CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LS398551	Orientia tsutsugamushi str. Gilliam chromosome I	3 crisprs	RT,DEDDh	6	0	24	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LS398551_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LS398551_1

269875-269964

Orphan

Consensus_repeat	Method
TGAAGGCAGAGCTGAAGGCAGGGCTGAAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LS398551_1

>merge|NZ_LS398551|1|269875-269964|CRISPRCasFinder
AAAATATATTGATGAAGGCAGAGCTGAAGGCAGGGCTGAAGGTATAAAGCTTGGTGAGACTAAGGGCAAAGCTGAAGGCAGAGCTGAAGG

>NZ_LS398551|1|1|269875-269964|CRISPRCasFinder
AAAATATATTGATGAAGGCAGAGCTGAAGG	CAGGGCTGAAGGTATAAAGCTTGGTGAGAC
TAAGGGCAAAGCTGAAGGCAGAGCTGAAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LS398551.1\|WP_109234511.1\|260246_260822_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NZ_LS398551.1\|WP_047220595.1\|284427_284763_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_109234517.1\|276462_277161_-\|conjugal-transfer-protein-TraF	unknown	unknown	gnl\|CDD\|372692
NZ_LS398551.1\|WP_011944309.1\|252064_252334_-\|30S-ribosomal-protein-S15	unknown	unknown	gnl\|CDD\|180170
NZ_LS398551.1\|WP_109234519.1\|279814_280198_-\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|370610
NZ_LS398551.1\|WP_109234520.1\|280220_281123_-\|TraU-family-protein	unknown	unknown	gnl\|CDD\|377717
NZ_LS398551.1\|WP_109234513.1\|270115_271870_-\|type-IV-secretion-system-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|313610
NZ_LS398551.1\|WP_109234509.1\|257364_258174_-\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	unknown	unknown	gnl\|CDD\|273146
NZ_LS398551.1\|WP_109234512.1\|260942_262001_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_LS398551.1\|WP_047220272.1\|252357_253266_-\|tRNA-pseudouridine(55)-synthase-TruB	unknown	unknown	gnl\|CDD\|179300
NZ_LS398551.1\|WP_045915406.1\|262068_262524_-\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_LS398551.1\|WP_109234521.1\|283052_284336_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271177
NZ_LS398551.1\|WP_082303941.1\|257079_257361_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_109234522.1\|285311_285788_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_109234514.1\|271873_273019_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_LS398551.1\|WP_082304340.1\|267967_269071_+\|toprim-domain-containing-protein	unknown	unknown	gnl\|CDD\|274285
NZ_LS398551.1\|WP_109234510.1\|259288_260146_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_LS398551.1\|WP_047220982.1\|282316_282616_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_012461870.1\|254510_254951_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_LS398551.1\|WP_109234518.1\|278294_279162_-\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923

Protein	Function_ID	Function_description	E-value
NZ_LS398551.1\|WP_109234511.1\|260246_260822_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	7.57244e-38
NZ_LS398551.1\|WP_109234517.1\|276462_277161_-\|conjugal-transfer-protein-TraF	gnl\|CDD\|372692	pfam13728, TraF, F plasmid transfer operon protein. TraF protein undergoes proteolytic processing associated with export. The 19 amino acids at the amino terminus of the polypeptides appear to constitute a typical membrane leader peptide - not included in this family, while the remainder of the molecule is predicted to be primarily hydrophilic in character. F plasmid TraF and TraH are required for F pilus assembly and F plasmid transfer, and they are both localized to the outer membrane in the presence of the complete F transfer region, especially TraV, the putative anchor.	1.43342e-51
NZ_LS398551.1\|WP_011944309.1\|252064_252334_-\|30S-ribosomal-protein-S15	gnl\|CDD\|180170	PRK05626, rpsO, 30S ribosomal protein S15; Reviewed.	2.27309e-47
NZ_LS398551.1\|WP_109234519.1\|279814_280198_-\|conjugal-transfer-protein	gnl\|CDD\|370610	pfam09673, TrbC_Ftype, Type-F conjugative transfer system pilin assembly protein. This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins is heterogeneous.	1.6671e-19
NZ_LS398551.1\|WP_109234520.1\|280220_281123_-\|TraU-family-protein	gnl\|CDD\|377717	pfam06834, TraU, TraU protein. This family consists of several bacterial TraU proteins. TraU appears to be more essential to conjugal DNA transfer than to assembly of pilus filaments.	3.17848e-113
NZ_LS398551.1\|WP_109234513.1\|270115_271870_-\|type-IV-secretion-system-DNA-binding-domain-containing-protein	gnl\|CDD\|313610	pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.	0
NZ_LS398551.1\|WP_109234509.1\|257364_258174_-\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	gnl\|CDD\|273146	TIGR00571, DNA_adenine_methylase, DNA adenine methylase (dam). All proteins in this family for which functions are known are DNA-adenine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The DNA adenine methylase (dam) of E. coli and related species is instrumental in distinguishing the newly synthesized strand during DNA replication for methylation-directed mismatch repair. This family includes several phage methylases and a number of different restriction enzyme chromosomal site-specific modification systems. [DNA metabolism, DNA replication, recombination, and repair].	4.86178e-52
NZ_LS398551.1\|WP_109234512.1\|260942_262001_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	1.67991e-48
NZ_LS398551.1\|WP_047220272.1\|252357_253266_-\|tRNA-pseudouridine(55)-synthase-TruB	gnl\|CDD\|179300	PRK01528, truB, tRNA pseudouridine synthase B; Provisional.	4.63983e-98
NZ_LS398551.1\|WP_045915406.1\|262068_262524_-\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	2.48057e-18
NZ_LS398551.1\|WP_109234521.1\|283052_284336_+\|site-specific-integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	4.26602e-33
NZ_LS398551.1\|WP_109234514.1\|271873_273019_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	8.48041e-24
NZ_LS398551.1\|WP_082304340.1\|267967_269071_+\|toprim-domain-containing-protein	gnl\|CDD\|274285	TIGR02760, conjugative_transfer_relaxase_protein_TraI, conjugative transfer relaxase protein TraI. This protein is a component of the relaxosome complex. In the process of conjugative plasmid transfer the realaxosome binds to the plasmid at the oriT (origin of transfer) site. The relaxase protein TraI mediates the single-strand nicking and ATP-dependent unwinding (relaxation, helicase activity) of the plasmid molecule. These two activities reside in separate domains of the protein.	1.82937e-12
NZ_LS398551.1\|WP_109234510.1\|259288_260146_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	7.05631e-12
NZ_LS398551.1\|WP_012461870.1\|254510_254951_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.39063e-11
NZ_LS398551.1\|WP_109234518.1\|278294_279162_-\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.23073e-49

>NZ_LS398551.1|WP_082304340.1|267967_269071_+|toprim-domain-containing-protein
MTIIAEGAETALSLQQSGIKGNIIASARISNLRNYSPFSGEKIIIAADNDSKNSITNNTVIKAAKTLEMKGAITCIVKPPENGDFNNLLQSCGEQSIRDIIEPEITKLTKAVETTKLTQTENNSIEKQNDITNVKELYNKSSSLYYLKQEEEAKLEAIVVNKFLENHTGIYSAKIFNNSNLRANMVFDEETQKSWPALTIFVKNEAGEITGAKILTLNSKTCNKADVAEKSVGTISGSFAEIAQQNLKYSPVTIITKDIETALTIWQARVEGKILCAIEAENLQNYNPGPKEKIILAVKNDVNTEKAKKVLEDKEAVVCTVKNDFNNVLKTQGLYAVRNIISPEIRKLNEKIESIQTNIQPGLCPKH
>NZ_LS398551.1|WP_045915406.1|262068_262524_-|conjugal-transfer-protein-TraD
MANLMQQKITLQQKKARLIMDEVNLKIKERKMRTRRLIEMGGLVAKAKLDHLSANTLFGAIVSLKETLTQHPNVQDHWTTIGKDIFDKEQQNKAAVILKFTSEPDENTKRHIRLHGLKWNSFRQEWCGHVKDIEALKNGLLNVQYSIELVV
>NZ_LS398551.1|WP_109234512.1|260942_262001_+|Rpn-family-recombination-promoting-nuclease/putative-transposase
MHLSRFLDPKNDVAFKKIFGSEKNKDILIHFLNDILLFEGNREITEVEFLGTILDADIASKKESIVDVLCKDKNGAQYIIEMQVDPTQGFEKRAQYYAAKAYGRQPNRGKEGKYSDLKEVIFIAIADYKLFPNKEDYISRHVILDKKTYEHDLKDFSFTFIELPKFKKNRVEELNDITEKWCYFFKHAKETTLDGYNKIIGEDLIIKRAYEALDQFNWSEDELITYEQELKRIWDNKAVEDYKLERAKAEGIKLGEAKGKAKGKAEGKAEGIKLGEAKGKAEGKAEGKAEGKAEGKAEGKAEGIKLGEAKGKAEAKKDFAIKLLKSELSVETIAEYTDLSIQEVLNLKNSVK
>NZ_LS398551.1|WP_109234511.1|260246_260822_+|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MIDFYSESLLNKLFETNVRFDTKIDLDKVEKAIFYAQKYHGQQKRDTGEPYYMHPLEVAYMVSDYSFETDTIITAILHDTLEDTTLTKEKIVKVFGRKVAEQVSDLTRIKDNKKISSREMIQTLYNRNKTELLLIKLFDRFHNIQTVSIKPYEKRQEIILETQQEFIPLAKYLNLPEIAIELNKYCELYAT
>NZ_LS398551.1|WP_109234510.1|259288_260146_+|HAMP-domain-containing-histidine-kinase
MKEKKKTINKWMVQIPPIPITLMNGESENIDEYMEIITKLRKAKYQVEVAESLKEYCTDLIQEIKYRFNLATSEIVRLAREIMLNDSKNKDKLKTILNRSTNLQEYCNDVVYTLRSEIEKENLCSKKFSIQKLVKNAVRRLEDIAKEKDIKINYNFQYKMKDIVIGNSDHLQAILSQLIGSVIRFNHSCKVIITVHLFTIKNYIKSDNILQFRIHDTGSGISKEKLGNIKAKLADFELVRDYPLMLESGLWFVNYLINQLNGEMEIESEKDKFTTITCNIPVQLF
>NZ_LS398551.1|WP_109234509.1|257364_258174_-|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase
MSVAVANKSKPFLHWIGSKRRIVNKLIEHLPQGPHYNYYEPFLGGGALFFQVRHLFKQCFLSDINLDLITSYNAVKNNPNEVNRLLSLYHKHHSKDYYYKVKNKYSNNPNEITAKFIYLNKYSFRGIYRVYKNGQSAQTFSGECYIKLHIASRINQCSNLLHGVSIYATDFSFIEPQQNDFVYFDPPYHKSGERFYTRLPFDEKDQIRLRDFVQKLTNKGVKIMISNNNTAFIRDLYKDFNINTVTVVYSINEQRNPVNELIITNYKTC
>NZ_LS398551.1|WP_082303941.1|257079_257361_+|hypothetical-protein
MDVRLGFMCHHNCRDNFVQGNYYYNIIEGNKASIFVTGGLVSAFNGDSDTGIDLGVGTAINLSRDTYLDIECSTIANYRPLPIHIRFGLRVHI
>NZ_LS398551.1|WP_012461870.1|254510_254951_-|helix-turn-helix-transcriptional-regulator
MATSPNPNSNTKVDSIDLYVSKRLKMRRVILGLSQKKLAEAVDVSIQQIQKYEKSTNRISSGKLYSLANLLKVPIGYFFENASSYTDCKNNVNTISVFAEDQENFLSDDTVTEKEVLNLIKAFNEVKNSHVRKKIIDLVKSIKAME
>NZ_LS398551.1|WP_047220272.1|252357_253266_-|tRNA-pseudouridine(55)-synthase-TruB
MKSKINGWINLYKPAGISSAQAVAKIKHWLNLSKVGHAGTLDVEAEGVLPIAIGEATKLVQYLMEATKEYHFTMKFGAKTDSGDVSGKVVQVTSNMPTYDECLSVTKKFIGEIVQVPPSYSALKINGVRAYNLARSGHKVILSPRKVKIFSLKLESYDSINLTATYSTECSKGTYIRTLSQDIALCLQSLSFVVKLARTRVGCFNYGHSSLYLNALNSFSEAKAKAYLKDGIMDAKCVLNNIPSLSIDDVVARKIYFGQLVQLPRLHNCSLVWLQYNNQLIAIGKVEDGYFRSSKVFNFITL
>NZ_LS398551.1|WP_011944309.1|252064_252334_-|30S-ribosomal-protein-S15
MSITVERKKALISEYADLENNTGSVEVQCAILTERIINLTQHCKINFKDFHSKRGLLMLVSSRRKLLSYLKKKDLNRYTQLINRLGLRK
>NZ_LS398551.1|WP_109234513.1|270115_271870_-|type-IV-secretion-system-DNA-binding-domain-containing-protein
MNFQNQGNFTRGSQLFAHKLRMFGQGSTNVFIIGLGLSIFWIICRLYQKVFLSSLYYFVIERYVQLKLAIGEHFYDIDQIGIKFYSLRFKKWMHLNAQDFLHEFYTSQHGFKIHQLWEFLINSALLEGLIVFAIGVIISIVFFTAQGKKTIIKAKIRGADFVGYRCLAKMLKSAKKASKIRFGGLPLVKNSERLHILITGTTGTGKTNMLNELLPQIRLHKDRAIIVDTTGAFTDRFFDSKCDKLLNPFEKNSEQWLPWNDCFEAADFHDIASSFSNYTPKLDDFFAKNAELVLSEALKLYQDDKDIIKLIHTIIYSDNRQFAKAFRNTAVSGIISESALETSAGIQSTLGKNITSLQYLKPGGSFSIKEWFSNSNETGWLFITANPNQRATLCPLISAWISIAIKALMCRNPNHDNKNMWFILDELPALQKVSSLPVALAESRKYGGCFVAGLQNIHQLEAIYGAAECASMLDLFNSKFIFRVSDQVTAYKSALTLGEQEIIETQENLSYGSNTMRDGVNMNNVERKKLLVMPSEIMNLPDLTCYVKLAGNFPITKLTMQLQNLNTAFVCEYKLLKKLKLVEY
>NZ_LS398551.1|WP_109234514.1|271873_273019_-|tetratricopeptide-repeat-protein
MKNIYKLAITIILPLMLLNTAIAAEENKLIPQNSSNDENVFAKEYFNIGSSFLKLKKYHEAIENFNIAIKYDPSYATAYNSKGIALADLGKALEAVENYDLAIKHKPHFAEAYNNKAVSYRKLGKNEEAIILCDLAIKYKPNYVTAYNNKGASLSRLGRYEDATENFDIAIRYNSSYPEAYYNKGTVLMNLGQFQEAIKNYDIAIRYRPNYSEAYHNKGLTLAILGQFQNAIEHFDLAIKYDPNDATAYRNKGYVLTMLKRYSEAIESCNLAIKYNPNCAESYYRKGMILEKLGKHQEAVENLDIAIKYKPNFAENYLEKGISLVSLGQYSKAKENFNLAIKYMPNLIAEYEATIKRLTEFENFTIAKEYEQKLQILKKYS
>NZ_LS398551.1|WP_109234517.1|276462_277161_-|conjugal-transfer-protein-TraF
MSRLLMVMILISQLSTVDASPTGFLWYNDKHGHELTESTSKLMSGAHDHRIEELKEQFNQAQRIALDNPTLENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINANEPANSLHKKLYQEKSEQKNDSKLKNIAKNWGLILQVKQDCLLCKAFMPIVQGFANKYAFQLLAVSKNNELLNKLNPEHVVPVLYSVASDGKKIYSVARGIISENKIIDNILAIDRYYHKLETR
>NZ_LS398551.1|WP_109234518.1|278294_279162_-|IS630-family-transposase
MARRYSYDLRMKIFKEVDDGLSIVKACKIFNISRNTIYRWKHLKRETGDIKAKPYGPAKGYNAKIDLKEFEELIINHHDKTAKELSIILGNRLQRTRINYYRKLLGYTYKKTHFHSKIDIVLRNEFIEKVKQISKENLVFIDESGIEDNACREYGWSIKGTRCYGNKAYQHKSRVSMIAGLCNNQIIAPVIFEGNCNKAIFTTYLETILIKELLPGQIVIMDNINFHKNNTIKVLIESVGCSILFLPTYSPDLNPIEHYWFKIKNEIRKVTAQFKDISIAVEHVMKFI
>NZ_LS398551.1|WP_109234519.1|279814_280198_-|conjugal-transfer-protein
MVIRVMMLMVLLFVNNANAFFLDKQKTFIFVSFSMSDEALKSYFAESQKAGAQLVMRGLINNSFIQTKNKTMELGISFDIDPSLFEKYKVDVVPVIVIDDEKRGLTKKLTSHIPLAIALEIMENNTP
>NZ_LS398551.1|WP_109234520.1|280220_281123_-|TraU-family-protein
MGRFVNPITDVCWKCLFPITIAGFKVVSSSMPDTNASGRLICLCPKPGIPVPIPGIPVGFWEPVRLVDVTKSPMCMVSLGGLSFGSATQKGMKDEAEGNAFYHIHWYVYSMIYWLEILLDFICLEMAAVDIAYLTEFDPLWSDDAKSAILNSETLLFQNVAAYQACIADCMSCSAGLLASDYAFWCAECQGMLYPFIETAAAHNGGVGTSVLMVSKFMAKMHRQLMLWGYYGYKGLCAKYPMPIIKKSQYRLQMTYSIPETKSCKSIGQTEAIWQAGKEFPVNGEDFGYLIWRKRDCCLL
>NZ_LS398551.1|WP_047220982.1|282316_282616_-|hypothetical-protein
MYLTSFFYRSTFDCKIPKGLKCKSLYEIKNMVAQGAFDIDNLEKVEASKTKSKRRCILCYRQAKAVQGVDVVNKSQKKPKKYLINLFKSKQSQGERKHT
>NZ_LS398551.1|WP_109234521.1|283052_284336_+|site-specific-integrase
MPVKVFKFTQSALNEIKVPTKEEKIIKCRDIIQRNLLWIISYTGFRRFYLGINIGGIYYKIKIGDSPDLTVAKARKKIQQLKRDIANGINPMDERRKINKERREKREKRLKLKNELTFGQVHVKYTEYSSLYHKSWKRMAQRVKKYLESLYNTKISEITKEDIQKIFDKITARKHYVTANSILKLLSPIFNKAIEWGLLEKNPVCGIKRHKEESRSRYVTNEEMGRVMKVLAEKENSQLTEKQKQSKISEKLFLFIALFTAARSGNILAMRWDEISLSEKIWCIPKTKSKNAKTLYIGLADKLIEVLQNRKLCSNSEWVLPSSRGNSKHIPYSTMHRAWAKIRKKAGIQNVTIHDLRRTFATWMKNNGETLDTISQILGHSNTNMTKIYTIHSLDKATIATNKVVENMLSIFGPNVCLNKILSGIVP
>NZ_LS398551.1|WP_047220595.1|284427_284763_+|hypothetical-protein
MRSLMLKLRLKVIMQNQKLCWALSRPLKYMGLSIDEWGVVLAGVAPGIVLLNSRHAKLGLAFMVGGIALCYCFKKFKKVSENFLLKSFLVAKGLLPAPLGYSRLLGKKVGK
>NZ_LS398551.1|WP_109234522.1|285311_285788_+|hypothetical-protein
MNIRILRFIIGFIALVNVNNIYAVEYELEADELLKLEISDSGPTRINLKDEKINDIFMYPQNAAEVVVHESGFLFIAPREEGNKVYLTVIGEYKTIQDLMLTFTPKTPSPVMLVNAATKIEKKDNSKQNNTNLFSNELNTKELTAKPFKKQSRNTKKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LS398551_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LS398551_2

