LT906454.1\|WP_095122333.1\|914119_915349_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NZ_LT906454.1\|WP_095123701.1\|918181_918700_+\|ClbS/DfsB-family-four-helix-bundle-protein	unknown	unknown	gnl\|CDD\|226733
NZ_LT906454.1\|WP_095122360.1\|935170_935779_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_LT906454.1\|WP_095122336.1\|916664_917921_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|181713
NZ_LT906454.1\|WP_095122339.1\|918950_919979_+\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|379231
NZ_LT906454.1\|WP_095122356.1\|934125_934602_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379155
NZ_LT906454.1\|WP_095122358.1\|934558_935161_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_LT906454.1\|WP_095122343.1\|927144_927459_+\|PTS-cellobiose-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|181974
NZ_LT906454.1\|WP_095122330.1\|912534_913908_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340879

Protein	Function_ID	Function_description	E-value
NZ_LT906454.1\|WP_095122328.1\|911293_912211_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	5.15849e-39
NZ_LT906454.1\|WP_017769519.1\|915397_916615_+\|amidohydrolase	gnl\|CDD\|349914	cd05664, M20_Acy1-like, M20 Peptidase aminoacylase 1 subfamily. Peptidase M20 family, Uncharacterized subfamily of proteins predicted as putative amidohydrolases or hippurate hydrolases. These are a class of zinc binding homodimeric enzymes involved in the hydrolysis of N-acetylated proteins. N-terminal acetylation of proteins is a widespread and highly conserved process that is involved in the protection and stability of proteins. Several types of aminoacylases can be distinguished on the basis of substrate specificity. Aminoacylase 1 (ACY1) breaks down cytosolic aliphatic N-acyl-alpha-amino acids (except L-aspartate), especially N-acetyl-methionine and acetyl-glutamate into L-amino acids and an acyl group. However, ACY1 can also catalyze the reverse reaction, the synthesis of acetylated amino acids. ACY1 may also play a role in xenobiotic bioactivation as well as in the inter-organ processing of amino acid-conjugated xenobiotic derivatives (S-substituted-N-acetyl-L-cysteine).	0
NZ_LT906454.1\|WP_095122323.1\|907228_907924_+\|hypothetical-protein	gnl\|CDD\|100078	cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-binding proteins (SREBPs) from membranes of the ER. These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD superfamily. Prokaryotic S2P/M50 homologs have been shown to regulate stress responses, sporulation, cell division, and cell differentiation. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses, and in Bacillus subtilis, the S2P homolog SpoIVFB is involved in the pro-sigmaK pathway of spore formation. Some of the subfamilies within this hierarchy contain one or two PDZ domain insertions, with putative regulatory roles, such as the inhibition of substrate cleavage as seen by the RseP PDZ domain.	0.000165529
NZ_LT906454.1\|WP_095122349.1\|930371_931724_+\|PTS-cellobiose-transporter-subunit-IIC	gnl\|CDD\|181976	PRK09592, celD, PTS cellobiose transporter subunit IIC.	0
NZ_LT906454.1\|WP_095122351.1\|931795_932890_+\|DUF871-domain-containing-protein	gnl\|CDD\|377567	pfam05913, DUF871, Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.	6.50168e-144
NZ_LT906454.1\|WP_095122347.1\|929492_929813_+\|PTS-cellobiose-transporter-subunit-IIA	gnl\|CDD\|181975	PRK09591, celC, PTS cellobiose transporter subunit IIA.	6.51828e-56
NZ_LT906454.1\|WP_172843144.1\|932960_933983_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	5.13115e-74
NZ_LT906454.1\|WP_095122321.1\|905605_907042_+\|glycoside-hydrolase-family-1-protein	gnl\|CDD\|225343	COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].	0
NZ_LT906454.1\|WP_095122360.1\|935170_935779_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	2.0966e-48
NZ_LT906454.1\|WP_095122333.1\|914119_915349_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	7.95746e-164
NZ_LT906454.1\|WP_095122339.1\|918950_919979_+\|FUSC-family-protein	gnl\|CDD\|379231	pfam13515, FUSC_2, Fusaric acid resistance protein-like.	1.55098e-13
NZ_LT906454.1\|WP_095123701.1\|918181_918700_+\|ClbS/DfsB-family-four-helix-bundle-protein	gnl\|CDD\|226733	COG4283, COG4283, Uncharacterized conserved protein [Function unknown].	9.51107e-77
NZ_LT906454.1\|WP_095122343.1\|927144_927459_+\|PTS-cellobiose-transporter-subunit-IIB	gnl\|CDD\|181974	PRK09590, celB, PTS cellobiose transporter subunit IIB.	1.26636e-59
NZ_LT906454.1\|WP_095122336.1\|916664_917921_+\|amidohydrolase-family-protein	gnl\|CDD\|181713	PRK09230, PRK09230, cytosine deaminase; Provisional.	1.28999e-144
NZ_LT906454.1\|WP_095122356.1\|934125_934602_+\|hypothetical-protein	gnl\|CDD\|379155	pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.	0.00188646
NZ_LT906454.1\|WP_095122358.1\|934558_935161_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	3.88751e-51
NZ_LT906454.1\|WP_095122345.1\|927502_929491_+\|BglG-family-transcription-antiterminator	gnl\|CDD\|226234	COG3711, BglG, Transcriptional antiterminator [Transcription].	9.26939e-51
NZ_LT906454.1\|WP_095122330.1\|912534_913908_+\|MFS-transporter	gnl\|CDD\|340879	cd17321, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.64065e-59

>NZ_LT906454.1|WP_095122339.1|918950_919979_+|FUSC-family-protein
MQNIFRTKEIEDAQLRVITITIIAFIIMLLGYWSDNFKISSFATLGLFTLFYYRNIPMFSLVVRLAIIGLTLLLAFLLGLLSSFLPWTTAIVVAAVAFFSRVLTRLYDISKPGVLFYAMLSAMGGSTTVSVDKLPVLILFFLMGVAFSVVGGIIIKSFDSRPETPLMLKSLKRRFYNDPIVIIDGVFYSGALFISVYLSQGLKLQNPYWVTLACASILLGENLRAIRERHLQYTFGAIAGLILSSLIFYFPFNRLQIVILVTLFYALSQYFVVRNYAVANIFTNPLAILLSMIAKGGQLSSLIQNQLLGILIGGFLGLAVAYIMTVALDHYITLIQEKRDEG
>NZ_LT906454.1|WP_095123701.1|918181_918700_+|ClbS/DfsB-family-four-helix-bundle-protein
MRTYEDKEELKAEIEKTFEKYISEFANIPESLKDKRIAEVDRTPAENLSYQVEWTSLLLKWEGDERKGLQVKTPSDEFKWNQLGELYQWFTDTYAHLSLQELKAKLNENINSIYAMIDSLSEEELFEPHMRKWADEATKTATWEVYKFIHVNTVAPFGTFRTKIRKWKKIVL
>NZ_LT906454.1|WP_095122336.1|916664_917921_+|amidohydrolase-family-protein
MKQKYINANIYGHDKATDFIVENGRFSAIGTDLGHADEIIDVKGKLILPPYVDPHLHLDYYFTGQTDKAENKTGTLFEAIDIWNDFKKGTTKEEMKARMRQAIKDVMSYGTQYIRAQTDCTDPNLTGIKAALELREELKDKVTIQVVAFPQNGMYSYEAEGKTGRDLVEEALQLGADCVGGIPHNEWARSIGEDSIKEIVRLALKYDKYIDVHCDETDDTQARFLELLNAEVLKQNYGARTTASHTCSFGSVNDAYAFRMMGLFKKSGIHFISCPTENAFLQGRQDSYPKRRGLTRVLEFVDQKINVAFAQDSIVDLWYPAGNGNMMNILDNGIHLAQLMRKDDFDKNFDLVTYNGAKLMGLEKEYGLEIGKPANFIVLDAPSVFEAQRNRVECLASIRNGFYLFKKAERSHEIGLDI
>NZ_LT906454.1|WP_017769519.1|915397_916615_+|amidohydrolase
MSIQNILSSIETIKDWQEETYKYLHSHPELSMQETHTAQFIYDTLVSYGYETQKIGGGVVGVLKNGEGKKVLFRADIDALPVKEETGLPYASTVTMKDLDGNLVPVMHACGHDVHIVAGLGAAWAMAQHQTEWTGTYIALFQPGEEIAAGAKSMIEDGLFSKIPKPDLALAQHVLTEPCSGHVGVKEEAFLSSAASVKVTVYGKGAHGSMPHLSIDPVVIASSIVLKLQTIVSREIDPFQFSVVSVGSFQSGLKANIIPDTATLLLNIRTYDEGIQEHIINAIKRIVTAECMAGGCEKDPEVEVYDTYPLTDNDPQISQKVKQAFMTNLGEDRVATHYHAMTASEDFSYIPRALGIPYLYWGFGGFVEGQEVYANHNPKFAPAIHPTLETGTQAALIAVLTYLGK
>NZ_LT906454.1|WP_095122333.1|914119_915349_+|ArgE/DapE-family-deacylase
MDKQTYINMLQDVIQIKSENGNEEAVAKYYQNILKNHGIESKLIPYSEGRSSLVAEITNGEGRVLALSGHMDVVSSGDESQWTHPPFSGDIEDGLIWGRGASDMKSGLTALVIAFINLKESGQFKGTIRLLATVGEEVGELGSAQLTNLGYLDDVDAVLIGEPCNIGVVHAHKGSLNYKVVSRGVAAHSSTPDLGENAIDHLLTAMTMISERITQQAEEIENPVLGKTFHNITLLSGGSQINSIPDQAMFEANVRTIPEYDNAIVMATVEAVLDELNQTKGVDLEAVITANQPPVEAAPDSQLVLTILQVVNSHDSLKPQFLIQQMNDVLGKNMLSEDMASSNLDSVKPMVVSGTTDAAQFVRANANLEVAVYGPGMPSLNHKIDERLPLSQYLDFIEVYQEVIHQYLQ
>NZ_LT906454.1|WP_095122330.1|912534_913908_+|MFS-transporter
MENHMSYKGTNKLLVGIVLAVLSFWLFAQSILNMAPDVQADLGVPSSVMETGISLTALFSGLFIVVAGGLADKLGRVRFTYFGLLLNIVGSFCLIFSSGAILFILGRICQGLAAAFIMPATMSLVKTYYDGKERQRAVSFWSIGSWGGSGLCSFLGGAIASTLGWRYVFVFSILASLMSFICLWGTPESKVETKKSRFDLVGLVLFIVSMLALNIGIASAQERGLFSVVTIGLFLLMLAGLCLFYKVEHSKENAFIDFQLFQNRKYLGATLSNFLLNAVAGTLIVINTYMQLGRGLSAQVAGELSLGYLACILVTIRIGERLLQQFGARKPMVMGTIMTFLGISLMMFVNISGPMYFVMVFLGYAIYGIGLGIYATPSTDAAIATIPNEKVGSASGIYKMASSLGGAIGVAISIALFYAFSGKNHYDIGLLWGLAVNLVFCILAFVSIMFVMPRKNN
>NZ_LT906454.1|WP_095122328.1|911293_912211_-|LysR-family-transcriptional-regulator
METLQKINFLEAIDSYESLTKAAKHLFISQPYLSKVIKQMEDQLDTALIYNHHTGSQLTYAGKRYLYYLKEIYRLENKIKDEMYLIRNQQQGEIFLGINPGLASFFLAEFIPQFQSIHPKIFLKLIENNQNITEKMILLDQIDLAIGMSPLLYQDELSTITIYKEKIYLLVPQQSSLFSTQQAKKINTFHYSYNKLESEPLIITPLEYGLGSLIRSFYKKHHININPILTTSTVPTAINLSLAGMGSTYIPESLIETLPSDSSYNLYKLEDSSLFAEYILIYNKNKSLSLLTLKLLHTIQEKIAK
>NZ_LT906454.1|WP_095122326.1|908998_909280_+|hypothetical-protein
MTLELLYFDLIKSDFTRFEEYYDKAVQSTVKAMVKSTPSASRFLYAYEKFYEQNLESSKKWQDTFEKVCQTYPYAGDTEMERELMELAINNIV
>NZ_LT906454.1|WP_095122323.1|907228_907924_+|hypothetical-protein
MKKKIITIIQSIIYLLPFMYIGIYIGSKAGDLSPLYFILFLGISILLLFVTIIIHEAGHLLFGLWSGYQFSSFRVANLMWYKVGDKVKLTRFSIPGTGGQCIMLPPMEKETIPYFWYNAGGGILNVLVAGISWLVGVIWSDFTFYTNIFAMFNALIGIANLIPMNGLVPNDGYNIFALYRSPKARKAFALGLWITGEQLLGTRIKDIDDSYFMELSEEDYLLVVLVHFKIQ
>NZ_LT906454.1|WP_095122321.1|905605_907042_+|glycoside-hydrolase-family-1-protein
MTYTFPKEFLWGGATAANQFEGAYNLDGKGLSVQDVTPKGGVPAKAGDKNPLITDLPTEDNLKLEGIDFYHRYKEDIALFAEMGFKVFRMSIAWSRIFPNGDETEPNEAGLAFYDKVFDELAKYGIEPLVTLSHYETPLHLAREYNGWANRDLIGFYENYVRTVFTRYKDKVKYWLTFNEVNSVLHAPFMSGGIATPVEDLSKQDLYQAVHHELVASASATKIAHEINPDFKVGCMVIAMPAYGMTSNPLDQLAVHEFENQNYLFSDIHVRGKYPNYIKRFFKENDIEIQFAPGDEELLKHTVDFISFSYYMSVAQAHNPEDYASGKGNILGGITNPYLESSEWGWQIDPVGLRLVLNDFYDRYQLPLFIVENGLGAKDVLVDGPDGPTVEDDYRIDYLQKHLVQVGEALQDGVDLLGYTTWGPIDLVSASTAELSKRYGFIYVDRNDDGTGSLARYKKKSFYWYKEVIATNGESLYS
>NZ_LT906454.1|WP_095122343.1|927144_927459_+|PTS-cellobiose-transporter-subunit-IIB
MTKALIICAGGMSSSLIAKKTQTLLVEQGHDIEMNAVGVPEGGKKINAAEYDLYLISPQTKMHYKQFEEAAKKVGKPIVQIPPQAYIPIPMGIEKMAKLVLDNI
>NZ_LT906454.1|WP_095122345.1|927502_929491_+|BglG-family-transcription-antiterminator
MLNTKEKMILQYLYQHRGDYSTSKVLADYLSYSDRTVRTYIKKLSSDLSVAETGFTIVSKQGFGYQLEIVDDDTYHQFLVENDLAVGLDYGDIENRHKAILNKLIFEEETVLFDDLADQLFVSRSTLSSDFKKIRSQLAKYQLSIESKPYRGVYVLGDEQDKRHFIMDYFFGDQFHQNMTHFVGKDMLSLPLSLEELTIIVLDECRNQGLKLSDYAIQNLVIHLGLAIQRFQKGFRIAPIDLDTEKYSKELSVAQNISKRLSNRLKEIELIPKEETAYIALHLISKSISDEESSQVMANLRQEVVFALEACDLKEGYEFLNDMSLIEGLLTHLEILLERLINNVHLDNPLLDDIKSRYLDIFKLTTEFMSSLPVFQSYMLSEDEMAYVALHFLASIERQKEKNKLNVLVICATGFGSAQMLKNRIINELGQLVTISDVIGYYDLTNDKLKGVDVIMSTIDLSNLVFNIPVQTVSVFLSEQEVLEAKKTFSNLRRKQYHKHIQQNNSSDEDALLSSFDHYFSKEHFMILENADKLDLVSEMIQLLVPDDLHQQKELANLIKGRERLSTLVFDQDIAVPHPLKPIGEKHQIAVAIIKNGLYWEDGFENIRLIFLVVPSIYSNEGLKAITSRIVDLVDLPDVKNKLINVKDFEDFKAIFLDSKRT
>NZ_LT906454.1|WP_095122347.1|929492_929813_+|PTS-cellobiose-transporter-subunit-IIA
MNTEELQMAAFGIILSSGNARTIVHEAFAAMREGDYDKAEQLLEDANADMLEAHHAQTDLLQEYASGTEIKIEIIMVHAQDHLMTTMTLREVALEMLALYRKVDDK
>NZ_LT906454.1|WP_017769054.1|929831_930338_+|hypothetical-protein
MTDKEKAKLESLRQENAIKNMYYTRYFLIRYVVTFFFFINLYWLLMLYLSASFSVMVIPITLIGFSIYAMWEQSRMYTKTQKKAKVTSLLFKVQILTNGLLSILILLGKGNYLFPFFSETTNTQLFLIAMLLLGILLALWMLSKLHRIDKKADKQYRRIENYLATVKS
>NZ_LT906454.1|WP_095122349.1|930371_931724_+|PTS-cellobiose-transporter-subunit-IIC
MNKVFEFLEKYLMGPMSIVSTWRPVRAIVAAGMASIPLTIVGSAFLVLSVIPQAFPLDFIADLWAATFDKFADLYLLAYKCTMGILSLYFAIVIGYEYTKIYAEEDGLEIDPMNGALLSVVAFFLTIPELKVTDGAIKALQVKDATINGWTVGGDSLTRLSTSGMFTAILMSILAVQLYRMCVARKWVIKMPEAVPEGVSRSFTALIPAFVVAFVVLLINGVFILLGTDIYKVIAIPFGFVTNIANTWLGIMVIYLIVHALWLVGIHGANIVMGLVNPILLANMAQNVEGANITYAGEFTNSYVTIGGSGATLGLCLFIAFMAKSEQLSMLGKASIGPALFNINEPLVFGLPIVYNPTLALPFMLAPMVSASIGYWAIKLGFVAKTIIQTPWPTPVGLGAYVGSGGNIPAFLVSLLCAVAAFVVWFPFIKMYDSQLLKEERENAAAISEA
>NZ_LT906454.1|WP_095122351.1|931795_932890_+|DUF871-domain-containing-protein
MSELGVSIYPSKSSFDEMSEYLKLAQSYGYTRVFTSMLEVVENAGETVESFKKIIAFGNQLGMKTSLDVNPKLFKSLDISYNDLSSFVDMGIWSLRLDEGFTGYEEATMSHNPYNLKIELNISRGQHYIDLVNDFGANKRNLIGSHNFYPQSYTGLNLDYFIKTAKQYQSYNLLTAAFVDTDSGKVGPWPVSNLMVSTEVQRQMSIFSQIQLLKLTGVIDDIFISSSLVSEEDLKIVAQAFHQSLPQIPVEVNRDISSIESKILFEEIHQYRGDYSDYMIRSSQPRVKYKLEKIEKGDISDIKCGDVTIGNNFAGQYKGELQVALKDRPNDGSQNIVAKINTDSQILLDFMLPWYNFLLTRVVK
>NZ_LT906454.1|WP_172843144.1|932960_933983_+|IS30-family-transposase
MPNTHSTRNSSYSHLSATERGEIAAYLKMRKKPIEIARLLGRHRSTICREIKRGSVNQVQDKNGKRTYYSAYFADSGQRVYETNRQKCSYLKLNDCSARFIEQLGDALKANIRLHSVDSFVQTYKASHPEEVVPSTKTIYRYIKEGLLAIKPIDLPKMVSIRKRSKKVTKTNRKTLGKSIEERPECINDRSEFGHWEIDLVLGKKTKGEAVVLTLVERQTRYALGVKLEDKQSHTINSAVRHLTSLYPIASITADNGSEFSLLSDLEAVDVYFAHPYSSHERGTNENFNGLLREYVPKGVSLNSLTSEELENYITAINERPRRLLQYQSSKFLFGLAQTA
>NZ_LT906454.1|WP_095122356.1|934125_934602_+|hypothetical-protein
MEVYGQILEDAPDLARGFIGLAFRISEKDDYFESFYIRPTNGRTEDPIRRNRAIQYFAYPTYTFDYFREKGIMDYEGPADIGLDEWIHLAVELDNNVGRFYVNNDLVFTVEDLIHQPQAGNLGLFVDIGTRAYFKNITILERDSNDKTVFNATWRNAF
>NZ_LT906454.1|WP_095122358.1|934558_935161_+|histidine-phosphatase-family-protein
MTKLYLMRHGETLFNTQKRVQGACDSPLTELGIEQARLAKRYFEENEIHFDKVYASTQERATDTAKLVGDRNQIDQLKGLKEMSFGQFEAQPEMLLPKVREGAISFEDLLVPFGGEDIRQVGKRVHSAIQDVLSQSTDQNILMVSHGAAMWGLMLELAISFPPGVYFSNCAICQFDVVEGSSLKLEKLILPAQDFKVYDF
>NZ_LT906454.1|WP_095122360.1|935170_935779_+|histidine-phosphatase-family-protein
MVKTLFLMRHGQTRFNELKRVQGVFDSPLTALGIEQAQKAGHFFDQEVGKFAAVYASTQERAVDTAEIASGQKEIIRLKGLKEMDFGTFEGQTETLNPPLIPGVGYGDYFVQHGGEDSMAVRERMVTTITEILKQHQDGEKILVVSHGASIAQFYRGVMDNPPQVRMSNCAILKFNVNVDQFCLQFIFNPINQEYLYEAEKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LT906454_2	2.1\|920550\|26\|NZ_LT906454\|CRISPRCasFinder	920550-920575	26	LT599585	Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid	295031-295056	4	0.846