819123-819212

Orphan

Consensus_repeat	Method
TGAAGGCAGAGCTGAAGGCAGGGCTGAAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LS398551_2

>merge|NZ_LS398551|2|819123-819212|CRISPRCasFinder
AAAATATATTGATGAAGGCAGAGCTGAAGGCAGGGCTGAAGGTATAAAGCTTGGTGAGACTAAGGGCAAAGCTGAAGGCAGAGCTGAAGG

>NZ_LS398551|2|2|819123-819212|CRISPRCasFinder
AAAATATATTGATGAAGGCAGAGCTGAAGG	CAGGGCTGAAGGTATAAAGCTTGGTGAGAC
TAAGGGCAAAGCTGAAGGCAGAGCTGAAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LS398551.1\|WP_047220301.1\|803222_803951_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_LS398551.1\|WP_109235183.1\|821121_822264_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_LS398551.1\|WP_047220090.1\|826776_827160_-\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|370610
NZ_LS398551.1\|WP_047220853.1\|803972_804830_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_LS398551.1\|WP_109234697.1\|819363_821118_-\|type-IV-secretion-system-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|313610
NZ_LS398551.1\|WP_047220712.1\|804930_805506_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NZ_LS398551.1\|WP_109234695.1\|810415_811471_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_LS398551.1\|WP_109234696.1\|812546_815384_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274289
NZ_LS398551.1\|WP_082304340.1\|817215_818319_+\|toprim-domain-containing-protein	unknown	unknown	gnl\|CDD\|274285
NZ_LS398551.1\|WP_109234699.1\|830971_831298_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_047220791.1\|827182_828085_-\|TraU-family-protein	unknown	unknown	gnl\|CDD\|377717
NZ_LS398551.1\|WP_109235182.1\|807621_807885_-\|conjugal-transfer-protein-TraD	unknown	unknown	unknown
NZ_LS398551.1\|WP_047220723.1\|829278_829608_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_047220792.1\|825707_826406_-\|conjugal-transfer-protein-TraF	unknown	unknown	gnl\|CDD\|372692
NZ_LS398551.1\|WP_109234694.1\|809224_809959_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378820
NZ_LS398551.1\|WP_174190495.1\|800822_801278_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372648
NZ_LS398551.1\|WP_109234698.1\|822279_824520_-\|conjugal-transfer-protein-TraG-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|369594
NZ_LS398551.1\|WP_109234549.1\|811806_812250_-\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_LS398551.1\|WP_012460929.1\|832481_832817_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_109235168.1\|831441_831918_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_LS398551.1\|WP_047220301.1\|803222_803951_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.05566e-08
NZ_LS398551.1\|WP_109235183.1\|821121_822264_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.64329e-17
NZ_LS398551.1\|WP_047220090.1\|826776_827160_-\|conjugal-transfer-protein	gnl\|CDD\|370610	pfam09673, TrbC_Ftype, Type-F conjugative transfer system pilin assembly protein. This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins is heterogeneous.	1.53392e-19
NZ_LS398551.1\|WP_109234549.1\|811806_812250_-\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	5.29865e-18
NZ_LS398551.1\|WP_109234697.1\|819363_821118_-\|type-IV-secretion-system-DNA-binding-domain-containing-protein	gnl\|CDD\|313610	pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.	0
NZ_LS398551.1\|WP_047220712.1\|804930_805506_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	8.04123e-36
NZ_LS398551.1\|WP_109234695.1\|810415_811471_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	1.2056e-28
NZ_LS398551.1\|WP_082304340.1\|817215_818319_+\|toprim-domain-containing-protein	gnl\|CDD\|274285	TIGR02760, conjugative_transfer_relaxase_protein_TraI, conjugative transfer relaxase protein TraI. This protein is a component of the relaxosome complex. In the process of conjugative plasmid transfer the realaxosome binds to the plasmid at the oriT (origin of transfer) site. The relaxase protein TraI mediates the single-strand nicking and ATP-dependent unwinding (relaxation, helicase activity) of the plasmid molecule. These two activities reside in separate domains of the protein.	1.82937e-12
NZ_LS398551.1\|WP_047220791.1\|827182_828085_-\|TraU-family-protein	gnl\|CDD\|377717	pfam06834, TraU, TraU protein. This family consists of several bacterial TraU proteins. TraU appears to be more essential to conjugal DNA transfer than to assembly of pilus filaments.	1.37922e-114
NZ_LS398551.1\|WP_047220853.1\|803972_804830_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	6.52124e-13
NZ_LS398551.1\|WP_047220792.1\|825707_826406_-\|conjugal-transfer-protein-TraF	gnl\|CDD\|372692	pfam13728, TraF, F plasmid transfer operon protein. TraF protein undergoes proteolytic processing associated with export. The 19 amino acids at the amino terminus of the polypeptides appear to constitute a typical membrane leader peptide - not included in this family, while the remainder of the molecule is predicted to be primarily hydrophilic in character. F plasmid TraF and TraH are required for F pilus assembly and F plasmid transfer, and they are both localized to the outer membrane in the presence of the complete F transfer region, especially TraV, the putative anchor.	6.06387e-51
NZ_LS398551.1\|WP_109234694.1\|809224_809959_+\|hypothetical-protein	gnl\|CDD\|378820	pfam12146, Hydrolase_4, Serine aminopeptidase, S33. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.	0.000924844
NZ_LS398551.1\|WP_174190495.1\|800822_801278_-\|hypothetical-protein	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	6.91782e-23
NZ_LS398551.1\|WP_109234698.1\|822279_824520_-\|conjugal-transfer-protein-TraG-N-terminal-domain-containing-protein	gnl\|CDD\|369594	pfam07916, TraG_N, TraG-like protein, N-terminal region. The bacterial sequences found in this family are similar to the N-terminal region of the TraG protein. This is a membrane-spanning protein, with three predicted transmembrane segments and two periplasmic regions. TraG protein is known to be essential for DNA transfer in the process of conjugation, with the N-terminal portion being required for F pilus assembly. The protein is thought to interact with the periplasmic domain of TraN to stabilize mating-cell interactions.	4.40978e-24
NZ_LS398551.1\|WP_109234696.1\|812546_815384_+\|AAA-family-ATPase	gnl\|CDD\|274289	TIGR02768, conjugal_transfer_protein_TraA, Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.	3.05148e-108