1. spacer 2.1|920550|26|NZ_LT906454|CRISPRCasFinder matches to LT599585 (Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid) position: , mismatch: 4, identity: 0.846

gctatgactgatacaagcgca--tcaac	CRISPR spacer
gctctgactgatacaagcgcaggcca--	Protospacer
*** *****************  .**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12981 : 94864

Streptococcus_phage(19.05%)

transposase,tRNA,integrase

attL 26221:26241|attR 91022:91042

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095121201.1\|12981_14253_+\|tRNA	tRNA lysidine(34) synthetase TilS	R4TVK3	Phaeocystis_globosa_virus	7.8e-16	28.2
WP_017769763.1\|14265_14808_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.5e-05	27.9
WP_095121202.1\|14832_16794_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	H8ZJI5	Ostreococcus_tauri_virus	6.7e-107	48.8
WP_095121204.1\|17282_18146_+\|transposase	IS982 family transposase	NA	NA	NA	NA
26221:26241	attL	NA	NA	NA	NA
WP_095121206.1\|27522_28770_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.8e-126	56.1
WP_157737793.1\|29444_29630_-	hypothetical protein	A0A1S5SBP9	Streptococcus_phage	1.5e-08	53.4
WP_095121208.1\|30032_31460_+	CHAP domain-containing protein	NA	NA	NA	NA
WP_017770453.1\|31585_32548_+	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	4.8e-42	36.2
WP_095121210.1\|33641_34817_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_017770760.1\|34806_35562_+	DNA repair protein RecO	NA	NA	NA	NA
WP_095121212.1\|35673_36678_+	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_095121214.1\|36670_36913_+	acyl carrier protein	NA	NA	NA	NA
WP_095121217.1\|37309_38017_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D8KNF0	Synechococcus_phage	1.0e-41	41.3
WP_095121219.1\|38034_41754_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	5.1e-39	26.1
WP_095121224.1\|41767_43219_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.4e-55	33.1
WP_172843134.1\|43282_44302_+	phosphoribosylformylglycinamidine cyclo-ligase	R9TMC7	Synechococcus_phage	6.4e-61	41.9
WP_095121230.1\|44461_45010_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	6.3e-23	35.8
WP_095121233.1\|45257_46805_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	4.8e-76	48.3
WP_095121236.1\|47078_48698_-	SH3 domain-containing protein	M1PKZ3	Streptococcus_phage	2.6e-08	30.3
WP_095121239.1\|48916_50095_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_095121242.1\|50534_51797_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_095121246.1\|51928_52417_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.1e-18	45.7
WP_095121249.1\|52403_53477_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_017770745.1\|53485_53725_+	hypothetical protein	NA	NA	NA	NA
WP_017770743.1\|54572_55865_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	7.2e-17	32.1
WP_095121251.1\|55965_56874_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_095121255.1\|58326_59173_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	9.9e-07	23.3
WP_095121258.1\|59547_59970_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_017770740.1\|59987_60389_+	membrane protein	NA	NA	NA	NA
WP_095121260.1\|60385_62167_+	acyltransferase	A0A1R3Y5Q6	Salmonella_virus	9.0e-18	27.2
WP_017770737.1\|63074_63431_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_017770736.1\|63423_64251_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.9e-11	27.5
WP_017770735.1\|64253_64919_+	hypothetical protein	NA	NA	NA	NA
WP_095121264.1\|65371_67984_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_095121266.1\|68573_69506_+	hypothetical protein	NA	NA	NA	NA
WP_095121270.1\|69702_71199_+	threonine synthase	NA	NA	NA	NA
WP_095121273.1\|71200_71737_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095121275.1\|71848_73318_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.1e-199	73.6
WP_095121277.1\|77735_79085_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_095121280.1\|79352_80624_-	ABC transporter permease	NA	NA	NA	NA
WP_095121283.1\|80782_81289_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_095121287.1\|81333_82164_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_095121291.1\|82187_83639_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_095121295.1\|84033_84897_+	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_095121297.1\|84901_86128_-	MFS transporter	NA	NA	NA	NA
WP_095121299.1\|86295_87084_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_095121302.1\|88323_88530_+	hypothetical protein	NA	NA	NA	NA
WP_095121304.1\|88591_89113_+	hypothetical protein	NA	NA	NA	NA
WP_017769240.1\|89297_89615_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_095121306.1\|89601_89985_+	antitoxin	NA	NA	NA	NA
WP_095121312.1\|90377_90869_+\|integrase	tyrosine-type recombinase/integrase	A0A0M9JJ77	Lactobacillus_phage	4.5e-20	38.0
WP_095121316.1\|91329_92598_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	3.0e-92	46.1
91022:91042	attR	NA	NA	NA	NA
WP_017769609.1\|92590_93085_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017769608.1\|93182_93653_+	DUF3013 family protein	NA	NA	NA	NA
WP_157737894.1\|93898_94864_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

159086 : 166633

Erysipelothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017770601.1\|159086_160850_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	7.7e-30	24.6
WP_017770602.1\|161447_162437_+	lipoate--protein ligase	A0A2H4UVX5	Bodo_saltans_virus	4.1e-12	27.1
WP_095121435.1\|162506_163121_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.5e-12	41.1
WP_095121438.1\|163333_164401_+	purine/pyrimidine permease	H9YQ34	environmental_Halophage	2.2e-11	32.8
WP_095121440.1\|164476_165037_+	cysteine hydrolase	A0A1V0SL12	Klosneuvirus	1.0e-07	28.2
WP_095121444.1\|165313_166633_+	uracil permease	Q9KX94	Enterobacteria_phage	1.7e-61	35.5

DBSCAN-SWA_3

201718 : 267918

Leptospira_phage(28.57%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095121492.1\|201718_202468_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_095121494.1\|202457_203225_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_095121496.1\|203211_203682_+	ECF transporter S component	NA	NA	NA	NA
WP_095121498.1\|203725_204289_+	TIGR01440 family protein	NA	NA	NA	NA
WP_017770646.1\|204445_205654_-	MFS transporter	NA	NA	NA	NA
WP_095121500.1\|205964_206801_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_017770648.1\|206974_208258_+	trigger factor	NA	NA	NA	NA
WP_095121502.1\|208666_209671_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095121504.1\|209876_211067_+	argininosuccinate synthase	NA	NA	NA	NA
WP_095121506.1\|211076_212462_+	argininosuccinate lyase	NA	NA	NA	NA
WP_095121508.1\|212550_212910_+	ribonuclease P protein component	NA	NA	NA	NA
WP_017769876.1\|212893_213697_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_095121510.1\|213711_214824_+	Jag N-terminal domain-containing protein	NA	NA	NA	NA
WP_017769874.1\|215402_215849_+	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_037564142.1\|215864_216260_+	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_000831903.1\|216360_216495_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_095121512.1\|216560_217910_-	MATE family efflux transporter	NA	NA	NA	NA
WP_095121514.1\|218221_219226_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.4e-07	33.1
WP_095121516.1\|219375_220110_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	NA	NA	NA	NA
WP_095121518.1\|220145_221432_+	amino acid permease	NA	NA	NA	NA
WP_095121521.1\|221651_227843_+	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_095121524.1\|228235_229012_+	TatD family hydrolase	NA	NA	NA	NA
WP_172843135.1\|229192_229759_+	ribonuclease M5	NA	NA	NA	NA
WP_095121530.1\|229761_230208_+	HIT family protein	NA	NA	NA	NA
WP_095121532.1\|230226_231117_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_095121535.1\|231745_232240_-	VIT1/CCC1 transporter family protein	NA	NA	NA	NA
WP_017769862.1\|233194_234043_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095121537.1\|234857_235730_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_095121539.1\|235736_236399_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_095121541.1\|236391_237024_+	thiamine diphosphokinase	NA	NA	NA	NA
WP_095121543.1\|237039_238332_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_095121545.1\|238303_239242_+	HD domain-containing protein	NA	NA	NA	NA
WP_017769856.1\|239408_240221_+	pur operon repressor	NA	NA	NA	NA
WP_095121547.1\|240357_243099_+	SEC10/PgrA surface exclusion domain-containing protein	NA	NA	NA	NA
WP_001142328.1\|246710_247124_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_017768901.1\|247144_247615_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_017768900.1\|247843_249922_+	elongation factor G	E4ZFJ7	Streptococcus_phage	6.1e-58	28.6
WP_095121550.1\|249990_250944_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.9e-36	35.5
WP_017768899.1\|251380_252394_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_037563601.1\|252870_253419_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_037563596.1\|253545_254223_+	VIT family protein	NA	NA	NA	NA
WP_095121552.1\|256244_256700_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_095121554.1\|256966_258163_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_095121556.1\|259057_260062_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095121558.1\|260424_261271_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.9e-05	23.7
WP_095121560.1\|261401_262598_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_017769411.1\|262738_263260_+	aromatic acid exporter family protein	NA	NA	NA	NA
WP_095121562.1\|263412_263799_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	1.9e-05	34.1
WP_095121564.1\|263828_265175_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_095121566.1\|265214_265613_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095121568.1\|265528_266376_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	3.2e-05	23.5
WP_095121570.1\|266813_267918_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2