>NZ_LS398551.1|WP_082304340.1|817215_818319_+|toprim-domain-containing-protein
MTIIAEGAETALSLQQSGIKGNIIASARISNLRNYSPFSGEKIIIAADNDSKNSITNNTVIKAAKTLEMKGAITCIVKPPENGDFNNLLQSCGEQSIRDIIEPEITKLTKAVETTKLTQTENNSIEKQNDITNVKELYNKSSSLYYLKQEEEAKLEAIVVNKFLENHTGIYSAKIFNNSNLRANMVFDEETQKSWPALTIFVKNEAGEITGAKILTLNSKTCNKADVAEKSVGTISGSFAEIAQQNLKYSPVTIITKDIETALTIWQARVEGKILCAIEAENLQNYNPGPKEKIILAVKNDVNTEKAKKVLEDKEAVVCTVKNDFNNVLKTQGLYAVRNIISPEIRKLNEKIESIQTNIQPGLCPKH
>NZ_LS398551.1|WP_109234696.1|812546_815384_+|AAA-family-ATPase
MAIQFTRIEFLTRSKGGDSCRKAAYNARTIVKNENTGIKYNFSRKKDNVYHTVLIPDYVHQDFKNIQTLMNEVERTAKKDNSQLLKDIVIALPDEKELNLEHRIELTHQIVDEMEWVQKGIGVQIDIHKPQIGDKNWHVHILLTMRRFREDGTGLGDIAVDLNPKIITVNGQKVVIKDSKMIHEIAKEETNAYFAELGLPNRVKDISKVPGKHIGNIKYIEIRNLINEVLNENELRKEAHLKIINDADVIMDSITHYKSIFTKHDVEKAVKDIPDLTAREQLVQQVFSSNRILELYHDDGESSKYFTIIEVRNEETRIIRIANKINDRVYYNDIYNLKSDIEGLANVSEEQKQALRHILLSTSGVRVLRGRAGTGKSYVLIKAHELATNRGQKVIGLAPTHKAVSELRSKGYTEVYTVKGFLYNRKKIFMQDSLIVVDEAGMVGTKAYAELFRVVRNNNCQLILAGDEKQLASIERGGMFEMLSNNFGSHVLIDIRRQSENWSREAATKFAESNILSGITLLRQNKCVKFDNTLQDSISKLIYDWSLSKFKLHEKLVITVRNKDVDILNSSIRSLLKANGTLQGTEYRRSIAGRKESYMAGDRIVFQKSDKDLQIQNSEFATLTSVNKNEFVAKTDAGKKVSFDPSKIQFKHGYASTVYKVQGASIKDVYVLHNGVSNISSSYVAMTRHIKSLKLYCNNEATKSVNSLINQLSRPNEKSASITLKTAHDLEKERTKTTVFSKIENWFKSIINDINDRSNVNKEYYHFTAKPEQEAKVERVQQENSIKQYPFKDISTPLFMHIKEQRQYDYDVTILSAEGKTISSFQEAGIDSRMVYSSNVNNLKYYQPFQGEKILIAANNDKQNKEYVSTINEAAKVLTSKGAITSIVVPSKGEDFNEMLKNKGATAVKELMIPEIMKLINTQNVKTESEQVVKTDIAQKIGLRR
>NZ_LS398551.1|WP_109234549.1|811806_812250_-|conjugal-transfer-protein-TraD
MANLMQQKITLQQKKARLIMDEVNLKIKERKMRTRRLIEMGGLVAKAKLDHLSANTLFGAIVSLKETLTQHPNVQDHWTTIGKDIFDKEQQNKAAVILKFTSEPDENTKRHIRLHGLKWNSFRQEWCGHVKDIEALKNGLLNVQYKL
>NZ_LS398551.1|WP_109234695.1|810415_811471_-|tetratricopeptide-repeat-protein
MLTDKYFNKWNSFFKLRKYQEAIKNYDVAIKCNPDFIEAYMNKGIALRELGQYQKAIEIFDTAIRYEPDFAKAYYAKGISLYELGQYQEAIKNFDIAIKYQPDFAEAYVNKGMALKALGQHQKAIEIFDTAIRYEPNLAEAYYSKGLSLYELGQHQEAIKHYDTAIRYRPNDAEAYYSKGLSLHELGHHQEAIRNFDTAIRYRPDDADAYHAKGFSLDELGKYQEAIENYDIAIQYDSTNLDIYINRGVALNELGHHQEAIKNYDIAIKYKPDFAVAYHAKGNALKKLEKLLEAIENYDQAIRYRPNYADPYNSKGTALCILEQYQEAIENFDLAIKYKPDFSDTYNANLG
>NZ_LS398551.1|WP_109234694.1|809224_809959_+|hypothetical-protein
MKILYFDFYDELRKRQVPVSLYLPEKASNPLPTIVFGPGYQGLEGLTEEELLKRYKCKQYTYLAEYFTAKGYAFVSIQHDVFGDVDGLEKVDLNTIQDEARRHLYIRGEANILFALAQLEQQNLPLCLDNLILSGHSNGGDIAKYFVNQHPDLVHCVILFDARRARLRPISPLPVLMFEADDTTTDVGVISEPVQENNAMRANLDLTVIKPSGALHESYMDGEITEPLKKKIFSALDWFLESVA
>NZ_LS398551.1|WP_109235182.1|807621_807885_-|conjugal-transfer-protein-TraD
MNRLSLHPNVQNHWTTIGKDIFDKEQQNKAAVILKFTSEPDENTKRHIRLHGLKWNSFRQEWCGHVKDIESLKNALLNVQYSIELVV
>NZ_LS398551.1|WP_047220712.1|804930_805506_+|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MINFYSESLLNKLFETNVRFNTEIDLDKVEKAIFYAQKYHGQQKRDTGELYYTHPLEVARMVGYYSFETDTIITAILHDTLEDTTLTKEKIVKVFGRKIAEQVSDLTRIKDNKKISSREMIQTFYRQNKTELLLIKLFDRFHNIQTVSIKPYEKRQEIILETQQEFIPLAEYLKLPKIAIELNKYCELYAT
>NZ_LS398551.1|WP_047220853.1|803972_804830_+|HAMP-domain-containing-histidine-kinase
MKEKKKTINKWMVQIPPIPITLMNGESENIDEYMEIITKLRKAKYQVEVAESLKEYCTDLIQEIKYRFNIATSEIVRLASEIMLNDSENKDKLKTILNRSTNLQEYCNDVVYTLRSEIENENLCLKKFSIQKLVKNAVRRLEDIAKEKDIKINCNFQYKMKDIVIGNSDHLQAILSQLIGSVIRFNHSCQVIITVHLFTVKNYIKSDNILQFRIHDTGSGISKEKLGNIKAKLAHFDLVRDYPLMLESGLWFVNYLINQLNGEMEIESEKDKFTTITCNIPVQLF
>NZ_LS398551.1|WP_047220301.1|803222_803951_+|HAMP-domain-containing-histidine-kinase
MPIQDEGQNKINKLTEKLSTEGINSTTIKQIDAELQKLYFQLEKSGQVSIKLIEWIQYFRRIVNDYNKKKINIIASLNGIIFLFRQYIASTNIRVETFNIEPLINNTVIRMRKNFENENINLNVQNDIKPILIGDSFRIKAVISQLIGSAVINSSKNSKIIVNVNQNSEILQFTVQNIGLSTSKEKLERINAELENTNLVMYQELGEGLAFIKHLTHQMKGNLRVKERNNYVTFSFDVPTIV
>NZ_LS398551.1|WP_174190495.1|800822_801278_-|hypothetical-protein
MHYLKGEETGIYYIDSTKLTICHNKRTSSNRVFNKISKIDKSSYGWLLVFKLHLIINNIAEQVSDFTSVRNNKKISAMEMIQTFYRQNKTELLLIKLFERFHNIQTVSIKPYEKRQEIILETQQEFIPLAEYLKLPKIAIELNKYCELYAT
>NZ_LS398551.1|WP_109234697.1|819363_821118_-|type-IV-secretion-system-DNA-binding-domain-containing-protein
MNFQNQGNFTRGSQLFAHKLRMFGQGSTNVFIIGLGLSIFWIICRLYQKVFLSSLYYFAIERYVQLKLAIGEHFYDIDQIGIKFYSLRFKKWMHLNAQDFLHEFYTSQHGFKIHQLWEFLINSALLEGLIVFAIGVIISIVFFTAQGKKTIIKAKIRGADFVGYRCLAKMLKSAKKASKIRFGGLPLVKNSERLHILITGTTGTGKTNMLNELLPQIRLHKDRAIIVDTTGAFTDRFFDSKCDKLLNPFEKNSEQWLPWNDCFEAADFHDIASSFSNYTPKLDDFFAKNAELVLSEALKLYQDDKDIIKLIHTIIYSDNRQFAKAFRNTAVSGIISESALETSAGIQSTLGKNITSLQYLKPGGSFSIKEWFSNSNETGWLFITANPNQRATLCPLISAWISIAIKALMCRNPNHDNKNMWFILDELPALQKVSSLPVALAESRKYGGCFVAGLQNIHQLEAIYGAAECASMLDLFNSKFIFRVSDQVTAYKSALTLGEQEIIETQENLSYGSNTMRDGVNMNNVERKKLLVMPSEIMNLPDLTCYVKLAGNFPITKLTMQLQNLNTAFVCEYKLLKKLKLVEY
>NZ_LS398551.1|WP_109235183.1|821121_822264_-|tetratricopeptide-repeat-protein
MKNIYKLVTIIISTLILLNADVIVAKQIVQQNIVKDENILATEYFNIGSSFLKLKKYQEAIENYDITIKYDPSYASAYNSKGIALHYLSKYQEAIKNYNIATKYKPDFVEAYNNKAVSHRKIGKNEEAVILCNLAIKYKPDYAEAYINKGASLNDLGQYEEAIENFDIAIKYNSSYPEAYYNKGIALMNLGQFPEAIENYNLAIKYRLDYAEAYLNKGIPQIFLGQFPEAIESFDLAIKYDHNNVNAYYNKGYVLALLDKDAEAIENCNIAIKYDKNCVEAYRVKGTIFAKLGKHQEAIKNYDIAIKSKPNFAEGYLEKGISLVKLEEYAKAKENFNLAIKYMPNLISGGEAILKTAKKLENFALANELEQKLQILKKYS
>NZ_LS398551.1|WP_109234698.1|822279_824520_-|conjugal-transfer-protein-TraG-N-terminal-domain-containing-protein
MFGAKAVAKIRDVQIQDSITLTNTKEFLRQCFMKPYIIGNILGKKAAAQQTNDIIGFIEQNIPNNFGIYYREPSNLGISFKTCRQATPLIKAAIHKELNEGLLTKFAAAIGVQSDQSSMLSQRLKVMTGDTLKYLQREQQDIHEWMKQAMLLNANRESYDDWREKFSLSRIYPNLVSMHAIRGLFQKSFSYLVAGEMAAHMMPILQSVFFALVVSMIFIVFPMGLLPGGYNILKTWILLIIWVSSWPVFFTIIHCLGMISLSSKSGAFGSDYGLNMLSQGSFAEMILYSYATFQMLASSIPMLSWSVINACAHATANLASQFSPIQVASSLGSNIVDNNLSMDNYSIGNRTISQQNLAPSLDMTDSIINYGSHKIIIGNNGEQFVIQTVHSLETNFRSSALLQTGYQNQFVSSQSMLNSLTQKEANLISTGNSMAIDIGRRLTHDEALSIGLTESEYQALQIVSSDSESFSQHTGSSHRKTSGTNVEVGSGMLIIKGGVSGGNTEEETQGNLANQQQSHSEALSKIQSAVQEGKFSSTNSEVQSLSKNLNANLSEQQSIGQEIAKTKQEMEQLSYSMNYVFQNSITIDRNINELVLNEIIAQNPEIRSKEQAARWAKDHSAEAEKIAFEVAQINNEIPKDLNNHINDGNFLHEQDLQSNFYDNVKKLKTKAQTINLNDSSNEMHSQNIEHTFSDNEKIKNLDRISDSIKNKTQEIQKKFSDTTDSTFLMAGKQALENLGITKKDKS
>NZ_LS398551.1|WP_047220792.1|825707_826406_-|conjugal-transfer-protein-TraF
MSRLLMFMILISHLSTVDASPTGFLWYNDKHGHELDESSSKLICNAHDHRIEELKEQFNRAQRIALDNPTLENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINANEPANSLHKKLYQEKSEQKNDSKLKNIAKNWGLILQVKQDCLLCKAFMPIVQGFANKYAFQLLAVSKNNELLNKLNPEHVVPVLYSVASDGKKIYSVARGIISENKIIDNILAIDRYYHKLETR
>NZ_LS398551.1|WP_047220090.1|826776_827160_-|conjugal-transfer-protein
MVIRVMMLMVLLFVNNANAFFLDKQKTFIFVSFSMSDEALKSYFADSQKAGTQLVMRGLINNSFIQTKNKTMELGISFDIDPGLFEQYKIDVVPVIVIDDEKRGLTKKLTSHIPLAIALEIMENNTP
>NZ_LS398551.1|WP_047220791.1|827182_828085_-|TraU-family-protein
MGRFVNPITDVCWKCLFPITIAGFKVVSSSMPDTNASGRLICLCPKPGIPVPIPGIPVGFWEPVRLVDVTKSPMCMVSLGGLSFGSATQKGMKDEAEGNAFYHIHWYVYSMIYWLEILLDFICLEMAAVDIAYLTEFDPLWSDDAKSAILNSETLLFQNVAAYQACIADCMSCSAGLLASDYAFWCAECQGMLYPFTETAAAHNGGVGTSVLMVSKFMAKMHRQLMLWGYYGYKGLCAKYPMPIIKKSQYRLQMTYSIPETKSCKSIGQTEAIWQAGKEFPVNGEDFGYLIWRKRDCCLL
>NZ_LS398551.1|WP_047220723.1|829278_829608_-|hypothetical-protein
MKFLLLLLGCMSLTSFFYRSTFDCKIPKGLKCKSLYEIKNMVAQGAFDIDNLEKVEASKTKSKRRCILCYRQAKAVQGVDVVNTSPKKPKKYLINLFKSKQSQGEHKHT
>NZ_LS398551.1|WP_109234699.1|830971_831298_-|hypothetical-protein
MFIYQKSRLNMLKPTFEIQWNNVVVGLLIIITACVFSFEPALADTLEGQLNKIDGLFSGKLKTIGISSATILSSIWAVARGNIKLAGVMVAIGVILGFYLVNCQWYEN
>NZ_LS398551.1|WP_109235168.1|831441_831918_-|hypothetical-protein
MSIRVLRFMIGFIALVNVNNIYAVEYELEADNLLKLEISDSGPTRINLKDEKINDILMYPQNASEVVVHESGFLFIVPREEENKVYLTVIGEYKTIQDLMLIFTPKTPNPVMLVNAATKIEEKDNSKQNNTNLFSNDLNTKELTAKLFKKQSRNTKKK
>NZ_LS398551.1|WP_012460929.1|832481_832817_-|hypothetical-protein
MRNLMLKLRLKVIMQNQKLCWALSRPLKYMGLSIDEWGVVLAGVAPGIVLLNSRHAKLGLAFMVGGIALCYCFKKFKKVSENFLLKSFLVAKGLLPAPLGYSRLLGKKVGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LS398551_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LS398551_3

1699729-1699902

Orphan

Consensus_repeat	Method
AGGCATAGCTAAAGGNAT	CRT

4 spacers

The CRISPR arrays of NZ_LS398551_3

>merge|NZ_LS398551|3|1699729-1699902|CRT
AGGCATAGCTAAAGGTATAGAGATTGGTGAGACTAAAGGCATAGCTAAAGGTATAAAGATTGGTGAGACTAAAGGCATAGCTAAAGGCATAGCTAAAGGTGTAGAGATTGGTGAGACTAAAGGCATAGCTAAAGGCAGAGCTGAAGGCAGAGCTGAAGGCATAGCTGAAGGCAT

>NZ_LS398551|3|1|1699729-1699902|CRT
AGGCATAGCTAAAGGTAT	AGAGATTGGTGAGACTAA
AGGCATAGCTAAAGGTAT	AAAGATTGGTGAGACTAA
AGGCATAGCTAAAGGCAT	AGCTAAAGGTGTAGAGATTGGTGAGACTAA
AGGCATAGCTAAAGGCAG	AGCTGAAGGCAGAGCTGA
AGGCATAGCTGAAGGCAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LS398551.1\|WP_082303900.1\|1687106_1687634_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_109234932.1\|1692402_1692858_-\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_LS398551.1\|WP_109234937.1\|1705614_1706916_-\|conjugal-transfer-protein-TraH	unknown	unknown	gnl\|CDD\|368759
NZ_LS398551.1\|WP_109234540.1\|1690652_1691228_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NZ_LS398551.1\|WP_109234942.1\|1711651_1712035_-\|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC	unknown	unknown	gnl\|CDD\|370610
NZ_LS398551.1\|WP_109234935.1\|1700050_1701805_-\|type-IV-secretion-system-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|313610
NZ_LS398551.1\|WP_174190486.1\|1712057_1713035_-\|TraU-family-protein	unknown	unknown	gnl\|CDD\|377717
NZ_LS398551.1\|WP_109234936.1\|1701810_1702950_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_LS398551.1\|WP_047220172.1\|1685815_1686628_-\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	unknown	unknown	gnl\|CDD\|273146
NZ_LS398551.1\|WP_109234938.1\|1706912_1707629_-\|conjugal-transfer-protein-TraF	unknown	unknown	gnl\|CDD\|372692
NZ_LS398551.1\|WP_047220173.1\|1685263_1685812_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_047220174.1\|1684571_1685216_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_LS398551.1\|WP_174190469.1\|1713035_1713209_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_109234931.1\|1691348_1692335_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_LS398551.1\|WP_155377060.1\|1688455_1688596_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS398551.1\|WP_109234940.1\|1708311_1709715_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_LS398551.1\|WP_109234941.1\|1709966_1711655_-\|conjugal-transfer-protein-TraN	unknown	unknown	gnl\|CDD\|369160
NZ_LS398551.1\|WP_109235204.1\|1697791_1698886_+\|toprim-domain-containing-protein	unknown	unknown	gnl\|CDD\|274285
NZ_LS398551.1\|WP_109234933.1\|1693152_1695954_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274289
NZ_LS398551.1\|WP_109234939.1\|1707640_1708201_-\|DUF4065-domain-containing-protein	unknown	unknown	gnl\|CDD\|226128

Protein	Function_ID	Function_description	E-value
NZ_LS398551.1\|WP_109235204.1\|1697791_1698886_+\|toprim-domain-containing-protein	gnl\|CDD\|274285	TIGR02760, conjugative_transfer_relaxase_protein_TraI, conjugative transfer relaxase protein TraI. This protein is a component of the relaxosome complex. In the process of conjugative plasmid transfer the realaxosome binds to the plasmid at the oriT (origin of transfer) site. The relaxase protein TraI mediates the single-strand nicking and ATP-dependent unwinding (relaxation, helicase activity) of the plasmid molecule. These two activities reside in separate domains of the protein.	4.65883e-13
NZ_LS398551.1\|WP_109234941.1\|1709966_1711655_-\|conjugal-transfer-protein-TraN	gnl\|CDD\|369160	pfam06986, TraN, Type-1V conjugative transfer system mating pair stabilisation. TraN is a large cysteine-rich outer membrane protein involved in the mating-pair stabilisation (adhesin) component of the F-type conjugative plasmid transfer system. TraN is believed to interact with the core type IV secretion system apparatus through the TraV protein.	6.04414e-108
NZ_LS398551.1\|WP_109234540.1\|1690652_1691228_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	1.28612e-37
NZ_LS398551.1\|WP_109234942.1\|1711651_1712035_-\|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC	gnl\|CDD\|370610	pfam09673, TrbC_Ftype, Type-F conjugative transfer system pilin assembly protein. This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins is heterogeneous.	1.62398e-20
NZ_LS398551.1\|WP_109234935.1\|1700050_1701805_-\|type-IV-secretion-system-DNA-binding-domain-containing-protein	gnl\|CDD\|313610	pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.	0
NZ_LS398551.1\|WP_174190486.1\|1712057_1713035_-\|TraU-family-protein	gnl\|CDD\|377717	pfam06834, TraU, TraU protein. This family consists of several bacterial TraU proteins. TraU appears to be more essential to conjugal DNA transfer than to assembly of pilus filaments.	1.84532e-122
NZ_LS398551.1\|WP_109234936.1\|1701810_1702950_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	6.41116e-21
NZ_LS398551.1\|WP_047220172.1\|1685815_1686628_-\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	gnl\|CDD\|273146	TIGR00571, DNA_adenine_methylase, DNA adenine methylase (dam). All proteins in this family for which functions are known are DNA-adenine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The DNA adenine methylase (dam) of E. coli and related species is instrumental in distinguishing the newly synthesized strand during DNA replication for methylation-directed mismatch repair. This family includes several phage methylases and a number of different restriction enzyme chromosomal site-specific modification systems. [DNA metabolism, DNA replication, recombination, and repair].	7.02242e-50
NZ_LS398551.1\|WP_109234938.1\|1706912_1707629_-\|conjugal-transfer-protein-TraF	gnl\|CDD\|372692	pfam13728, TraF, F plasmid transfer operon protein. TraF protein undergoes proteolytic processing associated with export. The 19 amino acids at the amino terminus of the polypeptides appear to constitute a typical membrane leader peptide - not included in this family, while the remainder of the molecule is predicted to be primarily hydrophilic in character. F plasmid TraF and TraH are required for F pilus assembly and F plasmid transfer, and they are both localized to the outer membrane in the presence of the complete F transfer region, especially TraV, the putative anchor.	1.49946e-52
NZ_LS398551.1\|WP_047220174.1\|1684571_1685216_+\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	8.54069e-23
NZ_LS398551.1\|WP_109234931.1\|1691348_1692335_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	7.30938e-48
NZ_LS398551.1\|WP_109234932.1\|1692402_1692858_-\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	6.36351e-18
NZ_LS398551.1\|WP_109234940.1\|1708311_1709715_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	2.90443e-32
NZ_LS398551.1\|WP_109234937.1\|1705614_1706916_-\|conjugal-transfer-protein-TraH	gnl\|CDD\|368759	pfam06122, TraH, Conjugative relaxosome accessory transposon protein. The TraH protein is thought to be a relaxosome accessory component, also necessary for transfer but not for H-pilus synthesis within the conjugative transposon.	2.59508e-68
NZ_LS398551.1\|WP_109234933.1\|1693152_1695954_+\|AAA-family-ATPase	gnl\|CDD\|274289	TIGR02768, conjugal_transfer_protein_TraA, Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.	3.06441e-113
NZ_LS398551.1\|WP_109234939.1\|1707640_1708201_-\|DUF4065-domain-containing-protein	gnl\|CDD\|226128	COG3600, GepA, Uncharacterized phage-associated protein [Function unknown].	1.00409e-16