DBSCAN-SWA_4

272462 : 340552

Lactobacillus_phage(15.79%)

holin,transposase,tRNA,integrase

attL 276056:276071|attR 341434:341449

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095121581.1\|272462_273152_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_100244367.1\|273111_273570_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_095121583.1\|273675_274683_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-60	41.5
WP_095121586.1\|274763_275462_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_017770327.1\|275451_275775_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_095121588.1\|275818_276844_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
276056:276071	attL	NA	NA	NA	NA
WP_017770329.1\|276978_277248_-	30S ribosomal protein S14	NA	NA	NA	NA
WP_095121591.1\|277339_278512_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	4.7e-15	53.5
WP_017770331.1\|278646_279189_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_017770332.1\|279236_279824_+	3'-5' exonuclease	A0A0A8WJ41	Clostridium_phage	2.3e-10	27.3
WP_017770333.1\|280813_281113_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_095121594.1\|281479_283141_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095121596.1\|283344_285627_-	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_095121599.1\|285744_286596_+	aquaporin family protein	NA	NA	NA	NA
WP_095121601.1\|287652_288402_+	peptidase	NA	NA	NA	NA
WP_095121603.1\|288407_289343_+	serine hydrolase	NA	NA	NA	NA
WP_172843168.1\|289530_291849_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	4.0e-111	32.4
WP_095121605.1\|292082_293177_+	DNA polymerase IV	NA	NA	NA	NA
WP_095121607.1\|293821_296320_-	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	1.4e-53	28.3
WP_095121609.1\|296402_296996_-	signal peptidase I	NA	NA	NA	NA
WP_095121612.1\|297009_297921_-	ribonuclease HIII	NA	NA	NA	NA
WP_095121614.1\|298179_298968_-	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_017770347.1\|299366_300620_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	5.1e-60	50.2
WP_095121616.1\|300636_301242_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	8.2e-56	55.4
WP_017770349.1\|301423_301783_+	YbaN family protein	NA	NA	NA	NA
WP_095121618.1\|301948_302398_+	dUTP diphosphatase	A5GYP0	Lactococcus_phage	4.7e-32	51.7
WP_095121620.1\|302413_303775_+	DNA repair protein RadA	NA	NA	NA	NA
WP_095123686.1\|303838_304588_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	A0A2D1A6G0	Rhodococcus_phage	1.1e-06	24.1
WP_095121622.1\|304607_305126_+	NYN domain-containing protein	NA	NA	NA	NA
WP_095121623.1\|305201_306062_+	DegV family protein	NA	NA	NA	NA
WP_017769586.1\|306233_306680_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_017769585.1\|306706_307099_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_095121625.1\|307226_308381_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	1.8e-43	30.9
WP_095121627.1\|308450_309017_-	helix-turn-helix domain-containing protein	A0A1S5PRT4	Streptococcus_phage	4.5e-08	50.8
WP_095121629.1\|309333_309612_+	DNA-binding protein	NA	NA	NA	NA
WP_029690773.1\|309617_309947_+	replication initiator protein A	Q9MCM7	Streptococcus_virus	2.1e-05	28.9
WP_095121631.1\|309949_310603_+	hypothetical protein	NA	NA	NA	NA
WP_095121633.1\|310926_311774_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	5.8e-07	23.6
WP_095121635.1\|312724_313159_+	hypothetical protein	NA	NA	NA	NA
WP_095121637.1\|314903_315377_+	hypothetical protein	NA	NA	NA	NA
WP_095121639.1\|315675_316011_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_017769573.1\|316000_316288_-	hypothetical protein	NA	NA	NA	NA
WP_095123687.1\|317033_317282_+	hypothetical protein	NA	NA	NA	NA
WP_095121641.1\|317591_319136_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.0e-107	44.2
WP_172843136.1\|319137_320346_+	restriction endonuclease subunit S	F2Y1N5	Organic_Lake_phycodnavirus	5.5e-11	26.8
WP_172843137.1\|320350_320887_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_095121643.1\|320905_322000_+	AAA family ATPase	NA	NA	NA	NA
WP_095121645.1\|321996_325092_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_095121651.1\|327148_327995_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.5e-07	23.9
WP_017770005.1\|328352_329615_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_095121654.1\|329813_330905_+	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_029690786.1\|331005_331584_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_017770002.1\|331799_333410_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	5.1e-137	45.6
WP_095121656.1\|333567_335328_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.8e-63	29.8
WP_017770000.1\|335324_336053_+	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_017769999.1\|336190_336640_+\|holin	antiholin-like murein hydrolase modulator LrgA	NA	NA	NA	NA
WP_095121658.1\|336658_337366_+\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
WP_095121660.1\|337422_338340_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_095121662.1\|338698_339580_+	fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_095121664.1\|340039_340552_-\|integrase	site-specific integrase	A0A0M9JJ77	Lactobacillus_phage	1.4e-27	39.1
341434:341449	attR	NA	NA	NA	NA

DBSCAN-SWA_5

362990 : 414095

Planktothrix_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095121687.1\|362990_363854_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095121688.1\|364114_366088_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095121690.1\|366153_367653_+	ABC transporter permease	NA	NA	NA	NA
WP_095121692.1\|367652_368579_+	ABC transporter permease	NA	NA	NA	NA
WP_095121694.1\|368587_369637_+	ABC transporter ATP-binding protein	A0A2R8FFL6	Cedratvirus	5.5e-07	24.7
WP_095121696.1\|369651_370581_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.1e-22	34.9
WP_095121698.1\|370888_372550_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017769008.1\|372664_373579_+	ABC transporter permease	NA	NA	NA	NA
WP_095121700.1\|373589_374621_+	ABC transporter permease	NA	NA	NA	NA
WP_017769010.1\|374635_375682_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-19	31.6
WP_017769011.1\|375681_376614_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-23	33.9
WP_095121550.1\|378220_379174_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.8e-42	38.1
WP_017770045.1\|379584_379875_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_095121702.1\|379886_380372_+	single-stranded DNA-binding protein	A0A286QNX2	Streptococcus_phage	1.5e-60	74.7
WP_000068665.1\|380407_380647_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_095121704.1\|382158_383163_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095121706.1\|383854_384526_-	DUF1129 family protein	NA	NA	NA	NA
WP_017768819.1\|384617_385562_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_095121708.1\|385883_388706_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	56.8
WP_017768817.1\|388973_390053_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_095121710.1\|390158_391223_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_095121712.1\|391232_391682_+	competence protein ComE	F8WPT6	Bacillus_phage	6.5e-34	55.1
WP_017768814.1\|391920_392481_+	elongation factor P	NA	NA	NA	NA
WP_017768813.1\|392552_392948_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_029691148.1\|392934_393372_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_095121714.1\|394150_395440_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_095121716.1\|395621_396587_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_095121718.1\|396588_398028_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	8.6e-19	25.8
WP_095121720.1\|398230_400144_+	PTS sugar transporter subunit IIBCA	NA	NA	NA	NA
WP_095121722.1\|400284_401175_+	ROK family protein	NA	NA	NA	NA
WP_172843138.1\|401372_402395_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	7.4e-41	34.5
WP_157737808.1\|402493_403690_-	amidohydrolase	NA	NA	NA	NA
WP_172843139.1\|403679_403934_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_095121730.1\|404031_404334_-	PLP-dependent transferase	NA	NA	NA	NA
WP_157737810.1\|404330_404549_-	PLP-dependent transferase	NA	NA	NA	NA
WP_095121422.1\|404615_405620_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095121736.1\|406423_407170_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_095121738.1\|407243_408107_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095121740.1\|408093_410409_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_095121742.1\|410424_411801_+	glycosyltransferase	NA	NA	NA	NA
WP_172843140.1\|413141_414095_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	7.9e-37	34.8

DBSCAN-SWA_6

482119 : 532459

Bacillus_phage(22.22%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017770834.1\|482119_483034_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_095121830.1\|483054_483594_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_017770836.1\|483823_484513_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.2e-30	32.7
WP_017770837.1\|484493_486005_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	4.2e-24	28.4
WP_017770838.1\|486257_486737_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_095121831.1\|486733_487909_+	DnaD domain protein	NA	NA	NA	NA
WP_017770840.1\|487911_488814_+	primosomal protein DnaI	S5MU12	Brevibacillus_phage	1.9e-24	33.0
WP_095121833.1\|488874_490185_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_095121835.1\|490226_490754_+	hypothetical protein	NA	NA	NA	NA
WP_095121836.1\|491484_494580_+	SNF2 helicase associated domain-containing protein	V9XTV7	Choristoneura_murinana_nucleopolyhedrovirus	1.7e-40	27.6
WP_017770844.1\|494642_495332_+	hypothetical protein	NA	NA	NA	NA
WP_095121838.1\|495342_496674_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_095121839.1\|496860_497358_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095121841.1\|497443_499285_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_017770848.1\|499361_499853_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_095121843.1\|500081_500928_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.3e-06	23.7
WP_095121845.1\|501257_502178_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_017770578.1\|502259_502538_-	acylphosphatase	NA	NA	NA	NA
WP_095121847.1\|502582_503323_+	RNA methyltransferase	NA	NA	NA	NA
WP_017770576.1\|503363_503867_+	HD domain-containing protein	NA	NA	NA	NA
WP_095121849.1\|503884_504574_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_095121851.1\|504727_505042_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_037564552.1\|505144_505678_-	DUF402 domain-containing protein	NA	NA	NA	NA
WP_095121853.1\|505758_506535_-	recombination regulator RecX	NA	NA	NA	NA
WP_095121855.1\|506537_507353_-	phosphotransferase	NA	NA	NA	NA
WP_095121857.1\|507377_508346_+	hypothetical protein	NA	NA	NA	NA
WP_095121860.1\|508342_509698_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.2e-75	33.3
WP_095121550.1\|510043_510997_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.9e-36	35.5
WP_172843170.1\|518114_519233_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_157737814.1\|519644_519878_+	hypothetical protein	NA	NA	NA	NA
WP_157737816.1\|519980_520127_+	hypothetical protein	NA	NA	NA	NA
WP_095121864.1\|520348_522004_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_017770565.1\|522014_522338_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_017770564.1\|522447_522708_+	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_095121570.1\|525856_526962_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_095121552.1\|527432_527888_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_095121554.1\|528154_529351_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_095121556.1\|530245_531250_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095121558.1\|531612_532459_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.9e-05	23.7

DBSCAN-SWA_7

595311 : 688506

Streptococcus_phage(78.57%)

tail,capsid,terminase,transposase,holin,protease,head,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017769109.1\|595311_595902_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	3.7e-53	54.1
WP_017769816.1\|596223_596484_+	DUF2129 domain-containing protein	NA	NA	NA	NA
WP_095121951.1\|596678_597683_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095121953.1\|598255_599431_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017769814.1\|599779_600649_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_095121955.1\|600653_601607_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_017769812.1\|601606_602371_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.0e-16	26.5
WP_095121957.1\|602370_603081_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.4e-16	26.6
WP_017769810.1\|603289_603949_+	CBS domain-containing protein	M1NSC5	Streptococcus_phage	7.3e-74	63.9
WP_095121959.1\|604016_604664_+	dTMP kinase	M1PSC7	Streptococcus_phage	9.0e-69	61.1
WP_095121961.1\|604656_605556_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	5.6e-61	45.3
WP_017769807.1\|605666_605993_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.5e-27	59.6
WP_095121963.1\|605995_606862_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.7e-113	71.1
WP_095121965.1\|608294_608636_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_095121967.1\|608924_609560_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_017769553.1\|609748_610840_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	3.3e-156	73.5
WP_095121969.1\|610840_611389_+	GNAT family N-acetyltransferase	M1PSC3	Streptococcus_phage	1.9e-56	57.2
WP_017769555.1\|611419_612604_+	3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	3.0e-171	76.1
WP_095121971.1\|612662_612845_+	hypothetical protein	NA	NA	NA	NA
WP_017769557.1\|613117_614026_-	diacylglycerol kinase family lipid kinase	NA	NA	NA	NA
WP_017769558.1\|614114_614654_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_095121973.1\|614643_615147_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	4.5e-15	32.3
WP_172843141.1\|615124_616207_+	PDZ domain-containing protein	NA	NA	NA	NA
WP_095121975.1\|617776_618936_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.5e-18	26.8
WP_029751348.1\|620386_621637_-	YSIRK-targeted surface antigen transcriptional regulator	NA	NA	NA	NA
WP_000391860.1\|627718_627904_-	hypothetical protein	NA	NA	NA	NA
WP_000154548.1\|627957_628308_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_000165733.1\|628297_628480_-	hypothetical protein	NA	NA	NA	NA
WP_001212841.1\|628567_628777_-	helix-turn-helix domain-containing protein	A0A2K5B263	Erysipelothrix_phage	2.6e-17	63.1
WP_000904400.1\|628766_630425_-	DUF2326 domain-containing protein	NA	NA	NA	NA
WP_001176804.1\|630415_630640_-	hypothetical protein	NA	NA	NA	NA
WP_000347293.1\|630639_631758_-	hypothetical protein	NA	NA	NA	NA
WP_000182249.1\|632190_632787_+	hypothetical protein	M1Q222	Streptococcus_phage	2.2e-13	29.4
WP_000242734.1\|633062_633491_+	hypothetical protein	NA	NA	NA	NA
WP_001121831.1\|633549_635505_-	DNA polymerase	E4ZFK1	Streptococcus_phage	0.0e+00	86.0
WP_000158580.1\|635553_635721_-	hypothetical protein	E4ZFK2	Streptococcus_phage	1.8e-05	49.0
WP_000105207.1\|635740_636304_-	DUF2815 family protein	A0A1B0RXA9	Streptococcus_phage	1.6e-90	92.3
WP_095121979.1\|636308_637430_-	DUF2800 domain-containing protein	M1Q218	Streptococcus_phage	9.4e-199	89.5
WP_095121981.1\|637701_638806_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_001160925.1\|639326_641615_+	hypothetical protein	A0A1B0RXC5	Streptococcus_phage	0.0e+00	87.1
WP_095121983.1\|641895_642177_+	VRR-NUC domain-containing protein	M1PFY8	Streptococcus_phage	1.4e-37	79.6
WP_095121985.1\|642157_643534_+	DEAD/DEAH box helicase	M1Q214	Streptococcus_phage	8.5e-250	95.0
WP_000356273.1\|643526_644003_+	hypothetical protein	A0A1B0RXB9	Streptococcus_phage	1.2e-81	96.8
WP_000166944.1\|644186_644369_+	hypothetical protein	A0A1B0RXC3	Streptococcus_phage	3.8e-25	96.7
WP_000578147.1\|644417_645455_+	methionine adenosyltransferase	E4ZFL0	Streptococcus_phage	3.6e-168	83.8
WP_001138024.1\|645456_645822_+	HNH endonuclease	A0A1B0RXJ3	Streptococcus_phage	2.4e-63	89.3
WP_095121987.1\|646119_646581_+	hypothetical protein	M1Q209	Streptococcus_phage	9.9e-86	96.7
WP_095121989.1\|646552_647812_+	DNA modification methylase	E4ZFL4	Streptococcus_phage	2.9e-236	96.9
WP_024409992.1\|647908_648157_+	hypothetical protein	D0R0C7	Streptococcus_phage	7.5e-40	98.8
WP_095121991.1\|648158_648371_+	DUF4314 domain-containing protein	A0A1X9I6A3	Streptococcus_phage	4.4e-33	97.1
WP_095121995.1\|648654_649128_+\|terminase	phage terminase small subunit P27 family	A0A1X9I6K0	Streptococcus_phage	1.0e-85	98.7
WP_095121997.1\|649124_650717_+\|terminase	terminase large subunit	E4ZFM0	Streptococcus_phage	0.0e+00	98.5
WP_157737820.1\|650770_651511_+	serine/threonine protein kinase	A0A2I2L395	Orpheovirus	5.8e-11	27.6
WP_095122001.1\|651476_652019_+	hypothetical protein	NA	NA	NA	NA
WP_095122006.1\|652067_652914_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	9.9e-07	23.7
WP_095122008.1\|652976_654260_+\|portal	phage portal protein	A0A1B0RXD8	Streptococcus_phage	1.0e-244	97.9
WP_095122011.1\|654252_654948_+\|protease	Clp protease ClpP	A0A1B0RXJ9	Streptococcus_phage	1.9e-125	98.7
WP_095122012.1\|654966_656172_+\|capsid	phage major capsid protein	E4ZFM5	Streptococcus_phage	3.2e-229	99.5
WP_095122013.1\|656174_656432_+\|head,tail	phage gp6-like head-tail connector protein	A0A1X9I695	Streptococcus_phage	2.5e-38	96.5
WP_095122015.1\|656431_656770_+\|head,tail	head-tail adaptor protein	A0A1X9I694	Streptococcus_phage	1.2e-56	96.4
WP_095122017.1\|656762_657131_+	hypothetical protein	A0A1B0RXJ7	Streptococcus_phage	1.4e-45	94.3
WP_095122019.1\|657137_657464_+	hypothetical protein	A0A1X9I6J7	Streptococcus_phage	1.3e-55	97.2
WP_024416034.1\|657465_658035_+\|tail	phage tail protein	E4ZFM9	Streptococcus_phage	1.7e-103	98.9
WP_095122021.1\|658046_658466_+	hypothetical protein	D0R0E2	Streptococcus_phage	1.5e-69	97.1
WP_095122023.1\|658648_661507_+\|tail	phage tail tape measure protein	A0A1X9I6B4	Streptococcus_phage	2.2e-252	92.8
WP_095122025.1\|661503_662226_+\|tail	phage tail protein	E4ZFN2	Streptococcus_phage	4.6e-130	97.9
WP_095122027.1\|662225_666707_+\|tail	phage tail protein	E4ZFN3	Streptococcus_phage	0.0e+00	90.1
WP_002943561.1\|666719_666926_+	hypothetical protein	A0A1X9I679	Streptococcus_phage	8.7e-26	100.0
WP_095122029.1\|666931_667300_+	hypothetical protein	A0A1B0RXK8	Streptococcus_phage	1.0e-64	97.5
WP_024388660.1\|667277_667673_+\|holin	phage holin family protein	A0A1B0RXK5	Streptococcus_phage	5.0e-46	99.2
WP_095122031.1\|667679_669149_+	N-acetylmuramoyl-L-alanine amidase	E4ZFN7	Streptococcus_phage	3.1e-274	97.5
WP_095122033.1\|669314_669716_+	RNA polymerase subunit sigma-70	NA	NA	NA	NA
WP_032510820.1\|669712_669874_+	hypothetical protein	Q6DMS7	Streptococcus_phage	2.9e-08	58.8
WP_095121570.1\|670771_671877_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_095122035.1\|672364_673930_+	recombinase family protein	Q6DMS5	Streptococcus_phage	7.5e-178	60.9
WP_100244354.1\|674089_674872_+	HAD family hydrolase	NA	NA	NA	NA
WP_095122037.1\|674853_675675_+	HAD family phosphatase	NA	NA	NA	NA
WP_095122039.1\|675676_677314_+	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_017769745.1\|677393_678209_-	TIGR03943 family protein	NA	NA	NA	NA
WP_095122041.1\|678205_679111_-	permease	NA	NA	NA	NA
WP_095122043.1\|679119_679308_-	hypothetical protein	NA	NA	NA	NA
WP_095122046.1\|679282_679414_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_017769742.1\|679528_680497_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_017769741.1\|680860_681079_+	AEC family transporter	NA	NA	NA	NA
WP_095122048.1\|681102_681696_+	AEC family transporter	NA	NA	NA	NA
WP_095122050.1\|681914_682910_-	bile acid:sodium symporter family protein	NA	NA	NA	NA
WP_095122052.1\|683339_684386_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_095123691.1\|684643_685948_+	hypothetical protein	NA	NA	NA	NA
WP_095122054.1\|686385_686784_+	response regulator	W8CYM9	Bacillus_phage	4.6e-23	45.7
WP_095121550.1\|687552_688506_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.9e-36	35.5

DBSCAN-SWA_8

717487 : 785724

Leptospira_phage(30.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095122090.1\|717487_718335_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-05	25.5
WP_095122092.1\|718369_719239_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095121843.1\|720250_721098_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.3e-06	23.7
WP_095122094.1\|721759_723133_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_095122095.1\|723470_724517_-	galactose mutarotase	NA	NA	NA	NA
WP_017769542.1\|727329_727584_+	hypothetical protein	NA	NA	NA	NA
WP_157737898.1\|728463_728619_+	hypothetical protein	NA	NA	NA	NA
WP_172843171.1\|728628_729135_+	maturase	NA	NA	NA	NA
WP_157737826.1\|729131_729509_+	hypothetical protein	NA	NA	NA	NA
WP_095121704.1\|729820_730825_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095122099.1\|731669_732854_+	hypothetical protein	NA	NA	NA	NA
WP_095122101.1\|732887_734054_+	amidohydrolase	NA	NA	NA	NA
WP_095122103.1\|734147_735011_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095122105.1\|735120_735968_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	3.7e-06	24.2
WP_017770007.1\|737528_737921_-	VOC family protein	NA	NA	NA	NA
WP_017770008.1\|738089_739625_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_095122107.1\|742301_744236_+	AlwI family type II restriction endonuclease	NA	NA	NA	NA
WP_095122109.1\|744468_745554_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_095122111.1\|745746_746748_+	catabolite control protein A	NA	NA	NA	NA
WP_095122113.1\|746843_748295_+	alpha-amylase	NA	NA	NA	NA
WP_095122115.1\|748367_749366_+	glycosyltransferase	NA	NA	NA	NA
WP_017770015.1\|749367_750720_+	glycosyltransferase family 4 protein	A0A1V0SL50	Klosneuvirus	6.8e-10	25.1
WP_157737828.1\|751527_751689_+	hypothetical protein	NA	NA	NA	NA
WP_095122116.1\|751770_752094_+	MazG-like protein	NA	NA	NA	NA
WP_017770018.1\|752111_754067_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.3e-122	38.9
WP_029691270.1\|754659_755649_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_095122118.1\|755661_756246_+	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_095122120.1\|756238_756613_+	PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM	NA	NA	NA	NA
WP_100244342.1\|756703_757675_+	DUF3114 domain-containing protein	NA	NA	NA	NA
WP_095122122.1\|757697_758384_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.6e-31	32.6
WP_095122124.1\|758373_759822_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.1e-18	27.9
WP_017769336.1\|759912_760509_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_095122126.1\|761040_762114_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_029691261.1\|762194_762800_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.5e-60	56.2
WP_095122127.1\|763302_764397_+	serine hydrolase	NA	NA	NA	NA
WP_017769332.1\|764503_765550_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_095122129.1\|765715_766417_+	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_095122131.1\|766535_767540_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_017769330.1\|768063_769020_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_095122134.1\|769938_770892_+	competence protein CoiA	NA	NA	NA	NA
WP_095122137.1\|770913_772713_+	oligoendopeptidase F	NA	NA	NA	NA
WP_095122139.1\|772724_773147_+	hypothetical protein	NA	NA	NA	NA
WP_095122141.1\|773283_773898_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_095123694.1\|773974_774682_+	O-methyltransferase	NA	NA	NA	NA
WP_095122143.1\|774790_775735_+	peptidylprolyl isomerase PrsA	NA	NA	NA	NA
WP_095123695.1\|776369_778988_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.5e-63	34.4
WP_095122146.1\|779118_780540_+	amino acid permease	NA	NA	NA	NA
WP_095121570.1\|782457_783563_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_095122148.1\|784920_785724_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

810057 : 873343

Streptococcus_phage(35.29%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095122179.1\|810057_811062_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095122181.1\|811441_812233_-	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_095122183.1\|812487_813633_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_095122185.1\|813906_814350_+	flavodoxin	NA	NA	NA	NA
WP_095122188.1\|814446_815664_+	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	1.5e-88	49.6
WP_017770116.1\|815785_816133_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_095122190.1\|818827_819675_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.4e-05	24.5
WP_017770180.1\|820322_821522_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_095122192.1\|821702_823655_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.0e-144	46.1
WP_095122193.1\|823751_825476_+	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_095122195.1\|825502_826021_-	NUDIX hydrolase	NA	NA	NA	NA
WP_095122197.1\|826076_827180_+	glycerate kinase	W6LM47	Streptococcus_phage	1.1e-79	54.1
WP_017770183.1\|827204_827651_-	DUF1694 domain-containing protein	NA	NA	NA	NA
WP_017770184.1\|827796_829098_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	6.2e-234	94.9
WP_095122199.1\|829287_830514_+	peptidase T	NA	NA	NA	NA
WP_017770186.1\|830568_831066_+	EbsA family protein	NA	NA	NA	NA
WP_017770187.1\|831054_831249_-	ferredoxin	NA	NA	NA	NA
WP_095122201.1\|831294_831852_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_095122204.1\|831872_832553_+	(d)CMP kinase	NA	NA	NA	NA
WP_017770190.1\|832715_833246_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	5.4e-11	34.3
WP_017770191.1\|833281_833482_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_017770192.1\|833537_833897_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_017770193.1\|834649_836482_+	elongation factor 4	A0A1B0RXH7	Streptococcus_phage	7.5e-20	24.8
WP_095122207.1\|837261_837633_-	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_095122209.1\|837756_839553_+	DNA primase	A0A1S5RFR1	Helicobacter_phage	2.1e-46	29.4
WP_017770196.1\|839561_840674_+	RNA polymerase sigma factor RpoD	F4YCU2	Synechococcus_phage	9.2e-37	38.2
WP_095122211.1\|841190_841529_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_095122213.1\|841542_842469_+	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	6.2e-79	49.5
WP_095122217.1\|842534_843386_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.0e-27	35.5
WP_095122222.1\|843599_844892_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.2e-194	86.5
WP_095122229.1\|845116_846268_+	DUF1972 domain-containing protein	NA	NA	NA	NA
WP_095122236.1\|846257_847187_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_017769890.1\|847198_848005_+	ABC transporter permease	NA	NA	NA	NA
WP_017769891.1\|848004_849216_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	25.2
WP_095122242.1\|849233_851102_+	hypothetical protein	NA	NA	NA	NA
WP_095123697.1\|851110_852343_+	glycosyltransferase	NA	NA	NA	NA
WP_095122248.1\|852335_853322_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_095122252.1\|853401_855864_+	alkaline phosphatase family protein	NA	NA	NA	NA
WP_017769896.1\|855871_857641_+	hypothetical protein	NA	NA	NA	NA
WP_095122259.1\|857730_858159_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_017769897.1\|858416_858695_+	N-acetyltransferase	NA	NA	NA	NA
WP_095122263.1\|858737_859691_+	amidohydrolase	NA	NA	NA	NA
WP_017769899.1\|859913_861068_+	ABC transporter ATP-binding protein	F2Y165	Organic_Lake_phycodnavirus	4.3e-13	28.4
WP_095123698.1\|861069_861705_+	ABC transporter permease	NA	NA	NA	NA
WP_095122265.1\|861705_862626_+	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017769902.1\|862626_863286_+	ABC transporter permease	NA	NA	NA	NA
WP_095122267.1\|863539_863977_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_029691100.1\|863978_864437_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017769905.1\|864578_864851_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_029691099.1\|864861_865101_+	KH domain-containing protein	NA	NA	NA	NA
WP_095121550.1\|865534_866488_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.9e-36	35.5
WP_095122268.1\|866878_868474_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_095122270.1\|868636_869155_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_095123700.1\|869144_869900_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_095122271.1\|869896_870895_+	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	7.2e-25	50.0
WP_095122273.1\|871383_872445_+	PTS transporter subunit IIC	NA	NA	NA	NA
WP_095122274.1\|872496_873343_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.3e-06	22.9

DBSCAN-SWA_10

881740 : 938221

Leptospira_phage(22.22%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095122103.1\|881740_882604_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095122282.1\|882699_883546_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-05	23.6
WP_095122284.1\|883681_884143_+	hypothetical protein	NA	NA	NA	NA
WP_157737832.1\|884267_884972_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_157737834.1\|885001_885427_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_095122293.1\|885468_886014_-	dihydrofolate reductase family protein	NA	NA	NA	NA
WP_095122296.1\|886129_886651_+	hypothetical protein	NA	NA	NA	NA
WP_017770716.1\|886716_887097_+	DUF1149 family protein	NA	NA	NA	NA
WP_017770715.1\|887096_887945_+	DegV family protein	NA	NA	NA	NA
WP_017770714.1\|888062_888830_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_095122298.1\|888829_890053_+\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	8.3e-31	37.6
WP_095122300.1\|890437_892309_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	6.9e-61	30.6
WP_095122302.1\|892318_893656_+	MATE family efflux transporter	NA	NA	NA	NA
WP_095122304.1\|893689_894250_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095122305.1\|894246_895989_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.6e-35	24.6
WP_095122307.1\|895988_897785_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-60	31.2
WP_095122309.1\|898251_899097_+	PRD domain-containing protein	NA	NA	NA	NA
WP_095121843.1\|899193_900041_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.3e-06	23.7
WP_095122314.1\|901000_902911_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_095122317.1\|903016_903946_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_095122319.1\|905116_905365_+	NINE protein	NA	NA	NA	NA
WP_095122321.1\|905605_907042_+	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_095122323.1\|907228_907924_+	hypothetical protein	NA	NA	NA	NA
WP_095122326.1\|908998_909280_+	hypothetical protein	NA	NA	NA	NA
WP_095122328.1\|911293_912211_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.7e-25	26.7
WP_095122330.1\|912534_913908_+	MFS transporter	NA	NA	NA	NA
WP_095122333.1\|914119_915349_+	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_017769519.1\|915397_916615_+	amidohydrolase	NA	NA	NA	NA
WP_095122336.1\|916664_917921_+	amidohydrolase family protein	NA	NA	NA	NA
WP_095123701.1\|918181_918700_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_095122339.1\|918950_919979_+	FUSC family protein	NA	NA	NA	NA
WP_095122341.1\|920348_926249_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_095122343.1\|927144_927459_+	PTS cellobiose transporter subunit IIB	NA	NA	NA	NA
WP_095122345.1\|927502_929491_+	BglG family transcription antiterminator	NA	NA	NA	NA
WP_095122347.1\|929492_929813_+	PTS cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_017769054.1\|929831_930338_+	hypothetical protein	NA	NA	NA	NA
WP_095122349.1\|930371_931724_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_095122351.1\|931795_932890_+	DUF871 domain-containing protein	NA	NA	NA	NA
WP_172843144.1\|932960_933983_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.4e-39	34.2
WP_095122356.1\|934125_934602_+	hypothetical protein	NA	NA	NA	NA
WP_095122358.1\|934558_935161_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	2.6e-25	36.7
WP_095122360.1\|935170_935779_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_017769882.1\|935899_936625_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_095121704.1\|937216_938221_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