>NZ_LS398551.1|WP_109235204.1|1697791_1698886_+|toprim-domain-containing-protein
MAEGAETALSLQQSGIKGNIIASAGISNLTNYSPFPGEKIIIAADNDSKNSITNNTVIKAAKMLEMKGAITCIVKPPENGDFNNLLQSCGDQSIRDIIEPEITKLTKAVETTKLTQTENNSIEKQNDITNIKELYNKSSSLYYSKQKEEAKVEAIVVNKYLENHTGIYSSKIFNNPNLRANMVFDEETQKSWPALTIFVKNDKDEITGAKILALNSKTCNKADIPEKSVGTISGSFAEIAQQNSKYSPVTIITKDIETALTIQQAGVEGKILCAIEAENLQNYNPGPKEKIILAVKNDVNTEKAEKVLEDKGAVVCTVKNDFNNVLKTQGLYAVRNIISPEIRKLNEKIESIQTNIQPGLCPKH
>NZ_LS398551.1|WP_109234933.1|1693152_1695954_+|AAA-family-ATPase
MAIKFARIEFLRRSEGGDSCRKAAYNARTIVKNKQTGIRYNFSRKKDNVYHTVLIPDYVNQDFKNIQTLMNEVERTETRENSKLLKDIVIALPDEKELNLEHRIELTHRIVDAMEWVQNGLGVQIDIHKPQIGDKNWHVHILVTTRRFKENGEELGDKAVDLEAKFITVKGQWRIIKDHKMIHEIAKEETNAYFAELGLPYRVDETSEVPGKHIGPRRIRNLINEVLNENELRKEAHLKIINDADVITDSITHYKSIFTKQDVEKAVKDIPDLTAREQLVQKVLSSNRILELYHDDGESSKYFTTIEVRNEETRIIRIANKINDQVYYNNIYNLKSDIEGLANVSEEQKQALRHILLSTSGVRVLRGRAGTGKSYVLAKAHKLATNRGQKVIGIAPTHKAVSELRSKGYTEVYTVKGFLYNRKKIFMQDSLIVVDEAGMVGTKAYAELFRVVRNNNCQLILAGDEKQLASIERGGMFEILSNIFGSHVLVNIRRQSENWSREAAMEFAESNILSGITLLRQNNCVRFDNTLQDSMSKLIYNWSLSKFKPHEKLVITVRNKDVDILNSSIRSLLKANGTLQGKEYRRSIAGREESYMVGDRIVFQTNDKDLQIQNSEFATLTSVSKNKFIAKTDAGKKVSFDPSKIQFKHGYASTVYKVQGASIKDVYVLHNGVSNISSSYVAMTRHIENLKLYCNKEATKSINSLIKQLSRPNEKSASITLKTAHDLEKERTKTTVFSKIENWFKSIINDINDRSNVNKEYYHFTAKPEEEAKVEKVQLKDISTPLFMHIKEQRQYDYDVTILSAEGKTISSFQEAGIDSRMVYSSNVNNLKYYQPFQGEKILIAANNDKQNKEYVSTINEAAKVLTSKGAITSIIVPSEGEDFNEMLKNKGAVAVKGLMIPEIMKLINTQNVKTEPEQIVKADIAPKIRIRR
>NZ_LS398551.1|WP_109234932.1|1692402_1692858_-|conjugal-transfer-protein-TraD
MANLMQQKITLQQKKAKLIMDEVNLKIKERKMRTRRLIEMGGLVAKAKLDHLSTNTLFGAIVSLKETLTQHPNVQDHWTTIGKDIFDKEQQNKAAVILKFSSEPDENTKRHIRLHGLKWNSFRQEWCGHVKDIEALKNGLLNVQYSIELVV
>NZ_LS398551.1|WP_109234931.1|1691348_1692335_+|Rpn-family-recombination-promoting-nuclease/putative-transposase
MHLSRFLDPKNDVAFKKIFGSEKNKDILIHFLNDILLFEGNREITEVEFLGTILDADIASKKESIVDVLCKDKNGAQYIIEMQVDPTQGFEKRAQYYAAKAYGRQPNRGKEGKYSDLKEVIFIAIADYKLFPNKEDYISRHVILDKKTYEHDLKDFSFTFIELPKFKKDRVEELNDITEKWCYFFKHAKETTLDGYNKIIGEDLIIKRAYEALDQFNWSEDELITYEQELKRIWDNKAVEDYKLERAKAEGKAEGKAEGKAEGKAEGKAEGKAEGKAEGIKLGEAKGKAEAKKDFAIKLLKSELSVETIAEYTDLSIQEVLNLKNSVK
>NZ_LS398551.1|WP_109234540.1|1690652_1691228_+|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MIDFYSESLLNKLFETNVRFNTEIDLDKVEKAIFYAQKYHGQQKRDTGELYYTHPLEVAYMVSDYSFETDTIITAILHDTIEDTTLTKEKIGQEFGHNIAEQVSDLTRIKDNKKISSREMIQTLYNRNKTELLLIKLFDRFHNIQTVSIKPYEKRQEIILETQQEFIPLAEYLKLPEIAIELNKYCELYAT
>NZ_LS398551.1|WP_155377060.1|1688455_1688596_+|hypothetical-protein
MAQWQLEIKEDLNSIEKKDFDLVNTALDFYILDIMGRFKDVLEPDV
>NZ_LS398551.1|WP_082303900.1|1687106_1687634_+|hypothetical-protein
MIMYRRYFEQLSDLGKKSIDFLFKTEKTNKSLIVVGETDDQNFNITQVARAYENQGNGQVNGNRFGHFHLAEYVNYDHPVSYNTLYLVDDFGDNKKQLKSQMAEQQKKSIGGLEKIDSERAKVLIIVSNDLDENSKNELQEFAEDQKLNNYYEQTHILNLDQFEEFLSGDLGVER
>NZ_LS398551.1|WP_047220172.1|1685815_1686628_-|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase
MSIAISNEPKPFLHWVGGKRRIVNKLIEHLPSGPYYNYYEPFLGGGALFFQIRHLFKQCFLSDINLDLITSYHAVKKNPNEVNRLLNLYHKNHSENYYYKIRDNYYSNHPNDITAKFIYLNKYSFRGIYRLNRDGTSAQTFSDKRYLKLHICSRINKCSNLLAGVSICAMDFSFIEPQQNDFVYFDPPYHQSGERFYTRVPFDKKEQIRLRDFVYELNNKGVKIMLSNNNTTFIKDLYKDFFITHIGVTYSINEQRNLVNELIITNYKTY
>NZ_LS398551.1|WP_047220173.1|1685263_1685812_+|hypothetical-protein
MNVLKSLLQPCYAVILAFVVLSSPSICTANNNVNFNASKGGIDTSQFYIKFSTGIVTNYDTLEAGIGYRLDRHRMDVRLGFMCHHNCRDNFIQGNYYYNIIEGNKASIFVTGGLVSAFNSDSGTGIDLGVGTTINLSRDTYLDGVGTTINLSRDTYLDIECSTMANYRPLPIHIRFGLRVHI
>NZ_LS398551.1|WP_047220174.1|1684571_1685216_+|ankyrin-repeat-domain-containing-protein
MILKSKTKYTLHSAIQDGDIKKVKQLINKDSTLVNSKYKNGTTALSVALKYKNLPIAEILLSNGANVNAQDNDGHTALHLVVDTIQVYYEFFEKYPTYCNDHIALLLKYNADVNIENNQGNTPLSDAVECKCVEPLAIMLKHNSTGINKKYDEGETLLHIAVRNKIIDIIQLLIDYGADIDAKDDNGMTTIDYAAKSGNADIFNFLTEQWVPWY
>NZ_LS398551.1|WP_109234935.1|1700050_1701805_-|type-IV-secretion-system-DNA-binding-domain-containing-protein
MNFQNQGNFTRGSQLFAHKLRMFGQGSTNVFIIGLGLSIFWIICRLYQKVCLSSLYYFVIERYVQLKLAIGEHFYDIDQIGIKFYSLRFKKWMHLNAQDFLHEFYTGQHGFKIQQLWEFLINSALLEGLIVFAIGVIISIVFFTAQGKKTIIKAKIRGADFVECKCLSKMLKSAKKASKICFGGLPLVKNSERLHILITGTTGTGKTNMLNELLPQIRLHKDRAIIVDTTGAFIDRFFDSKCDKLLNPFEKNSEQWLPWNDCFEAADFHDIASSFSNYTPKLDDFFAKNAELVLSEALKLYKDDKDIIKLIHTIIYSDNRQFAKAFRNTAVSGIISESALETSAGIQSTLGKNITSLQYLKPGGSFSIKEWFSNSNETGWLFITANPNQRATLCPLISAWISIAIKALMCRNPNYDNKNMWFILDELPALQKVSSLPVALAESRKYGGCFVAGLQNIHQLEAIYGAAECASMLDLFNSKFIFRVSDQVTAYKSALTLGEQEIIETQENLSYGSNTMRDGVNMNNVERKKILVMPSEIMNLPDLTCYVKLAGNFPITKLTMQLQNLNTAFVWGYKLLKKLKLVEY
>NZ_LS398551.1|WP_109234936.1|1701810_1702950_-|tetratricopeptide-repeat-protein
MKNAYKKLAIILSLVLLNTAAVAAEQSIQQDLIQDRAVLAKEYLNIGSSFLRLKKYQEAIKNYDIAIKYDPSHASAYNSKGIALNNLEKPKEAIENFDLAIKYNPRFAEAYNNKAISYGKLGKDKEAIVLCDLAIKYKPNYVTAYNNKGASLAILGQYEEAIENYDIAIKYNSSYPEAYYNKGIALMRLGYIQEAIENYDIAIRYRPNYSEAYYNKGFTLAFLGQLQKAIEHFDLAIKYDPNDATAYCNKGYVLSMLKRYSEAIESCNLAIKYNLNCAEAYYRRGIIFEKLGKHQDAIKNYDIAIKHKPNFAENYLEKGISLVSLGQYLKAQENFNLAIKYMPNLIAEYEATIKRLTEFKNFTIAKDYEQKLQILKKYS
>NZ_LS398551.1|WP_109234937.1|1705614_1706916_-|conjugal-transfer-protein-TraH
MSIRIRVYAITMLLLLQAPVSLAWNIENVFQGMSVNVTRSGSYQDQAAGYYAAGGLSARTSQTSFQPFAITPPSLNMSCSGIDAYLGSFSVISGEELVQLMKNIGSQAKVYAFSLGLKTFAPQIENALKDLRNLAMEMNQFAKGDCELTKALFATALPKNWAMREAVCRDIQSQSGFDYFAAGKKCRNDLAQKQALRQAQNKDSELMLDDYNIFTKAAAKVGIPSDMRDSIMSMTGTIVVTNNNVHFYDSLAQDEKSWISHLKGGESASIYSCDNVSCLHPSLQRNITILPEKSYAGKAKQQLKNLKINFENNSEFTDSEIAFLSSIGDIFPIYDYIILESISGVTILDSSSELIASYTLVQHLKEVITEIRRAVTSLGAKQVSNEHLERYLKELNRVQLFANEKWTSLQTDASRIDKRARLIEQHLIAKEKS
>NZ_LS398551.1|WP_109234938.1|1706912_1707629_-|conjugal-transfer-protein-TraF
MNAIHLSVIIVLFGYLSMELATANSLPTGFLWYNDKHGHEPNNSTSKLMSGTHDHRIEELKEQFNRAQRIALDNPTLENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINAHEPANSLHRKLYQEKSEQENDSKLKNIAKNWGLILQVKQDCLLCKAFMPIVQGFANKYAFQLLAVSKNNELLNKLNPKHIVPVLYLVASDGKKIYSVARSIISEDKIIDNILAIDRYYHKLETR
>NZ_LS398551.1|WP_109234939.1|1707640_1708201_-|DUF4065-domain-containing-protein
MTIQQKGELLSCFDVASYFLVLVDREAGDVITQLKLQKLVYFAQGVHLALFDKPLFKEDIEAWENGPVVWHLRSIFGGFEANAIPAPGEIDFSIYTRQQKELIYKIYSSYGEHTASYLRNLTHLHSILQQAIIRPSRVITKEEMREFFKNHIKNIEDYLLPISKKDTAEIVNAEDQWWMNYDSVVP
>NZ_LS398551.1|WP_109234940.1|1708311_1709715_-|tetratricopeptide-repeat-protein
MKFVKYITAILLLTLLNTTIASKRNNNQPVQQKLIHDKAILAEKHFYVGISFLELNKYQEAMKNFDLAIKYKLNYAEAYYNKGNCLAELGQFQKAIESYNLAIKYNPNHADAYYNKGNCLAELGQFQKAIENYNLAIKYNPNHADAYYNKGLCLGKLEQYKKAIENFDLAIKYNPNYAKAYYNKGVCLNKLEQYKEAIENYDLAIKYNPNDAKAYYNKGLCLNELEQYKEAMENFNLAIKYNPNDADAYYMKGVCLNELEQYKKAIESFNLAIKYNPNDANAYYNKGVCLDKLGQYKEAIENFDLAIKYNPNDTNAYYNKGVCLDKLGQFQEAIENFDLAIKYNPNDAEAYYNKGVCLCKSGQFQEAIENYDLAIKYNPNHANAYYNKGVCLCKSGQFQEAIENYDLAIKYNPNHAYAYYNKGGCLYKLGQYQKAIENFDLAIKYDPNNGTLYKLINIFKQNAGIKK
>NZ_LS398551.1|WP_109234941.1|1709966_1711655_-|conjugal-transfer-protein-TraN
MRLLSILTLITLNISSCIASMQSSYNEASNYNVNLGNSSNTQELFHQGSNVNYPNNDEDLSYHGRNQLGTESGAMLFQAENSKNNALTQHNINDQNYMIANSMRIESDPLSALDSSNFVTQTSTTNTEIIQSCTEGSKFNIELIRELNVECKLENVWLPWQNRQMEFATEKIKENHSNWLKSRSDVYDESGSQIYCLVDDPEAIERQMKRAIANRLGASTQHIGRNFLLEVNEKICILHYDYRDKTQELRKVAEYWQVLNPELEQLTESNECYEVNRINYESGDRVFFDKFKVNRPYWKQKIVFSCTSDPKDGCKHLKIQNCELKNSTCQKSVANICLLWQHDYSCSTEKQTMLHSSLRNNSIFCLGGNCNTPTIIPNRDIAKVAHLAMLNQMSKDIKTNPVSVFSGKHRKCKKDVFSFLNCCSSMTGWGRDIGLSQCKSKEQELALYRKKGYCYYIGTYCSSRIPILGICLARKSTYCCFQSKLARIFQEEARKQLKIDFGTPECPNCRGLTVKELQKVDFTKINMDELFGDILTKAQNSMNKDIIAGIKDKVHRMQQSHH
>NZ_LS398551.1|WP_109234942.1|1711651_1712035_-|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC
MVIRVMMLMVLLFVNNANAFFLDKQKTFIFVSFSMSDEALKSYFTDSQKAGAQLVMRGLINNSFTQTKNKTMELGISFDIDPSLFEQYKIDVVPVIVIDDKKRGLTKKLTGHIPLAIAIEIMNENTP
>NZ_LS398551.1|WP_174190486.1|1712057_1713035_-|TraU-family-protein
MKELVILFAIVMSITANNCYAAAGCVGRFVNPITDVCWKCLFPITIAGFKVVSSSMPDTNASGRLICLCPKPGIPVPVPGIPVGFWEPVRLVDVTKSPMCMVSLGGLSFGSATQKGMKDEAEGSAFYHIHWYVYPVIYWLEILLDFICLEMAAVDIAYLTEFDPLWSDDAKSAILNPETLLFQNVAAYQACIADCMSCSAGLLASDYAFWCAGCQGMLYPFTGTAAAHNGGVGTSVLMVSKFMAKMHRQLMLWGYYGYKGLCGKYPMPIIKKSQYRLQMTYPIPETKSCKSIGQTEAIWQAGREFPVNGEDFGYLIWRKRDCCLL
>NZ_LS398551.1|WP_174190469.1|1713035_1713209_-|hypothetical-protein
MKSWKLQQLEQDLVKIVNNTLRGEIQEIVNPGGETLYLIPGNRYPKLLRKISSMQAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	303947-303976	0	1.0
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	793186-793215	0	1.0
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	969344-969373	0	1.0
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	1096838-1096867	0	1.0
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	1580380-1580409	0	1.0
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	1810657-1810686	0	1.0
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	1844935-1844964	0	1.0
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	303947-303976	0	1.0
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	793186-793215	0	1.0
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	969344-969373	0	1.0
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	1096838-1096867	0	1.0
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	1580380-1580409	0	1.0
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	1810657-1810686	0	1.0
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	1844935-1844964	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	401515-401532	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	461386-461403	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	755597-755614	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	1381121-1381138	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	1443826-1443843	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	1699711-1699728	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	1920140-1920157	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	2219003-2219020	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	2219039-2219056	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	2372222-2372239	0	1.0
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	2372258-2372275	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140592-140609	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140628-140645	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140640-140657	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140652-140669	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140688-140705	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140700-140717	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	218341-218358	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	269956-269973	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	269968-269985	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	303872-303889	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	303920-303937	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	330190-330207	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	368559-368576	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	401455-401472	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	401467-401484	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	461410-461427	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	461422-461439	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	607495-607512	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	755573-755590	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	755621-755638	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	793147-793164	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	793159-793176	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	819204-819221	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	819216-819233	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	969305-969322	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	969317-969334	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1096691-1096708	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1096703-1096720	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1096715-1096732	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1096727-1096744	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1096811-1096828	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1194199-1194216	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1228986-1229003	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1240629-1240646	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1381085-1381102	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1381097-1381114	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1443790-1443807	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1528453-1528470	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1810582-1810599	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1810630-1810647	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1844974-1844991	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1920092-1920109	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1920104-1920121	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1920116-1920133	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1920164-1920181	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1920176-1920193	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2219063-2219080	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2295814-2295831	0	1.0
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2372306-2372323	0	1.0
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	303899-303928	1	0.967
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	1096790-1096819	1	0.967
NZ_LS398551_1	1.1\|269905\|30\|NZ_LS398551\|CRISPRCasFinder	269905-269934	30	NZ_LS398551.1	1810609-1810638	1	0.967
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	303899-303928	1	0.967
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	1096790-1096819	1	0.967
NZ_LS398551_2	2.1\|819153\|30\|NZ_LS398551\|CRISPRCasFinder	819153-819182	30	NZ_LS398551.1	1810609-1810638	1	0.967
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	140736-140753	1	0.944
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	607471-607488	1	0.944
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	718247-718264	1	0.944
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	1194139-1194156	1	0.944
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	1194175-1194192	1	0.944
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	1240653-1240670	1	0.944
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	1240689-1240706	1	0.944
NZ_LS398551_3	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	NZ_LS398551.1	2295790-2295807	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	303896-303913	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	303944-303961	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	793183-793200	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	969341-969358	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	1096787-1096804	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	1096835-1096852	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	1580395-1580412	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	1810606-1810623	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	1810654-1810671	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	1844950-1844967	1	0.944
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	2372246-2372275	1	0.967
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140604-140621	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140664-140681	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	140712-140729	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	303968-303985	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	368547-368564	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	401479-401496	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	486623-486640	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	718271-718288	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	755633-755650	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	793207-793224	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	969365-969382	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1096739-1096756	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1096751-1096768	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1096763-1096780	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1228974-1228991	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1381145-1381162	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1443802-1443819	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1443850-1443867	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1580419-1580436	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1699891-1699908	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1699903-1699920	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1810678-1810695	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1837302-1837319	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1844926-1844943	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1844986-1845003	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1920188-1920205	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2218979-2218996	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2372282-2372299	1	0.944
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2372294-2372311	1	0.944
NZ_LS398551_3	3.2\|1699783\|18\|NZ_LS398551\|CRT	1699783-1699800	18	NZ_LS398551.1	1920212-1920229	2	0.889
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	401515-401544	2	0.933
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	461374-461403	2	0.933
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	755597-755626	2	0.933
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	1381121-1381150	2	0.933
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	1443826-1443855	2	0.933
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	1920140-1920169	2	0.933
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	2218991-2219020	2	0.933
NZ_LS398551_3	3.3\|1699819\|30\|NZ_LS398551\|CRT	1699819-1699848	30	NZ_LS398551.1	2219027-2219056	2	0.933
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	31274-31291	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	63548-63565	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	63596-63613	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	148288-148305	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	148300-148317	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	148312-148329	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	148324-148341	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	148372-148389	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	148420-148437	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	148468-148485	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	164323-164340	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	164335-164352	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	164347-164364	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	164359-164376	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	164371-164388	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	311408-311425	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	311480-311497	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	339898-339915	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	339946-339963	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	339958-339975	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	339970-339987	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	360999-361016	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	361011-361028	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	368523-368540	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	486635-486652	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	718283-718300	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	726013-726030	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	765101-765118	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	765113-765130	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	765173-765190	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	765185-765202	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	765197-765214	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	799941-799958	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	807347-807364	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	807419-807436	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	985045-985062	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	985093-985110	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	985141-985158	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	985153-985170	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1106775-1106792	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1106787-1106804	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1106799-1106816	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1106847-1106864	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1106859-1106876	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1106907-1106924	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1106919-1106936	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1218732-1218749	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1218780-1218797	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1218852-1218869	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1218864-1218881	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1369221-1369238	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1443874-1443891	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1454294-1454311	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1454342-1454359	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1454354-1454371	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1454366-1454383	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1545390-1545407	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1545402-1545419	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1692092-1692109	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1692164-1692181	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1837290-1837307	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1881106-1881123	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1881118-1881135	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1930510-1930527	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1930522-1930539	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1930570-1930587	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1930582-1930599	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	1930642-1930659	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2123194-2123211	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2123206-2123223	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2286505-2286522	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2286517-2286534	2	0.889
NZ_LS398551_3	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	NZ_LS398551.1	2395680-2395697	2	0.889

1. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 303947-303976, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

2. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 793186-793215, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

3. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 969344-969373, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

4. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 1096838-1096867, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

5. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 1580380-1580409, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

6. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 1810657-1810686, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

7. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 1844935-1844964, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

8. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 303947-303976, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

9. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 793186-793215, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

10. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 969344-969373, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

11. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 1096838-1096867, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

12. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 1580380-1580409, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

13. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 1810657-1810686, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

14. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 1844935-1844964, mismatch: 0, identity: 1.0

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagggctgaaggtataaagcttggtgagac	Protospacer
******************************

15. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 401515-401532, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

16. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 461386-461403, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

17. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 755597-755614, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

18. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 1381121-1381138, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

19. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 1443826-1443843, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

20. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 1699711-1699728, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

21. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 1920140-1920157, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

22. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 2219003-2219020, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

23. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 2219039-2219056, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

24. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 2372222-2372239, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

25. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 2372258-2372275, mismatch: 0, identity: 1.0

agagattggtgagactaa	CRISPR spacer
agagattggtgagactaa	Protospacer
******************

26. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140592-140609, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

27. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140628-140645, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

28. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140640-140657, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

29. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140652-140669, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

30. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140688-140705, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

31. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140700-140717, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

32. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 218341-218358, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

33. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 269956-269973, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

34. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 269968-269985, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

35. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 303872-303889, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

36. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 303920-303937, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

37. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 330190-330207, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

38. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 368559-368576, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

39. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 401455-401472, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

40. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 401467-401484, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

41. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 461410-461427, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

42. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 461422-461439, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

43. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 607495-607512, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

44. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 755573-755590, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

45. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 755621-755638, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

46. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 793147-793164, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

47. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 793159-793176, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

48. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 819204-819221, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

49. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 819216-819233, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

50. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 969305-969322, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

51. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 969317-969334, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

52. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1096691-1096708, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

53. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1096703-1096720, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

54. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1096715-1096732, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

55. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1096727-1096744, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

56. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1096811-1096828, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

57. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1194199-1194216, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

58. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1228986-1229003, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

59. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1240629-1240646, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

60. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1381085-1381102, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

61. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1381097-1381114, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

62. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1443790-1443807, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

63. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1528453-1528470, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

64. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1810582-1810599, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

65. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1810630-1810647, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

66. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1844974-1844991, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

67. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1920092-1920109, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

68. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1920104-1920121, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

69. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1920116-1920133, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

70. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1920164-1920181, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

71. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1920176-1920193, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

72. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2219063-2219080, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

73. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2295814-2295831, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

74. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2372306-2372323, mismatch: 0, identity: 1.0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

75. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 303899-303928, mismatch: 1, identity: 0.967

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagagctgaaggtataaagcttggtgagac	Protospacer
***.**************************

76. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 1096790-1096819, mismatch: 1, identity: 0.967

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagagctgaaggtataaagcttggtgagac	Protospacer
***.**************************

77. spacer 1.1|269905|30|NZ_LS398551|CRISPRCasFinder matches to position: 1810609-1810638, mismatch: 1, identity: 0.967

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagagctgaaggtataaagcttggtgagac	Protospacer
***.**************************

78. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 303899-303928, mismatch: 1, identity: 0.967

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagagctgaaggtataaagcttggtgagac	Protospacer
***.**************************

79. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 1096790-1096819, mismatch: 1, identity: 0.967

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagagctgaaggtataaagcttggtgagac	Protospacer
***.**************************

80. spacer 2.1|819153|30|NZ_LS398551|CRISPRCasFinder matches to position: 1810609-1810638, mismatch: 1, identity: 0.967

cagggctgaaggtataaagcttggtgagac	CRISPR spacer
cagagctgaaggtataaagcttggtgagac	Protospacer
***.**************************

81. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 140736-140753, mismatch: 1, identity: 0.944

agagattggtgagactaa	CRISPR spacer
agagattggtgaaactaa	Protospacer
************.*****

82. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 607471-607488, mismatch: 1, identity: 0.944

agagattggtgagactaa	CRISPR spacer
agagatcggtgagactaa	Protospacer
******.***********

83. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 718247-718264, mismatch: 1, identity: 0.944

agagattggtgagactaa	CRISPR spacer
agagatcggtgagactaa	Protospacer
******.***********

84. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 1194139-1194156, mismatch: 1, identity: 0.944

agagattggtgagactaa	CRISPR spacer
agagatcggtgagactaa	Protospacer
******.***********

85. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 1194175-1194192, mismatch: 1, identity: 0.944

agagattggtgagactaa	CRISPR spacer
agagattggtgaaactaa	Protospacer
************.*****

86. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 1240653-1240670, mismatch: 1, identity: 0.944

agagattggtgagactaa	CRISPR spacer
agagattggtgaaactaa	Protospacer
************.*****

87. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 1240689-1240706, mismatch: 1, identity: 0.944

agagattggtgagactaa	CRISPR spacer
agagatcggtgagactaa	Protospacer
******.***********

88. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to position: 2295790-2295807, mismatch: 1, identity: 0.944

agagattggtgagactaa	CRISPR spacer
agagatcggtgagactaa	Protospacer
******.***********

89. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 303896-303913, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

90. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 303944-303961, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

91. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 793183-793200, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

92. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 969341-969358, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

93. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 1096787-1096804, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

94. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 1096835-1096852, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

95. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 1580395-1580412, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

96. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 1810606-1810623, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

97. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 1810654-1810671, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

98. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 1844950-1844967, mismatch: 1, identity: 0.944

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagactaa	Protospacer
**** *************

99. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 2372246-2372275, mismatch: 1, identity: 0.967

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctaaaggtatagagattggtgagactaa	Protospacer
**********.*******************

100. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140604-140621, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

101. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140664-140681, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

102. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 140712-140729, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

103. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 303968-303985, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagggctga	Protospacer
************.*****

104. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 368547-368564, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

105. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 401479-401496, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

106. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 486623-486640, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcaaagctga	Protospacer
***********.******

107. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 718271-718288, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagttga	Protospacer
**************.***

108. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 755633-755650, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

109. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 793207-793224, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagggctga	Protospacer
************.*****

110. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 969365-969382, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagggctga	Protospacer
************.*****

111. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1096739-1096756, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcaaagctga	Protospacer
***********.******

112. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1096751-1096768, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcaaagctga	Protospacer
***********.******

113. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1096763-1096780, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcaaagctga	Protospacer
***********.******

114. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1228974-1228991, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcatagctga	Protospacer
*********** ******

115. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1381145-1381162, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

116. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1443802-1443819, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

117. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1443850-1443867, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

118. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1580419-1580436, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcatagctga	Protospacer
*********** ******

119. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1699891-1699908, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcatagctga	Protospacer
*********** ******

120. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1699903-1699920, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcatagctga	Protospacer
*********** ******

121. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1810678-1810695, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagggctga	Protospacer
************.*****

122. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1837302-1837319, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcaaagctga	Protospacer
***********.******

123. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1844926-1844943, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagggctga	Protospacer
************.*****

124. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1844986-1845003, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcatagctga	Protospacer
*********** ******

125. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1920188-1920205, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcaaagctga	Protospacer
***********.******

126. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2218979-2218996, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

127. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2372282-2372299, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagctga	Protospacer
****.*************

128. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2372294-2372311, mismatch: 1, identity: 0.944

agctgaaggcagagctga	CRISPR spacer
agctgaaggcatagctga	Protospacer
*********** ******

129. spacer 3.2|1699783|18|NZ_LS398551|CRT matches to position: 1920212-1920229, mismatch: 2, identity: 0.889

aaagattggtgagactaa	CRISPR spacer
aaagcttggtgagattaa	Protospacer
**** *********.***

130. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 401515-401544, mismatch: 2, identity: 0.933

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctgaaggtatagagattggtgagactaa	Protospacer
****.*****.*******************

131. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 461374-461403, mismatch: 2, identity: 0.933

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctgaaggtatagagattggtgagactaa	Protospacer
****.*****.*******************

132. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 755597-755626, mismatch: 2, identity: 0.933

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctgaaggtatagagattggtgagactaa	Protospacer
****.*****.*******************

133. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 1381121-1381150, mismatch: 2, identity: 0.933

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctgaaggtatagagattggtgagactaa	Protospacer
****.*****.*******************

134. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 1443826-1443855, mismatch: 2, identity: 0.933

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctgaaggtatagagattggtgagactaa	Protospacer
****.*****.*******************

135. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 1920140-1920169, mismatch: 2, identity: 0.933

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctgaaggtatagagattggtgagactaa	Protospacer
****.*****.*******************

136. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 2218991-2219020, mismatch: 2, identity: 0.933

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctgaaggtatagagattggtgagactaa	Protospacer
****.*****.*******************

137. spacer 3.3|1699819|30|NZ_LS398551|CRT matches to position: 2219027-2219056, mismatch: 2, identity: 0.933

agctaaaggtgtagagattggtgagactaa	CRISPR spacer
agctgaaggtatagagattggtgagactaa	Protospacer
****.*****.*******************

138. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 31274-31291, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

139. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 63548-63565, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

140. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 63596-63613, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agccgaaggcaaagctga	Protospacer
***.*******.******

141. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 148288-148305, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

142. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 148300-148317, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

143. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 148312-148329, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

144. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 148324-148341, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

145. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 148372-148389, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

146. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 148420-148437, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

147. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 148468-148485, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

148. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 164323-164340, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

149. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 164335-164352, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

150. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 164347-164364, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

151. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 164359-164376, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

152. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 164371-164388, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

153. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 311408-311425, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

154. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 311480-311497, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

155. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 339898-339915, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

156. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 339946-339963, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

157. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 339958-339975, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

158. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 339970-339987, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

159. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 360999-361016, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

160. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 361011-361028, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

161. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 368523-368540, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagccga	Protospacer
****.**********.**

162. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 486635-486652, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agccgaaggcaaagctga	Protospacer
***.*******.******

163. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 718283-718300, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agttgaaggcatagctga	Protospacer
**.******** ******

164. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 726013-726030, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

165. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 765101-765118, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

166. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 765113-765130, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

167. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 765173-765190, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

168. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 765185-765202, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

169. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 765197-765214, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

170. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 799941-799958, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

171. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 807347-807364, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

172. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 807419-807436, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

173. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 985045-985062, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

174. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 985093-985110, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

175. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 985141-985158, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

176. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 985153-985170, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

177. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1106775-1106792, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

178. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1106787-1106804, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

179. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1106799-1106816, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

180. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1106847-1106864, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

181. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1106859-1106876, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

182. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1106907-1106924, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

183. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1106919-1106936, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

184. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1218732-1218749, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

185. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1218780-1218797, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

186. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1218852-1218869, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

187. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1218864-1218881, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

188. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1369221-1369238, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

189. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1443874-1443891, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctaaaggcagagccga	Protospacer
****.**********.**

190. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1454294-1454311, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

191. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1454342-1454359, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

192. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1454354-1454371, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

193. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1454366-1454383, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

194. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1545390-1545407, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

195. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1545402-1545419, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

196. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1692092-1692109, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

197. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1692164-1692181, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

198. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1837290-1837307, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agccgaaggcaaagctga	Protospacer
***.*******.******

199. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1881106-1881123, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

200. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1881118-1881135, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

201. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1930510-1930527, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

202. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1930522-1930539, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

203. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1930570-1930587, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

204. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1930582-1930599, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

205. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 1930642-1930659, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

206. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2123194-2123211, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

207. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2123206-2123223, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

208. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2286505-2286522, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

209. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2286517-2286534, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

210. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to position: 2395680-2395697, mismatch: 2, identity: 0.889

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

31131 : 106125

Streptococcus_phage(23.08%)

integrase,transposase

attL 28212:28271|attR 52261:52365

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
28212:28271	attL	NA	NA	NA	NA
WP_047220086.1\|31131_32034_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.3e-86	58.0
WP_052692494.1\|32155_32551_-	HD domain-containing protein	NA	NA	NA	NA
WP_109234426.1\|33106_34924_+	ribonucleoside-diphosphate reductase subunit alpha	A0A0K1LMZ5	Caulobacter_phage	2.5e-188	54.5
WP_109234427.1\|34946_35936_+	ribonucleotide-diphosphate reductase subunit beta	M1I8A4	Pelagibacter_phage	2.9e-98	53.5
WP_109234428.1\|36764_36944_+	hypothetical protein	NA	NA	NA	NA
WP_052692496.1\|37270_37909_+\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	1.8e-16	27.9
WP_047220088.1\|37911_38382_+	peroxiredoxin	NA	NA	NA	NA
WP_047220089.1\|39501_40404_+	TraU family protein	NA	NA	NA	NA
WP_047220090.1\|40426_40810_+	conjugal transfer protein	NA	NA	NA	NA
WP_047220091.1\|41175_41688_-	hypothetical protein	NA	NA	NA	NA
WP_052692497.1\|41827_42040_-	hypothetical protein	NA	NA	NA	NA
WP_155377052.1\|42033_42384_-	hypothetical protein	NA	NA	NA	NA
WP_047220092.1\|42398_42611_-	hypothetical protein	NA	NA	NA	NA
WP_047220093.1\|42951_44583_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_109234429.1\|44934_47517_-	hypothetical protein	NA	NA	NA	NA
WP_047220095.1\|47557_47740_-	hypothetical protein	NA	NA	NA	NA
WP_047220096.1\|48159_48615_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_082303863.1\|55567_56260_-	conjugal transfer protein TraF	NA	NA	NA	NA
52261:52365	attR	NA	NA	NA	NA
WP_047220101.1\|56307_56820_-	hypothetical protein	NA	NA	NA	NA
WP_109234431.1\|59760_62610_-	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	4.6e-08	23.9
WP_045915406.1\|62906_63362_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234432.1\|63429_64380_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.3e-84	64.1
WP_109234433.1\|64500_65076_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	5.7e-06	38.6
WP_047220200.1\|67134_67938_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	4.5e-17	25.7
WP_047220199.1\|68036_69293_+	hypothetical protein	NA	NA	NA	NA
WP_047220198.1\|69351_69789_+	hypothetical protein	NA	NA	NA	NA
WP_047220197.1\|69842_70124_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_109234436.1\|71938_73387_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.2e-70	36.6
WP_109234437.1\|73395_75111_-	hypothetical protein	NA	NA	NA	NA
WP_011945032.1\|77086_77467_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	8.9e-08	33.0
WP_109234438.1\|77463_79026_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_109234439.1\|82426_83629_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_109234440.1\|83735_84773_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_109234441.1\|84832_85666_+	VacJ family lipoprotein	NA	NA	NA	NA
WP_108839807.1\|85662_86253_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_109234442.1\|86280_87483_+	coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_108839805.1\|87523_88036_+	hypothetical protein	A0A067XRB3	Caulobacter_phage	1.1e-32	47.7
WP_109234443.1\|88095_88821_+	DNA repair protein RecO	NA	NA	NA	NA
WP_109234444.1\|89696_90563_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.7e-20	28.8
WP_064591574.1\|92353_92677_-	DUF721 domain-containing protein	NA	NA	NA	NA
WP_012461710.1\|92715_93396_-	DNA repair protein RadC	NA	NA	NA	NA
WP_012461711.1\|93644_94016_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_109234445.1\|94039_94561_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_109234446.1\|94564_96691_+	elongation factor G	A0A1S5SF82	Streptococcus_phage	1.1e-59	27.9
WP_109234447.1\|96956_98432_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_011945048.1\|102859_103081_-	cold-shock protein	NA	NA	NA	NA
WP_109234448.1\|103968_104160_-\|transposase	transposase	NA	NA	NA	NA
WP_081257863.1\|104333_104471_-	hypothetical protein	NA	NA	NA	NA
WP_109234449.1\|104817_105684_+	folate-binding protein YgfZ	NA	NA	NA	NA
WP_109234450.1\|105858_106125_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