979321 : 1078705

117

Streptococcus_phage(64.0%)

tail,capsid,tRNA,terminase,integrase,transposase,holin,protease,head,portal

attL 988827:988845|attR 1031577:1031595

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157737836.1\|979321_979609_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_095122421.1\|979995_980310_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_095122423.1\|980440_981288_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.3e-06	27.1
WP_095122425.1\|981488_983168_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_095122426.1\|983178_983898_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_095122427.1\|984075_985737_-	fibronectin/fibrinogen-binding protein	A0A1J0F9J4	Only_Syngen_Nebraska_virus	3.0e-07	41.0
WP_017769298.1\|986123_987125_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095122428.1\|987152_988022_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_095122429.1\|988018_988777_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	9.1e-12	30.0
988827:988845	attL	NA	NA	NA	NA
WP_095122430.1\|988872_989967_-\|integrase	site-specific integrase	M1Q1T0	Streptococcus_phage	9.5e-95	47.5
WP_095122431.1\|990084_991032_-	Abi family protein	A0A1S5S8T0	Streptococcus_phage	2.6e-88	53.1
WP_095122435.1\|991220_991937_-	helix-turn-helix transcriptional regulator	E8ZDN4	Streptococcus_phage	9.0e-70	56.7
WP_172843145.1\|992639_992786_+	hypothetical protein	NA	NA	NA	NA
WP_095122437.1\|993059_993275_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_095122438.1\|993294_993903_+	phage repressor protein	A0A2H4JB17	uncultured_Caudovirales_phage	1.2e-43	46.3
WP_172843146.1\|993913_994051_+	hypothetical protein	NA	NA	NA	NA
WP_095122440.1\|994047_994575_-	hypothetical protein	A0A141E0Q2	Streptococcus_phage	2.9e-57	61.5
WP_095122441.1\|994623_994812_+	hypothetical protein	NA	NA	NA	NA
WP_095122443.1\|994928_995204_+	DNA-binding protein	O48392	Streptococcus_phage	4.6e-22	62.0
WP_157737838.1\|995205_995367_+	hypothetical protein	NA	NA	NA	NA
WP_170237059.1\|995366_995540_+	hypothetical protein	NA	NA	NA	NA
WP_095123702.1\|995986_996151_+	CopG family transcriptional regulator	NA	NA	NA	NA
WP_095122445.1\|996426_996594_+	CopG family transcriptional regulator	NA	NA	NA	NA
WP_095122447.1\|996772_997048_+	hypothetical protein	NA	NA	NA	NA
WP_095122449.1\|997025_997412_-	hypothetical protein	NA	NA	NA	NA
WP_095122451.1\|997467_997908_+	hypothetical protein	NA	NA	NA	NA
WP_095122453.1\|997904_998099_+	hypothetical protein	NA	NA	NA	NA
WP_095122455.1\|998101_998323_+	hypothetical protein	NA	NA	NA	NA
WP_095122457.1\|998322_999096_+	DnaD domain protein	A0A0K0MX39	Streptococcus_phage	8.9e-39	58.2
WP_172843172.1\|999138_999951_+	ATP-binding protein	M1PFI4	Streptococcus_phage	9.3e-47	40.3
WP_095122461.1\|999950_1000475_+	hypothetical protein	NA	NA	NA	NA
WP_095122464.1\|1000465_1000690_+	hypothetical protein	NA	NA	NA	NA
WP_095122467.1\|1000667_1000946_+	hypothetical protein	NA	NA	NA	NA
WP_095122469.1\|1000942_1001587_+	ERF family protein	A0A1S5SAM9	Streptococcus_phage	2.8e-38	39.3
WP_095122472.1\|1001588_1002014_+	single-stranded DNA-binding protein	Q938M7	Temperate_phage	1.6e-50	73.0
WP_095123703.1\|1002030_1002213_+	hypothetical protein	A0A2I6QR06	Streptococcus_phage	1.0e-06	50.0
WP_095122474.1\|1002209_1002644_+	RusA family crossover junction endodeoxyribonuclease	A0A141E1Z1	Streptococcus_phage	7.4e-43	64.2
WP_157737840.1\|1002628_1002796_+	hypothetical protein	NA	NA	NA	NA
WP_095122476.1\|1002779_1003097_+	hypothetical protein	NA	NA	NA	NA
WP_095122478.1\|1003096_1003318_+	hypothetical protein	A0A1P8VVZ1	Streptococcus_phage	3.3e-07	44.4
WP_095122480.1\|1003359_1003665_+	hypothetical protein	NA	NA	NA	NA
WP_095122482.1\|1003769_1004114_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SEX8	Streptococcus_phage	1.0e-42	73.5
WP_095122484.1\|1004103_1004319_-	AbrB family transcriptional regulator	Q708N8	Streptococcus_phage	1.7e-24	75.7
WP_095122486.1\|1004388_1004904_+	DUF1642 domain-containing protein	A0A1X9I5P8	Streptococcus_phage	5.6e-21	44.9
WP_157737842.1\|1004906_1005422_+	DUF1642 domain-containing protein	A0A1X9I5P8	Streptococcus_phage	2.7e-15	34.7
WP_157737844.1\|1005458_1005608_+	hypothetical protein	NA	NA	NA	NA
WP_095122490.1\|1005609_1005816_+	hypothetical protein	A0A1X9I653	Streptococcus_phage	1.3e-13	56.7
WP_095122492.1\|1005940_1006129_+	sporulation protein Cse60	NA	NA	NA	NA
WP_095122494.1\|1006125_1006374_+	hypothetical protein	NA	NA	NA	NA
WP_095122496.1\|1006389_1006776_+	HTH domain-containing protein	NA	NA	NA	NA
WP_095122498.1\|1006985_1007402_+	DUF1492 domain-containing protein	A0A0B5A564	Streptococcus_phage	5.1e-25	47.1
WP_095122500.1\|1008614_1008992_-	type II toxin-antitoxin system HicB family antitoxin	I3NLB2	Bifidobacterium_phage	1.2e-17	40.8
WP_095122502.1\|1009038_1009224_-	type II toxin-antitoxin system HicA family toxin	F0PIL1	Enterococcus_phage	2.3e-09	58.1
WP_095122504.1\|1009375_1009711_+	HNH endonuclease	J7KH36	Streptococcus_phage	4.7e-45	75.5
WP_095122506.1\|1010365_1012108_+\|terminase	terminase large subunit	J7KKD1	Streptococcus_phage	4.6e-285	80.2
WP_095122508.1\|1012295_1012841_+	hypothetical protein	NA	NA	NA	NA
WP_095122510.1\|1012905_1014126_+\|portal	phage portal protein	A0A2H4JGQ4	uncultured_Caudovirales_phage	1.4e-179	77.8
WP_037564299.1\|1014115_1014718_+\|protease	Clp protease ClpP	A0A2H4JG44	uncultured_Caudovirales_phage	1.1e-57	54.7
WP_095122512.1\|1014744_1015929_+\|capsid	phage major capsid protein	J7KJ82	Streptococcus_phage	5.2e-131	61.3
WP_095122514.1\|1016067_1016370_+\|head,tail	phage head-tail connector protein	M1NRM0	Streptococcus_phage	8.5e-30	67.7
WP_095122516.1\|1016356_1016707_+\|head,tail	head-tail adaptor protein	M1PFA2	Streptococcus_phage	4.8e-32	56.6
WP_095122518.1\|1016703_1017081_+	HK97 gp10 family phage protein	M1PKN1	Streptococcus_phage	7.2e-34	62.4
WP_095122520.1\|1017077_1017521_+	hypothetical protein	J7KBZ9	Streptococcus_phage	2.1e-53	69.3
WP_095122522.1\|1017522_1018077_+\|tail	phage tail protein	M1PRQ7	Streptococcus_phage	8.8e-81	78.5
WP_095122524.1\|1018136_1018463_+	hypothetical protein	M1NRL6	Streptococcus_phage	3.0e-36	71.3
WP_157737846.1\|1018486_1018660_+	hypothetical protein	J7KBS0	Streptococcus_phage	3.4e-15	77.8
WP_095122526.1\|1018672_1022965_+\|tail	phage tail tape measure protein	J7KDT4	Streptococcus_phage	1.1e-205	46.2
WP_095122528.1\|1022961_1023681_+\|tail	phage tail family protein	Q938K2	Temperate_phage	1.6e-66	48.5
WP_095122530.1\|1023677_1027709_+	hypothetical protein	Q938K1	Temperate_phage	7.7e-142	49.6
WP_157737848.1\|1027730_1027880_+	hypothetical protein	NA	NA	NA	NA
WP_095122532.1\|1027879_1028272_+	DUF1366 domain-containing protein	NA	NA	NA	NA
WP_157737850.1\|1028246_1028420_+	hypothetical protein	A0A097PAU6	Streptococcus_pyogenes_phage	2.3e-11	77.5
WP_095122535.1\|1028430_1028724_+	hypothetical protein	J7KH30	Streptococcus_phage	7.1e-13	37.8
WP_095122538.1\|1028725_1029001_+\|holin	phage holin	A0A0B5A2E7	Streptococcus_phage	9.8e-33	75.8
WP_095122540.1\|1029010_1029730_+	CHAP domain-containing protein	A0A1S5S9Z7	Streptococcus_phage	1.0e-52	66.9
WP_157737852.1\|1029934_1030105_+	hypothetical protein	NA	NA	NA	NA
WP_095122542.1\|1030101_1030680_+	hypothetical protein	NA	NA	NA	NA
WP_172843147.1\|1031052_1031235_+	hypothetical protein	A0A286QNA2	Streptococcus_phage	6.3e-12	67.9
WP_095122546.1\|1031279_1031486_+	Paratox	NA	NA	NA	NA
WP_095122548.1\|1031747_1033409_+	ribonuclease J	NA	NA	NA	NA
1031577:1031595	attR	NA	NA	NA	NA
WP_095122550.1\|1033526_1034309_+	esterase family protein	NA	NA	NA	NA
WP_095122553.1\|1034431_1035160_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_095122555.1\|1035338_1035539_+	hypothetical protein	NA	NA	NA	NA
WP_095123704.1\|1035593_1037522_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.9e-53	29.4
WP_095122558.1\|1037724_1038147_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_095122561.1\|1038143_1039526_+	MATE family efflux transporter	NA	NA	NA	NA
WP_017769288.1\|1039982_1040771_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_095123705.1\|1040770_1042114_-	Mur ligase family protein	NA	NA	NA	NA
WP_017769286.1\|1042212_1043070_+	TIGR00159 family protein	NA	NA	NA	NA
WP_017769285.1\|1043062_1044022_+	hypothetical protein	NA	NA	NA	NA
WP_017769284.1\|1044063_1045413_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_017769283.1\|1045486_1045858_+	DUF1801 domain-containing protein	NA	NA	NA	NA
WP_029690992.1\|1045847_1046576_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_095122563.1\|1046652_1047894_-	aminopeptidase	NA	NA	NA	NA
WP_079268446.1\|1048048_1048180_+	DUF4044 domain-containing protein	NA	NA	NA	NA
WP_029690990.1\|1048336_1049650_+	GTPase ObgE	NA	NA	NA	NA
WP_095122566.1\|1050060_1050408_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095122568.1\|1050407_1050614_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029690989.1\|1050628_1050802_+	hypothetical protein	NA	NA	NA	NA
WP_095122006.1\|1051068_1051916_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	9.9e-07	23.7
WP_095122570.1\|1053468_1055226_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_017770416.1\|1055289_1056795_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	5.3e-11	30.3
WP_095123706.1\|1056981_1057536_+	adenylate kinase	A0A097BYE2	Leuconostoc_phage	7.1e-22	36.7
WP_017770418.1\|1057560_1058301_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-34	40.9
WP_095122572.1\|1058300_1060481_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_172843173.1\|1060944_1061631_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_095122574.1\|1061820_1063812_+	excinuclease ABC subunit B	NA	NA	NA	NA
WP_095122576.1\|1064568_1065405_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_095122578.1\|1065404_1066766_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_095122581.1\|1066941_1068174_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_017770426.1\|1068615_1069644_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_095122583.1\|1070028_1071570_+	4-alpha-glucanotransferase	NA	NA	NA	NA
WP_095122585.1\|1071562_1073830_+	glycogen/starch/alpha-glucan family phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	6.7e-10	43.4
WP_095122587.1\|1073990_1074791_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_095122589.1\|1074802_1075921_+	aminotransferase	NA	NA	NA	NA
WP_017770431.1\|1075999_1076818_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_017770432.1\|1077337_1078705_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA

DBSCAN-SWA_12

1190753 : 1242982

Planktothrix_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095121738.1\|1190753_1191617_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017769401.1\|1193607_1194675_+	ABC transporter permease	NA	NA	NA	NA
WP_095122732.1\|1194687_1195353_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.4e-31	37.6
WP_017769399.1\|1195472_1196027_+	FMN-binding protein	NA	NA	NA	NA
WP_095122734.1\|1196139_1197201_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_172843150.1\|1197169_1198150_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_095122738.1\|1198200_1198656_-	NusG domain II-containing protein	NA	NA	NA	NA
WP_095122740.1\|1198862_1199651_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_095123709.1\|1199647_1200082_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_095121570.1\|1200225_1201330_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_157737854.1\|1201621_1202719_+	hypothetical protein	NA	NA	NA	NA
WP_095122744.1\|1202964_1203969_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095122746.1\|1204192_1205263_+	tyrosine recombinase XerS	A0A1B1IQT7	uncultured_Mediterranean_phage	1.8e-05	29.1
WP_095122748.1\|1206527_1207127_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_095122750.1\|1207166_1207346_-	hypothetical protein	NA	NA	NA	NA
WP_095122752.1\|1207552_1208497_-	sensor histidine kinase	NA	NA	NA	NA
WP_095122754.1\|1208493_1209162_-	response regulator transcription factor	NA	NA	NA	NA
WP_095123710.1\|1209204_1211169_-	ABC transporter permease	NA	NA	NA	NA
WP_017769386.1\|1211155_1211926_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-27	36.5
WP_017769385.1\|1212145_1212637_+	hypothetical protein	NA	NA	NA	NA
WP_172843176.1\|1212839_1214126_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.2e-211	93.0
WP_095122758.1\|1214727_1215732_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_017769462.1\|1216158_1216422_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_017769463.1\|1216418_1216634_-	hypothetical protein	NA	NA	NA	NA
WP_095122760.1\|1217258_1218428_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_095122763.1\|1218449_1219196_-	esterase family protein	NA	NA	NA	NA
WP_095122765.1\|1219217_1220042_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_095122767.1\|1222234_1223578_-\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_017768856.1\|1223909_1226021_-	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	1.3e-100	36.0
WP_095122769.1\|1226148_1226991_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.8e-29	42.0
WP_017768854.1\|1227059_1227611_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_017768853.1\|1227610_1228393_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	1.6e-24	39.5
WP_017768852.1\|1228379_1229231_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_172843151.1\|1230263_1233584_-	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_095122773.1\|1233780_1234170_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_095122775.1\|1234509_1234914_-	DUF1801 domain-containing protein	NA	NA	NA	NA
WP_095122777.1\|1234943_1236485_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.5e-48	28.2
WP_095122779.1\|1236583_1237165_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_017769630.1\|1237391_1238375_-	GMP reductase	Q4ZCY7	Staphylococcus_virus	2.3e-140	74.0
WP_051105464.1\|1239021_1239414_+	hypothetical protein	NA	NA	NA	NA
WP_095122781.1\|1239477_1240314_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017769633.1\|1240329_1240959_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-32	40.2
WP_029690590.1\|1241128_1241770_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_172843152.1\|1241959_1242982_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	9.6e-41	34.5