112804 : 181106

Streptococcus_phage(26.67%)

tRNA,integrase,terminase,transposase

attL 120222:120281|attR 182011:182122

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234454.1\|112804_114226_-\|terminase	phage terminase large subunit	A0A088FB00	Idiomarinaceae_phage	1.3e-56	33.8
WP_109234455.1\|114555_115176_+	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_109234456.1\|115175_115736_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_109234457.1\|115745_116846_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_109234458.1\|118824_119619_+	exodeoxyribonuclease III	NA	NA	NA	NA
120222:120281	attL	NA	NA	NA	NA
WP_109234459.1\|121360_122680_+\|integrase	site-specific integrase	Q9T1R0	Acyrthosiphon_pisum_secondary_endosymbiont_phage	6.9e-15	26.0
WP_041621693.1\|122735_123071_+	hypothetical protein	NA	NA	NA	NA
WP_045913844.1\|123070_123622_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234460.1\|123618_124095_+	hypothetical protein	NA	NA	NA	NA
WP_108839945.1\|124458_124791_+	hypothetical protein	NA	NA	NA	NA
WP_109234461.1\|124829_126152_+	conjugal transfer protein	NA	NA	NA	NA
WP_045917530.1\|126151_126472_+	hypothetical protein	NA	NA	NA	NA
WP_108840164.1\|126452_128942_+	TraC family protein	NA	NA	NA	NA
WP_109234462.1\|128938_129598_+	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_174190469.1\|129688_129862_+	hypothetical protein	NA	NA	NA	NA
WP_174190470.1\|129862_130840_+	TraU family protein	NA	NA	NA	NA
WP_109234463.1\|130862_131246_+	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_109234464.1\|131242_132934_+	conjugal transfer protein TraN	NA	NA	NA	NA
WP_109234465.1\|132930_133629_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234466.1\|133625_134927_+	conjugal transfer protein TraH	NA	NA	NA	NA
WP_109234467.1\|134926_137551_+	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_109234468.1\|137563_138703_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234469.1\|138706_140461_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109234470.1\|140470_141526_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109235160.1\|141577_142672_-	toprim domain-containing protein	NA	NA	NA	NA
WP_109234471.1\|144512_147314_-	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	1.0e-07	24.4
WP_109234472.1\|147610_148066_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234473.1\|148133_149228_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	6.8e-85	64.9
WP_109234474.1\|149348_149936_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	J9Q7H7	Salmonella_phage	5.6e-09	36.4
WP_109234475.1\|149977_150472_-	ATP-binding protein	NA	NA	NA	NA
WP_109235161.1\|150490_150958_-	ATP-binding protein	NA	NA	NA	NA
WP_082304280.1\|151445_151922_-	ATP-binding protein	NA	NA	NA	NA
WP_109234476.1\|152460_153129_-	ATP-binding protein	NA	NA	NA	NA
WP_047220945.1\|153143_153845_-	histidine kinase	NA	NA	NA	NA
WP_109234477.1\|153909_154188_-	hypothetical protein	NA	NA	NA	NA
WP_109234478.1\|154554_155364_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.2e-19	27.4
WP_109234479.1\|155367_155871_-	hypothetical protein	NA	NA	NA	NA
WP_109234480.1\|155918_156563_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	5.7e-15	33.3
WP_109234481.1\|156597_157173_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A292GI44	Xanthomonas_phage	3.5e-08	30.4
WP_109234482.1\|157405_158854_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	5.1e-72	36.9
WP_109234483.1\|158862_160578_-	hypothetical protein	NA	NA	NA	NA
WP_109234484.1\|164204_165131_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	7.5e-85	61.7
WP_082303921.1\|165251_165839_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	3.4e-06	29.0
WP_109234485.1\|165880_166375_-	ATP-binding protein	NA	NA	NA	NA
WP_047220834.1\|166393_166861_-	sensor histidine kinase	NA	NA	NA	NA
WP_082304036.1\|167339_167828_-	ATP-binding protein	NA	NA	NA	NA
WP_047220473.1\|168055_168757_-	histidine kinase	NA	NA	NA	NA
WP_045917470.1\|169998_170808_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.4e-18	26.7
WP_082304126.1\|170911_171319_-	hypothetical protein	NA	NA	NA	NA
WP_047221043.1\|171365_172010_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	3.1e-13	31.3
WP_109234486.1\|172047_172623_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	5.1e-07	30.4
WP_109234436.1\|172856_174305_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.2e-70	36.6
WP_109235162.1\|174313_175669_-	hypothetical protein	NA	NA	NA	NA
WP_109235163.1\|177900_178545_+	SCO family protein	NA	NA	NA	NA
WP_174190467.1\|179266_179428_-	hypothetical protein	NA	NA	NA	NA
WP_174190490.1\|180791_181106_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
182011:182122	attR	NA	NA	NA	NA

DBSCAN-SWA_3

204380 : 270106

Bodo_saltans_virus(22.22%)

tRNA,holin,integrase,transposase

attL 204309:204336|attR 216148:216175

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
204309:204336	attL	NA	NA	NA	NA
WP_109234494.1\|204380_205247_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	4.7e-20	28.4
WP_109234495.1\|205821_206916_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_109234496.1\|207596_209360_+	hypothetical protein	NA	NA	NA	NA
WP_109234497.1\|211043_211595_-	conjugal transfer protein	NA	NA	NA	NA
WP_052695985.1\|212909_213296_+	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_109234498.1\|213436_213685_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_109234499.1\|214321_215215_+	lipase	NA	NA	NA	NA
WP_174190468.1\|215787_216180_-	DUF4102 domain-containing protein	NA	NA	NA	NA
216148:216175	attR	NA	NA	NA	NA
WP_109234500.1\|216176_217044_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.1e-20	28.8
WP_162551757.1\|218488_219220_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_047220287.1\|219844_220891_+	hypothetical protein	NA	NA	NA	NA
WP_047220286.1\|221441_222038_+	hypothetical protein	NA	NA	NA	NA
WP_109234502.1\|222074_223628_-	SurA N-terminal domain-containing protein	NA	NA	NA	NA
WP_109234503.1\|223707_224457_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_047220285.1\|224462_224759_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_109234504.1\|225507_227091_-\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_047220295.1\|227231_227780_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_012461848.1\|227742_228288_+	demethoxyubiquinone hydroxylase family protein	NA	NA	NA	NA
WP_047220284.1\|228364_229057_+	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	4.3e-16	33.7
WP_047220283.1\|229108_229882_+\|holin	phosphatidylcholine/phosphatidylserine synthase	NA	NA	NA	NA
WP_012461851.1\|229931_230417_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
WP_109234505.1\|230413_230662_+	hypothetical protein	NA	NA	NA	NA
WP_109234506.1\|230699_233528_+	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_109234507.1\|233719_235396_-	NADH-quinone oxidoreductase subunit D	NA	NA	NA	NA
WP_045919133.1\|235464_236343_-	succinate--CoA ligase subunit alpha	A0A2K9L1S3	Tupanvirus	3.3e-21	31.5
WP_047220281.1\|236357_237518_-	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_047220280.1\|237574_238783_-	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_109234508.1\|239137_239725_-	DUF1013 domain-containing protein	NA	NA	NA	NA
WP_047220278.1\|239852_243056_-\|tRNA	isoleucine--tRNA ligase	A0A2I2L3Y0	Orpheovirus	3.4e-177	34.4
WP_047220277.1\|243094_243700_-	COQ9 family protein	NA	NA	NA	NA
WP_012461860.1\|243846_244053_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_052692516.1\|244081_244591_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_047220276.1\|244688_245930_+	MFS transporter	NA	NA	NA	NA
WP_047220275.1\|246155_246878_+	DUF5394 family protein	NA	NA	NA	NA
WP_047220274.1\|246960_248214_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_052692515.1\|248302_249481_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_047220273.1\|249520_251731_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_011944309.1\|252064_252334_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_047220272.1\|252357_253266_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_012461870.1\|254510_254951_-	helix-turn-helix transcriptional regulator	K4K6E9	Caulobacter_phage	1.3e-13	39.4
WP_082303941.1\|257079_257361_+	hypothetical protein	NA	NA	NA	NA
WP_109234509.1\|257364_258174_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	9.1e-18	26.4
WP_109234510.1\|259288_260146_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_109234511.1\|260246_260822_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	2.5e-06	31.1
WP_109234512.1\|260942_262001_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.5e-84	64.1
WP_045915406.1\|262068_262524_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_082304340.1\|267967_269071_+	toprim domain-containing protein	NA	NA	NA	NA
WP_047221036.1\|269122_270106_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_4

278294 : 340730

Bodo_saltans_virus(15.38%)

integrase,transposase

attL 282319:282378|attR 287889:288181

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234518.1\|278294_279162_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	29.1
WP_109234519.1\|279814_280198_-	conjugal transfer protein	NA	NA	NA	NA
WP_109234520.1\|280220_281123_-	TraU family protein	NA	NA	NA	NA
WP_047220982.1\|282316_282616_-	hypothetical protein	NA	NA	NA	NA
282319:282378	attL	NA	NA	NA	NA
WP_109234521.1\|283052_284336_+\|integrase	site-specific integrase	Q9T1R0	Acyrthosiphon_pisum_secondary_endosymbiont_phage	4.3e-14	25.9
WP_047220595.1\|284427_284763_+	hypothetical protein	NA	NA	NA	NA
WP_109234522.1\|285311_285788_+	hypothetical protein	NA	NA	NA	NA
WP_108839640.1\|285932_286259_+	hypothetical protein	NA	NA	NA	NA
WP_109234523.1\|286301_287621_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234524.1\|287620_287950_+	conjugal transfer protein	NA	NA	NA	NA
WP_052692627.1\|289632_290295_-	PRANC domain-containing protein	A0A2H4X2Q6	Flamingopox_virus	1.8e-08	23.8
287889:288181	attR	NA	NA	NA	NA
WP_109234527.1\|291895_292279_+	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_109234528.1\|292275_293964_+	conjugal transfer protein TraN	NA	NA	NA	NA
WP_109234531.1\|295553_296114_+	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	3.4e-24	40.4
WP_109234532.1\|296125_296842_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234533.1\|296838_298140_+	conjugal transfer protein TraH	NA	NA	NA	NA
WP_109234534.1\|298139_300791_+	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_109234514.1\|300813_301959_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234513.1\|301962_303717_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109234535.1\|303726_304758_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109234536.1\|304809_305904_-	toprim domain-containing protein	NA	NA	NA	NA
WP_109234537.1\|306092_307490_+	ankyrin repeat domain-containing protein	Q6VZ31	Canarypox_virus	3.1e-05	31.4
WP_109234538.1\|310670_311126_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234539.1\|311193_312240_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.9e-84	64.1
WP_109234540.1\|312360_312936_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.8e-07	30.2
WP_109234541.1\|313036_313894_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_047220301.1\|313915_314644_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_012461033.1\|314992_315133_-	hypothetical protein	NA	NA	NA	NA
WP_109234542.1\|315952_316480_-	hypothetical protein	NA	NA	NA	NA
WP_109234543.1\|317103_317916_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	5.3e-26	30.6
WP_082304126.1\|318019_318427_-	hypothetical protein	NA	NA	NA	NA
WP_109234544.1\|318473_319118_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.0e-08	28.0
WP_047220734.1\|319155_319731_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	7.4e-06	29.6
WP_109234545.1\|320147_321015_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.0e-19	33.8
WP_109234546.1\|321086_322385_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.4e-65	38.4
WP_109234547.1\|322393_323071_-	hypothetical protein	NA	NA	NA	NA
WP_162551758.1\|324191_324344_-	hypothetical protein	NA	NA	NA	NA
WP_047221052.1\|328250_328988_-	hypothetical protein	NA	NA	NA	NA
WP_109234548.1\|330068_330980_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109235164.1\|331031_332126_-	toprim domain-containing protein	NA	NA	NA	NA
WP_109234549.1\|337596_338040_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234550.1\|338376_339144_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047220228.1\|339743_340730_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.4e-84	64.1

DBSCAN-SWA_5

360255 : 451504

Tupanvirus(13.33%)

tRNA,protease,integrase,transposase

attL 365541:365594|attR 456686:456739

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234560.1\|360255_361254_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.4e-84	64.1
WP_109235167.1\|363036_364179_+	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	7.3e-05	26.8
WP_052692577.1\|364193_364991_+	toprim domain-containing protein	NA	NA	NA	NA
WP_047220718.1\|365297_365798_-	hypothetical protein	NA	NA	NA	NA
365541:365594	attL	NA	NA	NA	NA
WP_174190492.1\|366649_367744_+	toprim domain-containing protein	NA	NA	NA	NA
WP_047220714.1\|367728_368697_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109234561.1\|370613_371756_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234562.1\|375737_376454_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_047220715.1\|376458_377025_-	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_109234563.1\|378488_380177_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_047220457.1\|380173_380563_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_052692627.1\|382163_382826_+	PRANC domain-containing protein	A0A2H4X2Q6	Flamingopox_virus	1.8e-08	23.8
WP_047220982.1\|384508_384808_-	hypothetical protein	NA	NA	NA	NA
WP_109234566.1\|386059_386530_+\|integrase	site-specific integrase	B6SD79	Bacteriophage	8.4e-08	27.6
WP_012460929.1\|386621_386957_+	hypothetical protein	NA	NA	NA	NA
WP_109235168.1\|387520_387997_+	hypothetical protein	NA	NA	NA	NA
WP_109234567.1\|388140_388467_+	hypothetical protein	NA	NA	NA	NA
WP_109234568.1\|388509_389829_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234569.1\|389828_390158_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234520.1\|392603_393506_+	TraU family protein	NA	NA	NA	NA
WP_109234519.1\|393528_393912_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234570.1\|394282_394981_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234571.1\|396168_398388_+	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_047221041.1\|398414_399563_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234572.1\|399568_401290_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_109234573.1\|401333_402317_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109235169.1\|402368_403472_-	toprim domain-containing protein	NA	NA	NA	NA
WP_047220583.1\|406167_407607_-	hypothetical protein	NA	NA	NA	NA
WP_052692557.1\|408558_409269_-	AAA family ATPase	NA	NA	NA	NA
WP_082304100.1\|409258_410563_-	MobA/MobL family protein	NA	NA	NA	NA
WP_047220226.1\|410858_411314_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_047220095.1\|411733_411916_+	hypothetical protein	NA	NA	NA	NA
WP_109234429.1\|411956_414539_+	hypothetical protein	NA	NA	NA	NA
WP_047220093.1\|414890_416522_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_047220092.1\|416862_417075_+	hypothetical protein	NA	NA	NA	NA
WP_047220578.1\|417089_417713_+	hypothetical protein	NA	NA	NA	NA
WP_047220577.1\|417865_418393_+	hypothetical protein	NA	NA	NA	NA
WP_047220576.1\|418398_418974_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	3.3e-06	37.1
WP_109235170.1\|421861_422146_-	hypothetical protein	NA	NA	NA	NA
WP_162551759.1\|422506_423229_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_109234575.1\|423488_424133_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	3.0e-08	29.4
WP_109234576.1\|424170_424746_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	4.8e-05	28.9
WP_109234577.1\|426883_427429_+	peptide deformylase	E3SLL2	Synechococcus_phage	2.9e-20	42.4
WP_109234578.1\|427425_428349_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.5e-08	28.3
WP_109234579.1\|428894_431426_-	AsmA-like C-terminal region-containing protein	NA	NA	NA	NA
WP_109234580.1\|431594_432089_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_047220984.1\|432307_433264_+	malate dehydrogenase	NA	NA	NA	NA
WP_047220985.1\|433356_435723_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	8.1e-91	33.5
WP_047220987.1\|437042_437948_-	bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.5e-29	38.7
WP_109234581.1\|437944_438961_-	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	3.3e-17	27.4
WP_109234582.1\|439159_441943_+	glycoside hydrolase TIM-barrel-like domain-containing protein	A0A0B5A7K5	Paracoccus_phage	5.2e-97	28.8
WP_109234583.1\|442206_442788_-	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_109234584.1\|442981_444382_-\|protease	DegP-like serine protease TSA47	W5SAB9	Pithovirus	1.2e-06	31.1
WP_109234585.1\|444399_445266_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_109234586.1\|445289_446345_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_109234587.1\|446527_447544_+	Mrp/NBP35 family ATP-binding protein	NA	NA	NA	NA
WP_109234589.1\|450637_451504_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.0e-19	33.3
456686:456739	attR	NA	NA	NA	NA

DBSCAN-SWA_6

486420 : 494582

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234598.1\|486420_487419_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.4e-84	64.1
WP_047220712.1\|487539_488115_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	5.7e-06	38.6
WP_047220841.1\|488215_489073_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_109234599.1\|490173_490986_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	5.1e-29	33.5
WP_109234600.1\|490989_491538_-	hypothetical protein	NA	NA	NA	NA
WP_109234601.1\|491640_492285_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.0e-08	28.0
WP_109234602.1\|492322_492898_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	1.9e-06	30.4
WP_109234603.1\|493133_494582_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.0e-71	37.1

DBSCAN-SWA_7

560238 : 657268

Tupanvirus(18.75%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047220757.1\|560238_561585_-\|tRNA	glutamate--tRNA ligase	A0A2K9L594	Tupanvirus	8.9e-10	35.7
WP_109234616.1\|561764_563807_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	3.8e-97	36.2
WP_047220751.1\|563834_565088_-	MFS transporter	NA	NA	NA	NA
WP_109234617.1\|565124_567689_-	type IV secretion system protein	NA	NA	NA	NA
WP_109234618.1\|567681_570954_-	type IV secretion system protein	NA	NA	NA	NA
WP_109234619.1\|571007_574871_-	type IV secretion system protein	NA	NA	NA	NA
WP_109234620.1\|574892_577340_-	type IV secretion system protein	NA	NA	NA	NA
WP_109234621.1\|577339_579757_-	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_109234622.1\|579767_580055_-	type IV secretion system protein VirB3	NA	NA	NA	NA
WP_109234623.1\|580375_582316_-	primosomal protein N'	NA	NA	NA	NA
WP_109234624.1\|582502_584038_+\|tRNA	methionine--tRNA ligase	A0A1V0SEZ7	Hokovirus	3.0e-94	39.2
WP_109234625.1\|584050_584839_+	TatD family hydrolase	NA	NA	NA	NA
WP_012461376.1\|586967_587834_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_012461375.1\|588885_589551_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	4.2e-13	40.2
WP_082304349.1\|590860_591775_+	hypothetical protein	NA	NA	NA	NA
WP_047220574.1\|592005_592581_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	5.1e-07	30.4
WP_047221043.1\|592618_593263_+	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	3.1e-13	31.3
WP_162551759.1\|593473_594196_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_082304352.1\|594556_594841_+	hypothetical protein	NA	NA	NA	NA
WP_045917205.1\|594844_595654_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	7.4e-20	27.1
WP_109234626.1\|596028_596757_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_109234627.1\|596778_597636_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_109234628.1\|597736_598312_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	3.3e-06	37.1
WP_047220952.1\|598398_598944_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_109234629.1\|602886_603711_+	toprim domain-containing protein	NA	NA	NA	NA
WP_109235175.1\|605542_606646_+	toprim domain-containing protein	NA	NA	NA	NA
WP_047220626.1\|606697_607633_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109234630.1\|607642_609397_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_047221041.1\|609402_610551_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234571.1\|610577_612797_-	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_109234517.1\|613983_614682_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234631.1\|614678_616229_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_047220434.1\|616225_616609_-	conjugal transfer protein	NA	NA	NA	NA
WP_047220723.1\|618729_619059_-	hypothetical protein	NA	NA	NA	NA
WP_109234632.1\|619058_619241_-	conjugal transfer protein TraB	NA	NA	NA	NA
WP_109234633.1\|619324_619534_-	conjugal transfer protein TraB	NA	NA	NA	NA
WP_109234634.1\|619633_620035_-	hypothetical protein	NA	NA	NA	NA
WP_109234612.1\|621404_622272_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.3e-19	28.4
WP_109234635.1\|623254_626692_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.0e-09	22.6
WP_109234636.1\|627329_628889_-	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_047221009.1\|629062_629959_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_047221010.1\|630275_631496_+	MFS transporter	NA	NA	NA	NA
WP_109234637.1\|634141_635009_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	4.7e-20	28.8
WP_047221015.1\|635886_636225_+	hypothetical protein	NA	NA	NA	NA
WP_108883849.1\|636313_636436_-	hypothetical protein	NA	NA	NA	NA
WP_109234638.1\|636779_638648_+	hypothetical protein	NA	NA	NA	NA
WP_045916122.1\|639198_640212_-	serine/threonine dehydratase	NA	NA	NA	NA
WP_162551808.1\|640349_642701_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	4.6e-171	43.2
WP_109234640.1\|642765_643416_-	hypothetical protein	NA	NA	NA	NA
WP_109234641.1\|643545_644295_-	ComF family protein	NA	NA	NA	NA
WP_109234642.1\|644275_645313_-\|tRNA	tRNA dimethylallyltransferase	NA	NA	NA	NA
WP_109234643.1\|645382_646000_+	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	1.3e-24	43.0
WP_011944684.1\|646565_646817_+	DUF2312 domain-containing protein	A0A076YL00	Rhizobium_phage	6.7e-12	52.0
WP_082304068.1\|648403_649270_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.5e-21	29.4
WP_082304085.1\|649561_649840_+	conjugal transfer protein	NA	NA	NA	NA
WP_011944475.1\|652068_652194_-	50S ribosomal protein L36	NA	NA	NA	NA
WP_082304077.1\|653027_653330_+\|transposase	transposase	NA	NA	NA	NA
WP_109234644.1\|653526_653853_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.5e-16	46.6
WP_109234645.1\|653875_656194_-	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_109234646.1\|656206_657268_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_8

672068 : 756444

Bodo_saltans_virus(30.0%)

integrase,tRNA,transposase

attL 686224:686263|attR 739240:739279

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234648.1\|672068_672936_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	28.8
WP_047220563.1\|673639_673846_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_045916960.1\|673942_674308_+	membrane protein	NA	NA	NA	NA
WP_047220565.1\|674685_675606_-	GTPase Era	NA	NA	NA	NA
WP_109234649.1\|675602_676625_-	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_109234650.1\|676830_677910_-	peptide chain release factor 1	NA	NA	NA	NA
WP_047220238.1\|678904_680470_+	hypothetical protein	NA	NA	NA	NA
WP_047220235.1\|682151_682727_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	7.4e-06	29.6
WP_109234652.1\|683960_684407_-	hypothetical protein	NA	NA	NA	NA
WP_162551764.1\|684399_684894_-	hypothetical protein	NA	NA	NA	NA
WP_109234654.1\|684950_685982_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
686224:686263	attL	NA	NA	NA	NA
WP_109234612.1\|686474_687342_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.3e-19	28.4
WP_109234655.1\|687913_688489_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	2.5e-06	38.6
WP_109234657.1\|690547_691357_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.0e-17	25.6
WP_109234658.1\|691360_691642_-	hypothetical protein	NA	NA	NA	NA
WP_109234659.1\|692181_693201_+	reverse transcriptase	NA	NA	NA	NA
WP_045916135.1\|693922_694591_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_109234660.1\|695969_696838_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	4.2e-21	28.8
WP_052692550.1\|697062_697551_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_109234661.1\|697562_698834_-\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	1.7e-23	22.4
WP_045913338.1\|698836_699322_-	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_047220514.1\|699326_699689_-	NADH:ubiquinone oxidoreductase	NA	NA	NA	NA
WP_082304048.1\|699660_700167_-	ribonuclease HI	J9Q745	Salmonella_phage	5.3e-32	47.8
WP_109234662.1\|700166_700694_-	hypothetical protein	NA	NA	NA	NA
WP_109234663.1\|700821_701646_-	DsbA family protein	NA	NA	NA	NA
WP_012461772.1\|701777_702098_-	ferredoxin family protein	NA	NA	NA	NA
WP_047220515.1\|702102_702813_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_109234664.1\|702805_703537_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_047220528.1\|703535_704366_+	glutamine synthetase	NA	NA	NA	NA
WP_047220517.1\|707718_711372_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_047220518.1\|711878_714161_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_082304050.1\|714441_714636_+	hypothetical protein	NA	NA	NA	NA
WP_012462182.1\|716356_716905_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_047220521.1\|717473_718445_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_047220523.1\|719148_719655_-	toprim domain-containing protein	NA	NA	NA	NA
WP_109234665.1\|724569_724998_-	MobA/MobL family protein	NA	NA	NA	NA
WP_109234666.1\|725275_725731_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_047220712.1\|726954_727530_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	5.7e-06	38.6
WP_162551765.1\|730010_731579_-	hypothetical protein	NA	NA	NA	NA
WP_109234667.1\|733558_734062_-	hypothetical protein	NA	NA	NA	NA
WP_109234668.1\|734547_735189_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234669.1\|736730_737930_+\|integrase	site-specific integrase	A0A0R6PGY7	Moraxella_phage	4.6e-26	25.7
WP_012460929.1\|738050_738386_+	hypothetical protein	NA	NA	NA	NA
WP_082304027.1\|738949_739258_+	hypothetical protein	NA	NA	NA	NA
WP_109234670.1\|739392_739722_+	hypothetical protein	NA	NA	NA	NA
739240:739279	attR	NA	NA	NA	NA
WP_109234671.1\|739764_741087_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234672.1\|741086_741416_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234673.1\|741396_743886_+	TraC family protein	NA	NA	NA	NA
WP_109234674.1\|743882_744542_+	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_174190477.1\|744625_744799_+	hypothetical protein	NA	NA	NA	NA
WP_174190478.1\|744799_745777_+	TraU family protein	NA	NA	NA	NA
WP_109234675.1\|745799_746183_+	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_109234676.1\|746179_747871_+	conjugal transfer protein TraN	NA	NA	NA	NA
WP_109234677.1\|747867_748572_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234678.1\|748568_749870_+	conjugal transfer protein TraH	NA	NA	NA	NA
WP_109234679.1\|749869_752521_+	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_109234680.1\|752536_753682_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234681.1\|753687_755442_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109234682.1\|755451_756444_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_9

764982 : 836831

Bodo_saltans_virus(21.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234685.1\|764982_765957_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	3.0e-84	64.1
WP_109234686.1\|766077_766665_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	J9Q7H7	Salmonella_phage	3.1e-07	34.1
WP_045914126.1\|766706_767201_-	ATP-binding protein	NA	NA	NA	NA
WP_109235178.1\|767219_767684_-	ATP-binding protein	NA	NA	NA	NA
WP_109235179.1\|768171_768648_-	sensor histidine kinase	NA	NA	NA	NA
WP_047220780.1\|769101_769803_-	histidine kinase	NA	NA	NA	NA
WP_047220781.1\|769867_770146_-	hypothetical protein	NA	NA	NA	NA
WP_109234687.1\|770520_771330_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	3.7e-19	26.4
WP_047220782.1\|771345_772221_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_109234688.1\|772569_779136_-	hypothetical protein	Q9JMP0	Wolbachia_phage	2.6e-38	34.7
WP_045912795.1\|779113_779674_-	hypothetical protein	NA	NA	NA	NA
WP_109234689.1\|780492_780996_-	hypothetical protein	NA	NA	NA	NA
WP_109234690.1\|781042_781687_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	2.4e-13	31.9
WP_045914898.1\|781721_782297_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A292GI44	Xanthomonas_phage	4.6e-08	29.2
WP_109234691.1\|782529_783966_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.1e-73	37.6
WP_109234692.1\|783974_785690_-	hypothetical protein	NA	NA	NA	NA
WP_045917084.1\|788984_789410_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.8e-17	37.4
WP_109235180.1\|791768_793016_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_109234693.1\|793025_793997_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109235181.1\|794048_795119_-	toprim domain-containing protein	NA	NA	NA	NA
WP_047220817.1\|797864_798308_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_052692591.1\|798643_799234_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047220852.1\|799822_800701_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	E9P639	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	7.1e-85	58.1
WP_174190495.1\|800822_801278_-	hypothetical protein	NA	NA	NA	NA
WP_047220301.1\|803222_803951_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_047220853.1\|803972_804830_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_047220712.1\|804930_805506_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	5.7e-06	38.6
WP_109235182.1\|807621_807885_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234694.1\|809224_809959_+	hypothetical protein	NA	NA	NA	NA
WP_109234695.1\|810415_811471_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234549.1\|811806_812250_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234696.1\|812546_815384_+	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	3.9e-07	24.9
WP_082304340.1\|817215_818319_+	toprim domain-containing protein	NA	NA	NA	NA
WP_047221036.1\|818370_819354_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109234697.1\|819363_821118_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109235183.1\|821121_822264_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234698.1\|822279_824520_-	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_047220792.1\|825707_826406_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_047220090.1\|826776_827160_-	conjugal transfer protein	NA	NA	NA	NA
WP_047220791.1\|827182_828085_-	TraU family protein	NA	NA	NA	NA
WP_047220723.1\|829278_829608_-	hypothetical protein	NA	NA	NA	NA
WP_109234699.1\|830971_831298_-	hypothetical protein	NA	NA	NA	NA
WP_109235168.1\|831441_831918_-	hypothetical protein	NA	NA	NA	NA
WP_012460929.1\|832481_832817_-	hypothetical protein	NA	NA	NA	NA
WP_109234487.1\|833107_833974_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	4.7e-20	28.4
WP_109234700.1\|834816_835684_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.3e-19	28.4
WP_109234701.1\|836477_836831_-\|transposase	transposase	A0A2H4UV16	Bodo_saltans_virus	6.5e-05	30.0

DBSCAN-SWA_10

861231 : 928360

Bodo_saltans_virus(42.86%)

integrase,protease,tRNA,transposase

attL 906033:906092|attR 927415:927975

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162551769.1\|861231_861696_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.5e-12	38.3
WP_047220926.1\|863150_864911_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	9.