DBSCAN-SWA_13

1413461 : 1452836

Streptococcus_phage(36.36%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024409351.1\|1413461_1414043_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_024409352.1\|1414045_1414279_-	hypothetical protein	NA	NA	NA	NA
WP_024409353.1\|1414288_1414672_-	arsenate reductase	NA	NA	NA	NA
WP_044769798.1\|1414681_1415110_-	hypothetical protein	NA	NA	NA	NA
WP_029743109.1\|1415093_1416449_-	DNA (cytosine-5-)-methyltransferase	A0A141E1L1	Streptococcus_phage	2.9e-125	55.6
WP_009909851.1\|1416606_1417431_-	replication initiator protein A	A0A286QNA4	Streptococcus_phage	5.8e-12	37.6
WP_044769819.1\|1417427_1417601_-	hypothetical protein	NA	NA	NA	NA
WP_095122950.1\|1417860_1418229_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_017769382.1\|1418303_1418807_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_095121550.1\|1419071_1420025_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.9e-36	35.5
WP_157737902.1\|1420531_1421824_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.8e-197	86.5
WP_095122954.1\|1422239_1422887_-	deoxynucleoside kinase	Q5ULP7	Lactobacillus_virus	8.8e-48	47.0
WP_095122956.1\|1422894_1423494_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_017768796.1\|1423508_1424738_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.5e-136	59.7
WP_095122960.1\|1424928_1425432_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	6.9e-24	38.7
WP_095122962.1\|1425497_1426337_-	thymidylate synthase	U5J9N5	Bacillus_phage	4.3e-79	52.7
WP_017768793.1\|1426541_1427717_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_095122964.1\|1427709_1428990_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_095122967.1\|1429000_1430017_-	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_095122970.1\|1430000_1430549_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095122973.1\|1430548_1431547_-	phosphomevalonate kinase	NA	NA	NA	NA
WP_095122975.1\|1431548_1432481_-	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_017768787.1\|1432462_1433338_-	mevalonate kinase	NA	NA	NA	NA
WP_157737866.1\|1433858_1435151_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.6e-192	85.2
WP_095122982.1\|1436936_1438661_-	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_095122984.1\|1438676_1439888_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.3e-31	38.5
WP_095123719.1\|1440198_1440756_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.7e-13	30.9
WP_095122986.1\|1442197_1443130_-	hypothetical protein	NA	NA	NA	NA
WP_095122988.1\|1444424_1445774_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_095122990.1\|1445927_1447250_-	accessory Sec system glycosylation chaperone GtfB	NA	NA	NA	NA
WP_095122992.1\|1447242_1448751_-	accessory Sec system glycosyltransferase GtfA	NA	NA	NA	NA
WP_017770491.1\|1448813_1450031_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_095122994.1\|1450055_1451198_-	cysteine desulfurase	NA	NA	NA	NA
WP_095122996.1\|1451678_1452836_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1456049 : 1523651

Streptococcus_phage(75.0%)

tail,capsid,terminase,transposase,protease,head,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095123002.1\|1456049_1456896_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_095123004.1\|1456980_1460160_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_095123006.1\|1460639_1461722_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	4.9e-59	36.7
WP_095123009.1\|1461764_1462691_-	aspartate carbamoyltransferase catalytic subunit	M1HWF9	Paramecium_bursaria_Chlorella_virus	4.5e-21	30.3
WP_095123011.1\|1462750_1463272_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_017770480.1\|1463454_1464351_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_017770479.1\|1464334_1464796_-	signal peptidase II	NA	NA	NA	NA
WP_029690477.1\|1464805_1465711_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000916503.1\|1466077_1466371_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_095123014.1\|1466391_1466727_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_017770476.1\|1466732_1467047_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_095123017.1\|1467252_1468428_-	CapA family protein	A0A2H4JG01	uncultured_Caudovirales_phage	7.0e-35	33.2
WP_095123020.1\|1468583_1469430_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	3.2e-05	23.5
WP_002884573.1\|1469568_1469745_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_095123023.1\|1469825_1470398_-	uracil-DNA glycosylase family protein	NA	NA	NA	NA
WP_095123025.1\|1470408_1471755_-	metallophosphoesterase	NA	NA	NA	NA
WP_095123027.1\|1471860_1472583_-	hypothetical protein	NA	NA	NA	NA
WP_095123029.1\|1472792_1473245_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_017770469.1\|1475971_1476376_-	PaaI family thioesterase	NA	NA	NA	NA
WP_017770468.1\|1476390_1476951_-	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	5.5e-30	39.7
WP_095123031.1\|1477094_1478033_-	nucleoside hydrolase	NA	NA	NA	NA
WP_157737868.1\|1478127_1478676_-	hypothetical protein	NA	NA	NA	NA
WP_095123720.1\|1479645_1480311_+	hypothetical protein	NA	NA	NA	NA
WP_017770463.1\|1480341_1481196_-	VanW family protein	NA	NA	NA	NA
WP_095123036.1\|1481195_1481735_-	YqeG family HAD IIIA-type phosphatase	NA	NA	NA	NA
WP_095123002.1\|1482127_1482974_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_095123038.1\|1483118_1483946_-	prephenate dehydratase	NA	NA	NA	NA
WP_095123042.1\|1483936_1484428_-	shikimate kinase	NA	NA	NA	NA
WP_095123047.1\|1484449_1485730_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_095123051.1\|1485955_1486975_+	3-deoxy-7-phosphoheptulonate synthase	A0A0B5IW14	Pandoravirus	3.5e-43	35.0
WP_095123053.1\|1486993_1488019_+	3-deoxy-7-phosphoheptulonate synthase	S4W5F1	Pandoravirus	1.4e-44	35.1
WP_095123055.1\|1488046_1488916_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_095123058.1\|1488928_1489996_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_095123061.1\|1490313_1491417_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_095123063.1\|1491423_1492590_-	chorismate synthase	NA	NA	NA	NA
WP_095123066.1\|1492586_1493267_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	2.7e-63	54.9
WP_017768863.1\|1493582_1493849_+	chorismate mutase	NA	NA	NA	NA
WP_017768862.1\|1495020_1495914_-	cation transporter	NA	NA	NA	NA
WP_095123068.1\|1495903_1496224_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_095121570.1\|1496637_1497743_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_095123070.1\|1497844_1498162_-	hypothetical protein	Q6DMT6	Streptococcus_phage	3.3e-32	62.1
WP_017770801.1\|1498158_1498527_-	HK97 gp10 family phage protein	Q6DMT7	Streptococcus_phage	7.5e-28	55.2
WP_017770800.1\|1498507_1498858_-\|head,tail	head-tail adaptor protein	A0A1B0RXE4	Streptococcus_phage	1.2e-22	48.2
WP_017770799.1\|1498857_1499133_-\|head,tail	phage gp6-like head-tail connector protein	A0A1X9I695	Streptococcus_phage	1.7e-21	59.3
WP_017770798.1\|1499135_1500335_-\|capsid	phage major capsid protein	M1Q1R5	Streptococcus_phage	4.4e-202	86.5
WP_017770797.1\|1500346_1501039_-\|protease	Clp protease ClpP	E4ZFM4	Streptococcus_phage	5.1e-102	81.4
WP_017770796.1\|1501031_1502294_-\|portal	phage portal protein	A0A1B0RXD8	Streptococcus_phage	2.9e-228	92.3
WP_044753264.1\|1502307_1503900_-\|terminase	terminase large subunit	Q6DMU3	Streptococcus_phage	7.9e-292	90.0
WP_037564715.1\|1503901_1504369_-\|terminase	phage terminase small subunit P27 family	Q6DMU4	Streptococcus_phage	1.8e-79	95.5
WP_017770793.1\|1504442_1504679_-	hypothetical protein	E4ZFL8	Streptococcus_phage	6.7e-14	50.0
WP_017770792.1\|1504671_1504884_-	DUF4314 domain-containing protein	Q6DMU8	Streptococcus_phage	6.0e-30	92.4
WP_017770791.1\|1504944_1506213_-	DNA (cytosine-5-)-methyltransferase	M1NSK8	Streptococcus_phage	3.9e-209	83.7
WP_017770790.1\|1506209_1507457_-	DNA modification methylase	A0A1B0RXJ0	Streptococcus_phage	1.1e-227	93.7
WP_017770789.1\|1507428_1507884_-	hypothetical protein	M1Q209	Streptococcus_phage	6.6e-42	51.0
WP_017770788.1\|1508144_1508510_-	HNH endonuclease	M1PLL8	Streptococcus_phage	6.0e-54	76.9
WP_095123072.1\|1508511_1509552_-	methionine adenosyltransferase	E4ZFL0	Streptococcus_phage	8.3e-149	77.2
WP_017770786.1\|1509599_1509761_-	hypothetical protein	A0A1B0RXC3	Streptococcus_phage	3.3e-12	72.3
WP_017770785.1\|1509963_1510446_-	hypothetical protein	D0R0B9	Streptococcus_phage	2.6e-60	70.7
WP_095123074.1\|1510438_1511815_-	DEAD/DEAH box helicase	A0A1X9I6B0	Streptococcus_phage	1.6e-219	82.5
WP_017770783.1\|1511795_1512077_-	VRR-NUC domain-containing protein	A0A1B0RXC4	Streptococcus_phage	7.7e-33	72.0
WP_017770782.1\|1512423_1514703_-	hypothetical protein	M1NSF0	Streptococcus_phage	0.0e+00	75.8
WP_172843155.1\|1515055_1515193_+	hypothetical protein	NA	NA	NA	NA
WP_095123076.1\|1515167_1515497_+	hypothetical protein	M1PSP3	Streptococcus_phage	7.9e-13	44.1
WP_017770779.1\|1515489_1516611_+	DUF2800 domain-containing protein	M1Q218	Streptococcus_phage	4.1e-170	76.3
WP_017770778.1\|1516614_1517178_+	DUF2815 family protein	E4ZFK3	Streptococcus_phage	5.6e-91	91.2
WP_017770777.1\|1517234_1517405_+	hypothetical protein	NA	NA	NA	NA
WP_095123079.1\|1517610_1519560_+	DNA polymerase	A0A1B0RXB4	Streptococcus_phage	1.3e-301	76.1
WP_017770774.1\|1519604_1520186_-	hypothetical protein	NA	NA	NA	NA
WP_095123082.1\|1520607_1522452_-	ImmA/IrrE family metallo-endopeptidase	A0A1X9I6C7	Streptococcus_phage	6.8e-194	53.8
WP_017770772.1\|1522523_1523651_-	DNA cytosine methyltransferase	A7XXH6	Thermus_virus	5.2e-64	41.6

DBSCAN-SWA_15

1605621 : 1683895

Streptococcus_phage(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017769185.1\|1605621_1606968_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	4.8e-56	30.6
WP_095123169.1\|1607001_1608180_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_095123172.1\|1608258_1610721_-	bifunctional DnaQ family exonuclease/ATP-dependent helicase	A0A1X9I5C8	Streptococcus_phage	3.5e-198	46.6
WP_095123173.1\|1610903_1611860_-	dihydrofolate reductase	NA	NA	NA	NA
WP_095123175.1\|1612011_1612647_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	4.7e-78	61.6
WP_095123177.1\|1612696_1613629_-	ABC transporter permease	NA	NA	NA	NA
WP_095123178.1\|1613621_1614314_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.3e-28	35.6
WP_172843156.1\|1614686_1615709_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.4e-39	34.2
WP_157737872.1\|1616013_1617109_-	peptide chain release factor 2	NA	NA	NA	NA
WP_095123183.1\|1617158_1618277_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_095123185.1\|1620070_1621987_-	fructose-1,6-bisphosphatase	NA	NA	NA	NA
WP_095122744.1\|1622400_1623405_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123187.1\|1624102_1625458_+\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_095123189.1\|1625546_1626404_+	metallophosphoesterase	NA	NA	NA	NA
WP_029690863.1\|1626464_1626833_+	hypothetical protein	NA	NA	NA	NA
WP_095122744.1\|1627220_1628225_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123191.1\|1630133_1632818_-	cation-translocating P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.7e-74	29.0
WP_029690859.1\|1633031_1634834_-	beta-hexosaminidase	NA	NA	NA	NA
WP_029690858.1\|1634844_1635645_-	HAD family hydrolase	NA	NA	NA	NA
WP_095123193.1\|1636379_1637912_-	beta-glucuronidase	NA	NA	NA	NA
WP_017768722.1\|1637977_1638817_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_017768721.1\|1638868_1639963_-	mannonate dehydratase	NA	NA	NA	NA
WP_017768720.1\|1640025_1641426_-	glucuronate isomerase	NA	NA	NA	NA
WP_017768719.1\|1641427_1642048_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_029690855.1\|1642231_1642906_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_017768716.1\|1644657_1646451_-	beta-glucuronidase	B9U1V4	Vaccinia_virus	1.0e-141	46.0
WP_017768715.1\|1646463_1647501_-	sugar kinase	NA	NA	NA	NA
WP_095123195.1\|1647560_1649108_-	MFS transporter	NA	NA	NA	NA
WP_095123197.1\|1649285_1649681_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_095123199.1\|1649782_1651084_+	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	1.6e-27	30.5
WP_095123201.1\|1651162_1651972_+	sugar-phosphatase	NA	NA	NA	NA
WP_095123204.1\|1651971_1653192_+	aminoacyltransferase	NA	NA	NA	NA
WP_095123206.1\|1653193_1654426_+	aminoacyltransferase	NA	NA	NA	NA
WP_095123208.1\|1655072_1655825_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_017768708.1\|1656161_1657358_-	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	7.8e-34	28.9
WP_095123210.1\|1657487_1658468_-	anti sigma factor C-terminal domain-containing protein	NA	NA	NA	NA
WP_095123212.1\|1658451_1658961_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_095123214.1\|1659210_1660455_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_095123216.1\|1660851_1661856_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123218.1\|1662264_1665054_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_095123220.1\|1665197_1667006_+	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	1.2e-105	36.5
WP_017768701.1\|1666989_1667469_+	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	4.5e-09	31.2
WP_017768826.1\|1667971_1668352_-	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_017768825.1\|1668317_1668845_-	ECF transporter S component	NA	NA	NA	NA
WP_095123223.1\|1668932_1670066_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	4.3e-74	41.2
WP_095123225.1\|1670257_1671130_+	N-acetylmuramoyl-L-alanine amidase	X2JN49	Bacillus_phage	3.6e-20	34.0
WP_095123227.1\|1671367_1671931_+	energy-coupled thiamine transporter ThiT	NA	NA	NA	NA
WP_095123724.1\|1673793_1674267_+\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
WP_095123229.1\|1674269_1674635_+	YccF domain-containing protein	NA	NA	NA	NA
WP_095123231.1\|1674637_1675261_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_017770439.1\|1675298_1676201_-	HAD family hydrolase	NA	NA	NA	NA
WP_095123233.1\|1676340_1677831_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	5.6e-90	40.7
WP_095123235.1\|1679755_1679962_+	hypothetical protein	NA	NA	NA	NA
WP_006738512.1\|1680057_1680255_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_172843152.1\|1682872_1683895_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	9.6e-41	34.5

DBSCAN-SWA_16

1716087 : 1766044

Streptococcus_phage(23.08%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095123272.1\|1716087_1716951_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095123273.1\|1717348_1718353_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123275.1\|1719088_1719472_-	hypothetical protein	NA	NA	NA	NA
WP_095123277.1\|1719598_1720348_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_017768957.1\|1720505_1720694_+	hypothetical protein	NA	NA	NA	NA
WP_095123278.1\|1720834_1721590_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_095123280.1\|1721591_1721855_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_095123281.1\|1721912_1723505_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.1e-58	38.0
WP_172843157.1\|1723771_1724002_-	hypothetical protein	NA	NA	NA	NA
WP_095123285.1\|1724141_1725941_-	SH3 domain-containing protein	M1PRP8	Streptococcus_phage	8.8e-05	53.2
WP_017768963.1\|1726112_1726493_-	PH domain-containing protein	A6N235	Microbacterium_phage	1.4e-08	42.0
WP_095123725.1\|1727828_1729373_-	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	2.8e-36	28.5
WP_017769348.1\|1729492_1730179_-	TIGR02206 family membrane protein	NA	NA	NA	NA
WP_095123287.1\|1730185_1731556_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_095123289.1\|1731888_1732455_+	folate family ECF transporter S component	NA	NA	NA	NA
WP_095123291.1\|1732495_1733542_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_017769352.1\|1733669_1734266_-	recombination protein RecR	NA	NA	NA	NA
WP_095123726.1\|1734290_1736276_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_017769354.1\|1736744_1737440_-	phosphoglycerate mutase	NA	NA	NA	NA
WP_157737876.1\|1737516_1737660_-	hypothetical protein	NA	NA	NA	NA
WP_095123293.1\|1737732_1738668_+	dihydroorotate oxidase	A0A1V0SH91	Hokovirus	2.4e-62	42.6
WP_095123295.1\|1738791_1738974_-	hypothetical protein	NA	NA	NA	NA
WP_017769715.1\|1739021_1739201_-	hypothetical protein	NA	NA	NA	NA
WP_095123297.1\|1739204_1739672_-	transcriptional repressor	NA	NA	NA	NA
WP_095123298.1\|1739772_1740558_-	hypothetical protein	NA	NA	NA	NA
WP_095121570.1\|1740667_1741772_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_157737878.1\|1741769_1742867_-	hypothetical protein	NA	NA	NA	NA
WP_095123302.1\|1743105_1743952_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	7.5e-07	22.6
WP_017769711.1\|1744155_1744431_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.5e-25	71.9
WP_017769710.1\|1744552_1745146_-	YpmS family protein	NA	NA	NA	NA
WP_095123304.1\|1745135_1745966_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_017769708.1\|1745958_1746798_-	DegV family protein	NA	NA	NA	NA
WP_095123306.1\|1746904_1748563_-	DNA repair protein RecN	NA	NA	NA	NA
WP_017769706.1\|1748572_1749040_-	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_017769705.1\|1749017_1749854_-	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_017769704.1\|1749819_1750716_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_017769703.1\|1750715_1750934_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_095123308.1\|1750923_1752252_-	exodeoxyribonuclease VII large subunit	M1NLU2	Moumouvirus	5.8e-38	32.8
WP_017769702.1\|1755514_1756165_-	hemolysin III family protein	NA	NA	NA	NA
WP_172843181.1\|1756148_1756604_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_095123312.1\|1756699_1757554_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	5.0e-43	42.2
WP_095123314.1\|1757766_1758501_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.4e-39	42.3
WP_017769698.1\|1758500_1759187_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_000443582.1\|1759340_1759571_-	DUF1797 family protein	NA	NA	NA	NA
WP_095123317.1\|1759860_1762119_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	4.3e-126	39.1
WP_095123319.1\|1764751_1766044_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.5e-208	92.0

DBSCAN-SWA_17

1802938 : 1841109

Streptococcus_phage(55.56%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095123355.1\|1802938_1803786_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	2.2e-06	23.5
WP_095123357.1\|1803945_1804914_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_095123360.1\|1804915_1805365_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_095123362.1\|1805997_1806699_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
WP_017768759.1\|1806691_1806928_-	DUF2829 domain-containing protein	NA	NA	NA	NA
WP_095123365.1\|1808226_1809074_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	7.5e-07	24.5
WP_095123367.1\|1809138_1809495_+	hypothetical protein	NA	NA	NA	NA
WP_095123369.1\|1809542_1810370_-	hypothetical protein	NA	NA	NA	NA
WP_017769485.1\|1810356_1810692_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_017769484.1\|1810704_1810857_-	hypothetical protein	NA	NA	NA	NA
WP_017769483.1\|1810872_1811019_-	hypothetical protein	NA	NA	NA	NA
WP_017769482.1\|1811294_1812530_-	aminoacyltransferase	NA	NA	NA	NA
WP_095121704.1\|1812713_1813718_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095121704.1\|1814273_1815278_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123371.1\|1817105_1819163_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-85	34.4
WP_095123373.1\|1820904_1821123_-	hypothetical protein	NA	NA	NA	NA
WP_095123375.1\|1821129_1822794_-	hypothetical protein	NA	NA	NA	NA
WP_051105453.1\|1822939_1823647_-	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_172843158.1\|1823892_1825029_-	L-lactate oxidase	NA	NA	NA	NA
WP_095123379.1\|1825363_1826191_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	1.6e-123	82.4
WP_095123381.1\|1826370_1826991_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_095123383.1\|1827193_1827844_-	HD domain-containing protein	S4W232	Pandoravirus	1.9e-13	30.4
WP_017768730.1\|1827859_1828114_-	DUF1912 family protein	NA	NA	NA	NA
WP_095123728.1\|1828926_1829112_+\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	3.5e-18	81.4
WP_017769993.1\|1835690_1836239_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_095123385.1\|1836320_1836983_-	ComF family protein	NA	NA	NA	NA
WP_095123387.1\|1836982_1838281_-	DEAD/DEAH box helicase	A0A1X9I5S6	Streptococcus_phage	1.4e-132	54.2
WP_095123389.1\|1838328_1838955_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	5.0e-64	60.7
WP_095123391.1\|1839050_1839971_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	1.4e-139	82.2
WP_095122103.1\|1840245_1841109_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

1850945 : 1909415

Bacillus_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095123404.1\|1850945_1851878_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.6e-08	31.8
WP_095123406.1\|1851992_1854380_-	primosomal protein N'	NA	NA	NA	NA
WP_095123408.1\|1854769_1855087_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_095123410.1\|1855110_1855731_-	guanylate kinase	K4JYM5	Abalone_herpesvirus	6.7e-21	35.0
WP_095123412.1\|1856050_1857658_-	ribonuclease Y	NA	NA	NA	NA
WP_017769195.1\|1857807_1858290_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_095123415.1\|1858342_1859860_-	hypothetical protein	NA	NA	NA	NA
WP_095123417.1\|1859862_1861029_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_095123419.1\|1861482_1861833_-	cell division regulator GpsB	NA	NA	NA	NA
WP_095123421.1\|1861958_1862477_-	DUF1273 family protein	NA	NA	NA	NA
WP_017769200.1\|1862554_1863154_+	Holliday junction resolvase RecU	A0A0S2MVB5	Bacillus_phage	4.3e-17	31.3
WP_017769201.1\|1863155_1865405_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_095123424.1\|1866268_1867297_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_172843159.1\|1867312_1868080_-	response regulator	NA	NA	NA	NA
WP_095123428.1\|1868072_1869716_-	histidine kinase	NA	NA	NA	NA
WP_017769961.1\|1870181_1871009_-	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_095123430.1\|1871005_1871815_-	PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC	NA	NA	NA	NA
WP_095123434.1\|1871833_1872325_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_017769964.1\|1872346_1872772_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_172843133.1\|1873521_1873941_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_095123437.1\|1874086_1874934_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.4e-07	24.0
WP_095123439.1\|1876379_1877333_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.8e-41	37.8
WP_095123441.1\|1877622_1878108_+	type III toxin-antitoxin system ToxN/AbiQ family toxin	NA	NA	NA	NA
WP_095123443.1\|1878554_1878923_-	hypothetical protein	NA	NA	NA	NA
WP_095123444.1\|1879217_1879442_-	hypothetical protein	NA	NA	NA	NA
WP_095123445.1\|1879461_1880259_-	ParA family protein	NA	NA	NA	NA
WP_095123446.1\|1880635_1882516_-	hypothetical protein	NA	NA	NA	NA
WP_095123447.1\|1882577_1884536_-	hypothetical protein	NA	NA	NA	NA
WP_095123448.1\|1884536_1884797_-	hypothetical protein	A0A1X9I6D4	Streptococcus_phage	1.3e-10	48.3
WP_095123729.1\|1885068_1885926_-	Rgg/GadR/MutR family transcriptional regulator	A0A1X9I6E0	Streptococcus_phage	1.6e-36	41.3
WP_172843138.1\|1886071_1887094_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	7.4e-41	34.5
WP_095121687.1\|1887212_1888076_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095123449.1\|1888349_1889597_+	MFS transporter	NA	NA	NA	NA
WP_095123450.1\|1889593_1890463_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.9e-38	43.1
WP_095123451.1\|1890473_1891172_+	ABC transporter permease	NA	NA	NA	NA
WP_095123452.1\|1891289_1891904_-	recombinase family protein	M9Q1K0	Clostridium_phage	1.7e-21	41.7
WP_095123453.1\|1892052_1892745_-	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_095123454.1\|1893028_1893745_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_095123731.1\|1893847_1894948_-	nucleotidyltransferase	NA	NA	NA	NA
WP_095123730.1\|1894959_1895703_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_017769969.1\|1895886_1896240_-	ribosome silencing factor	NA	NA	NA	NA
WP_095123455.1\|1896247_1896841_-	HD domain-containing protein	NA	NA	NA	NA
WP_095123456.1\|1896837_1897470_-	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_095123457.1\|1897507_1897822_-	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_095123458.1\|1897997_1899116_-	ribosome biogenesis GTPase YqeH	NA	NA	NA	NA
WP_029691564.1\|1899115_1899676_-	YqeG family HAD IIIA-type phosphatase	NA	NA	NA	NA
WP_095123459.1\|1899960_1900656_-	hypothetical protein	NA	NA	NA	NA
WP_095122611.1\|1901305_1902153_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.2e-07	23.5
WP_017770317.1\|1902959_1904399_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_095123460.1\|1904398_1905865_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_095123461.1\|1905864_1906167_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_095123462.1\|1907676_1907973_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_095123463.1\|1908251_1909415_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	2.9e-25	27.6

DBSCAN-SWA_19

1962622 : 2097413

112

Streptococcus_phage(18.18%)

protease,bacteriocin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095121738.1\|1962622_1963486_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095121422.1\|1963793_1964798_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123493.1\|1964978_1966385_-	6-phospho-beta-galactosidase	NA	NA	NA	NA
WP_095123494.1\|1966454_1968134_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_095123495.1\|1968133_1968451_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_095123496.1\|1968482_1969316_-	PRD domain-containing protein	NA	NA	NA	NA
WP_095123497.1\|1970324_1970591_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_095123498.1\|1971643_1972540_-	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_095123499.1\|1972631_1973618_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_095123500.1\|1973620_1974550_-	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_017769720.1\|1974680_1975196_-	galactose-6-phosphate isomerase subunit LacB	NA	NA	NA	NA
WP_095123501.1\|1975210_1975636_-	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_095123502.1\|1975660_1977109_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_017769723.1\|1977135_1977441_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_017769724.1\|1977433_1977907_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_095121738.1\|1978140_1979004_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017769725.1\|1979077_1979836_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_017769726.1\|1980052_1980823_-	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_017769727.1\|1980819_1981683_-	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_017769728.1\|1981694_1983074_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_017769729.1\|1983123_1983546_-	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_017769730.1\|1983542_1984016_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_095123503.1\|1984018_1985251_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_095123504.1\|1985326_1986061_-	3-oxoacyl-[acyl-carrier-protein] reductase	A0A0M4JSW6	Mollivirus	2.4e-09	25.2
WP_095123505.1\|1986072_1986993_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_017769734.1\|1987007_1987973_-	enoyl-[acyl-carrier-protein] reductase FabK	NA	NA	NA	NA
WP_017769735.1\|1988094_1988319_-	acyl carrier protein	NA	NA	NA	NA
WP_095123506.1\|1988378_1989347_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_017769737.1\|1989346_1989781_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_095123507.1\|1989872_1990676_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_095123508.1\|1990866_1992219_+	aspartate kinase	NA	NA	NA	NA
WP_095123509.1\|1992454_1992952_-	competence protein ComX	NA	NA	NA	NA
WP_095122744.1\|1999317_2000322_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123510.1\|2000904_2002062_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_095122744.1\|2002111_2003116_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_172843161.1\|2003280_2003919_-	HAD family phosphatase	M1I080	Acanthocystis_turfacea_Chlorella_virus	9.0e-13	29.5
WP_029692074.1\|2004049_2004367_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	2.3e-17	46.2
WP_095123512.1\|2006533_2006977_-	VOC family protein	NA	NA	NA	NA
WP_100244334.1\|2007058_2007493_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_095123514.1\|2008182_2008401_-	DUF4649 family protein	NA	NA	NA	NA
WP_095123515.1\|2008410_2008767_-	DUF2200 domain-containing protein	NA	NA	NA	NA
WP_095123516.1\|2008776_2010093_-	FAD-containing oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	7.9e-96	43.7
WP_029692082.1\|2010327_2010831_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	4.7e-41	54.8
WP_095123517.1\|2010957_2012442_+	DUF1846 domain-containing protein	NA	NA	NA	NA
WP_095123518.1\|2012574_2014914_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	4.3e-20	52.4
WP_095123519.1\|2015026_2015329_+	hypothetical protein	NA	NA	NA	NA
WP_017769023.1\|2015325_2015874_+	CvpA family protein	NA	NA	NA	NA
WP_017769024.1\|2016219_2017245_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_017769025.1\|2017259_2018171_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.5e-72	50.9
WP_095123520.1\|2019253_2020101_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	2.9e-06	22.0
WP_037563672.1\|2020326_2020851_-\|tRNA	tRNA adenosine(34) deaminase TadA	NA	NA	NA	NA
WP_095123521.1\|2020850_2021627_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_017769028.1\|2021787_2022345_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_095123522.1\|2022392_2024249_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_095123523.1\|2024631_2025894_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_017769031.1\|2025915_2026710_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_017769032.1\|2026727_2027477_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.3e-21	38.8
WP_017769033.1\|2027922_2028264_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_095123524.1\|2028362_2028698_-	thioredoxin family protein	NA	NA	NA	NA
WP_172843183.1\|2028754_2029381_-	hypothetical protein	NA	NA	NA	NA
WP_017769036.1\|2029405_2030401_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	4.6e-48	37.0
WP_095123525.1\|2030415_2031882_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_095123526.1\|2031885_2033058_-	galactokinase	NA	NA	NA	NA
WP_095123527.1\|2033197_2034196_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.3e-09	25.5
WP_095123528.1\|2034325_2035936_-	alpha-glucosidase	NA	NA	NA	NA
WP_095123529.1\|2036009_2037143_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	3.6e-20	31.8
WP_095123530.1\|2037289_2038138_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_017769043.1\|2038228_2039056_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_095123531.1\|2039057_2040731_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.3e-21	29.1
WP_095123532.1\|2040815_2041364_-	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_095123533.1\|2041381_2042227_-	S-adenosyl-l-methionine hydroxide adenosyltransferase family protein	NA	NA	NA	NA
WP_095123534.1\|2042634_2045136_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	65.3
WP_095123535.1\|2045517_2046351_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_017768694.1\|2046596_2048099_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_095123536.1\|2048116_2048821_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_095123537.1\|2048824_2049652_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_095123538.1\|2049827_2050793_-	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_095123539.1\|2050802_2052179_-	amino acid permease	NA	NA	NA	NA
WP_095123540.1\|2052381_2053380_-	YhdH/YhfP family quinone oxidoreductase	NA	NA	NA	NA
WP_017768688.1\|2053449_2053992_-	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_017768687.1\|2054184_2054361_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_079268432.1\|2054371_2054524_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_095123541.1\|2054572_2056966_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_095123542.1\|2057088_2057958_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_095123543.1\|2058046_2058451_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_017768683.1\|2058463_2059273_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_095123544.1\|2059259_2060162_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_095123545.1\|2060316_2060802_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_095123546.1\|2060798_2062583_-	beta-galactosidase	NA	NA	NA	NA
WP_095123547.1\|2062749_2063466_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_095123548.1\|2063528_2064512_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_095123549.1\|2064520_2065696_-	SIS domain-containing protein	NA	NA	NA	NA
WP_017770357.1\|2065706_2066426_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_095123550.1\|2066907_2068200_-	adenylosuccinate synthase	G5CQQ4	Megavirus	6.6e-71	36.9
WP_095123551.1\|2068468_2069518_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_095123552.1\|2069682_2070411_+	hypothetical protein	M1PFV6	Streptococcus_phage	2.6e-32	47.5
WP_095123553.1\|2070487_2071492_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123554.1\|2071630_2072905_+	toxic anion resistance protein	M1PLC8	Streptococcus_phage	2.0e-136	68.0
WP_095123555.1\|2072991_2073864_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_017770363.1\|2073850_2074828_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_095121481.1\|2074941_2076219_-	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_095123556.1\|2076776_2077484_-	low temperature requirement protein A	NA	NA	NA	NA
WP_095123557.1\|2078391_2079039_-	low temperature requirement protein A	NA	NA	NA	NA
WP_095123558.1\|2080439_2082878_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	5.9e-121	38.0
WP_017770081.1\|2082877_2083339_-	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_095123559.1\|2083840_2084881_-	elongation factor Ts	NA	NA	NA	NA
WP_017770079.1\|2085063_2085831_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_017770074.1\|2092607_2093012_-	type II toxin-antitoxin system HicB family antitoxin	A0A1P8VVW2	Streptococcus_phage	5.3e-67	99.3
WP_095123560.1\|2093071_2093257_-	type II toxin-antitoxin system HicA family toxin	A0A1P8VVU8	Streptococcus_phage	2.2e-28	98.4
WP_095121570.1\|2094809_2095914_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_095123561.1\|2096162_2096498_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_095122006.1\|2096565_2097413_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	9.9e-07	23.7

DBSCAN-SWA_20

2113049 : 2168149

Streptococcus_phage(33.33%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095123568.1\|2113049_2113676_-\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_017770232.1\|2113681_2113996_-	thioredoxin family protein	A0A0K2FIM3	Achromobacter_phage	5.2e-06	34.5
WP_037564361.1\|2113992_2114274_-	DUF4651 domain-containing protein	NA	NA	NA	NA
WP_017770230.1\|2114465_2114666_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.0e-23	78.5
WP_095123569.1\|2114811_2115876_+	glutamyl aminopeptidase	NA	NA	NA	NA
WP_095123570.1\|2115918_2116704_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.4e-36	38.4
WP_095123571.1\|2117249_2117918_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_095123572.1\|2117951_2118404_-	hypothetical protein	NA	NA	NA	NA
WP_095123573.1\|2118478_2119483_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_017770225.1\|2119612_2119810_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_095123574.1\|2119838_2120045_-	hypothetical protein	NA	NA	NA	NA
WP_017770223.1\|2120199_2121390_-	acetate kinase	NA	NA	NA	NA
WP_095123575.1\|2121450_2122404_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_017770220.1\|2122842_2123280_-	competence protein ComGF	NA	NA	NA	NA
WP_095123576.1\|2123257_2123557_-	hypothetical protein	NA	NA	NA	NA
WP_095123577.1\|2123528_2123945_-	competence protein	NA	NA	NA	NA
WP_095123578.1\|2123928_2124219_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_017770216.1\|2124219_2125194_-	type II secretion system F family protein	NA	NA	NA	NA
WP_017770215.1\|2125171_2126125_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_100244363.1\|2126244_2126604_-	DUF1033 family protein	NA	NA	NA	NA
WP_095123579.1\|2126941_2130574_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	4.0e-65	25.2
WP_017770212.1\|2130697_2134267_-	DNA-directed RNA polymerase subunit beta	A0A2P0VMZ3	Tetraselmis_virus	1.6e-37	25.6
WP_172843184.1\|2134567_2136865_-	penicillin-binding protein	NA	NA	NA	NA
WP_095123581.1\|2137096_2138353_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	5.6e-75	39.7
WP_017770208.1\|2139738_2140563_-	metal ABC transporter permease	NA	NA	NA	NA
WP_095123582.1\|2140559_2141252_-	metal ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-12	31.7
WP_095123583.1\|2141255_2141693_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_095123584.1\|2143095_2144157_+\|transposase	transposase	A0A2I7SC85	Paenibacillus_phage	1.0e-29	52.0
WP_095123585.1\|2144415_2145672_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.7e-128	56.6
WP_095123735.1\|2152400_2152958_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.9e-51	55.0
WP_172843185.1\|2152954_2153455_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017769426.1\|2153456_2154389_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_095123736.1\|2154711_2156880_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.2e-263	63.8
WP_095123587.1\|2156993_2158535_-	hypothetical protein	NA	NA	NA	NA
WP_095123588.1\|2160206_2160506_-	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_095123589.1\|2160520_2160940_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_095123590.1\|2160939_2161206_-	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_095123591.1\|2161359_2161887_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_037563881.1\|2161886_2162555_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_023649370.1\|2162580_2163327_+	peroxide stress protein YaaA	A0A1X9I5I0	Streptococcus_phage	2.1e-29	38.3
WP_095121570.1\|2163410_2164516_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_095123592.1\|2164663_2165161_-	competence protein ComX	NA	NA	NA	NA
WP_095123593.1\|2165513_2166716_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	8.3e-209	92.0
WP_095123585.1\|2166892_2168149_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.7e-128	56.6

DBSCAN-SWA_21

2191638 : 2288822

Streptococcus_phage(35.29%)

protease,transposase,tRNA,integrase

attL 2250066:2250082|attR 2289546:2289562

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095123599.1\|2191638_2192747_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-69	50.0
WP_095123601.1\|2193184_2193985_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	4.0e-10	26.3
WP_095123602.1\|2194010_2194616_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_095122274.1\|2194616_2195464_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.3e-06	22.9
WP_095123603.1\|2195475_2196774_+	PRD domain-containing protein	NA	NA	NA	NA
WP_029691486.1\|2196770_2197250_+	transcriptional regulator GutM	NA	NA	NA	NA
WP_095123604.1\|2197283_2197826_+	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_095123605.1\|2197847_2198831_+	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_095123606.1\|2198863_2199229_+	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_095123607.1\|2199244_2199922_+	fructose-6-phosphate aldolase	M4SLG0	Cyanophage	2.3e-22	30.1
WP_095123608.1\|2200067_2200616_+	DUF4352 domain-containing protein	E5DV69	Deep-sea_thermophilic_phage	5.4e-22	40.6
WP_017768831.1\|2200712_2201411_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	NA	NA	NA	NA
WP_095123609.1\|2201465_2202596_+	N-acetyldiaminopimelate deacetylase	NA	NA	NA	NA
WP_017768833.1\|2202648_2203047_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_029691479.1\|2203284_2204445_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	4.8e-121	63.5
WP_095123610.1\|2204541_2205798_-	competence/damage-inducible protein A	NA	NA	NA	NA
WP_172843162.1\|2207218_2207602_+	hypothetical protein	NA	NA	NA	NA
WP_095123611.1\|2207651_2208656_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_095123613.1\|2209138_2209986_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.3e-06	22.9
WP_095123614.1\|2210180_2210732_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_017769066.1\|2210832_2211426_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_029691475.1\|2211435_2212659_-	MFS transporter	NA	NA	NA	NA
WP_095123615.1\|2212695_2214663_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.8e-65	30.5
WP_095123616.1\|2214757_2217307_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	7.2e-37	24.4
WP_095123617.1\|2217318_2217756_-	arginine repressor	NA	NA	NA	NA
WP_095123618.1\|2217913_2219605_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.6e-75	32.8
WP_002982147.1\|2221340_2221490_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_029691462.1\|2221505_2221688_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_095123619.1\|2222002_2223115_+	vitamin B12 independent methionine synthase	A0A218MNE0	uncultured_virus	7.9e-73	42.4
WP_095123620.1\|2223169_2223634_+	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_095123621.1\|2223618_2225469_-	APC family permease	NA	NA	NA	NA
WP_095123737.1\|2225765_2227043_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_095123622.1\|2227153_2228905_+\|tRNA	aspartate--tRNA ligase	A0A1V0SJ84	Klosneuvirus	9.1e-15	26.9
WP_095123623.1\|2228897_2229836_+	YitT family protein	NA	NA	NA	NA
WP_017769074.1\|2229976_2230852_+	YitT family protein	M1Q1P6	Streptococcus_phage	8.8e-51	38.4
WP_095123624.1\|2230911_2231358_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_095123625.1\|2231640_2232228_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029691461.1\|2233817_2235071_-	hypothetical protein	NA	NA	NA	NA
WP_095123626.1\|2235346_2236351_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_157737882.1\|2237642_2237999_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023649359.1\|2238346_2239156_+\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_023649358.1\|2239199_2239331_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_172843186.1\|2239294_2239777_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_172843163.1\|2240158_2241181_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.3e-40	34.5
WP_161515432.1\|2241355_2241670_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_017769273.1\|2241704_2241989_-	hypothetical protein	NA	NA	NA	NA
WP_095123631.1\|2242516_2243461_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_095123633.1\|2243992_2245708_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.0e-58	31.2
WP_029691454.1\|2245710_2246475_-	hypothetical protein	NA	NA	NA	NA
WP_095123634.1\|2246477_2247353_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-27	38.8
WP_029691452.1\|2247345_2247777_-	hypothetical protein	NA	NA	NA	NA
WP_029691451.1\|2247787_2248369_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_029691450.1\|2248370_2249108_-	amino acid transporter	NA	NA	NA	NA
2250066:2250082	attL	NA	NA	NA	NA
WP_095123613.1\|2250199_2251046_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.3e-06	22.9
WP_095121738.1\|2251389_2252253_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095123635.1\|2252465_2253221_+	replication initiation protein	NA	NA	NA	NA
WP_095123636.1\|2253223_2253634_+	hypothetical protein	NA	NA	NA	NA
WP_095123637.1\|2253626_2254151_+	hypothetical protein	NA	NA	NA	NA
WP_095123638.1\|2254431_2254797_+	hypothetical protein	NA	NA	NA	NA
WP_157737884.1\|2256944_2257043_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_095121570.1\|2257399_2258505_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.8e-70	50.2
WP_095121738.1\|2259047_2259911_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_095123639.1\|2260008_2260647_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	8.2e-22	39.6
WP_095123640.1\|2260943_2262281_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_029691446.1\|2263031_2263364_-	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_095123641.1\|2263525_2263963_+	hypothetical protein	NA	NA	NA	NA
WP_095123642.1\|2264125_2266042_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.8e-91	36.9
WP_095123643.1\|2266053_2266362_-	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_017769263.1\|2266377_2266749_-	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_017769262.1\|2266915_2267536_+	CoA pyrophosphatase	NA	NA	NA	NA
WP_017769259.1\|2268905_2270123_-	ABC transporter permease	NA	NA	NA	NA
WP_017769258.1\|2270119_2271013_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.3e-22	29.9
WP_017769257.1\|2271249_2271576_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_095123644.1\|2271562_2272147_+	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_017769255.1\|2272143_2273187_+	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_172843187.1\|2273667_2274960_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	8.6e-204	90.2
WP_095123646.1\|2275264_2275618_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_017769319.1\|2275777_2275978_+	hypothetical protein	NA	NA	NA	NA
WP_029691438.1\|2276177_2277689_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	3.1e-51	29.5
WP_095123647.1\|2278510_2278765_+	hypothetical protein	NA	NA	NA	NA
WP_095123648.1\|2278761_2279124_-	hypothetical protein	NA	NA	NA	NA
WP_095123649.1\|2279110_2279521_-	hypothetical protein	NA	NA	NA	NA
WP_157737888.1\|2279798_2280026_-	hypothetical protein	A0A1X9I5V2	Streptococcus_phage	4.2e-21	58.9
WP_095123651.1\|2280412_2280715_-	hypothetical protein	A0A1X9I5U4	Streptococcus_phage	2.0e-10	42.9
WP_095123652.1\|2280716_2281124_-	hypothetical protein	A0A1X9I5V5	Streptococcus_phage	1.1e-27	50.8
WP_095123653.1\|2281114_2281309_-	hypothetical protein	NA	NA	NA	NA
WP_095123739.1\|2281628_2282897_-	virulence-associated protein E	M1PKI6	Streptococcus_phage	2.8e-50	30.8
WP_095123654.1\|2283034_2283871_-	primase C-terminal domain-containing protein	A0A1X9I6L2	Streptococcus_phage	3.0e-80	53.0
WP_095123655.1\|2283870_2284140_-	hypothetical protein	A0A1X9I5U9	Streptococcus_phage	2.5e-20	51.2
WP_095123656.1\|2284123_2284453_-	DNA-binding protein	A0A1X9I5Z6	Streptococcus_phage	2.2e-10	41.0
WP_095123740.1\|2284453_2284705_-	hypothetical protein	M1PF88	Streptococcus_phage	1.6e-10	49.4
WP_095123741.1\|2284916_2285189_-	hypothetical protein	NA	NA	NA	NA
WP_172843164.1\|2285267_2285417_-	hypothetical protein	NA	NA	NA	NA
WP_095123658.1\|2285688_2286309_-	Rha family transcriptional regulator	A0A192Y918	Salmonella_phage	1.0e-13	29.8
WP_086163549.1\|2286319_2286523_-	transcriptional regulator	NA	NA	NA	NA
WP_095123659.1\|2286729_2287248_+	helix-turn-helix domain-containing protein	A0A1X9I723	Streptococcus_phage	1.4e-16	61.1
WP_095123660.1\|2287655_2288822_+\|integrase	site-specific integrase	A0A1X9I5Y5	Streptococcus_phage	2.0e-159	70.9
2289546:2289562	attR	NA	NA	NA	NA

DBSCAN-SWA_22

2306571 : 2314583

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095123672.1\|2306571_2307270_-	transglycosylase	Q4Z8Z7	Staphylococcus_phage	1.7e-28	70.6
WP_095123673.1\|2307412_2307925_-	LysM peptidoglycan-binding domain-containing protein	A0A288TY55	Enterococcus_phage	1.9e-21	35.5
WP_095123674.1\|2308088_2308889_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_095123675.1\|2308881_2309724_-	energy-coupling factor transporter ATPase	A0A2H4PQG7	Staphylococcus_phage	2.8e-14	28.5
WP_017769792.1\|2309699_2310527_-	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	1.8e-21	32.7
WP_017769791.1\|2310538_2311081_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_095123676.1\|2311087_2311969_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_095123677.1\|2312040_2313333_-	insulinase family protein	A0A2K9LA15	Tupanvirus	4.4e-14	27.7
WP_095123678.1\|2313335_2314583_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	4.0e-65	35.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LT906454

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection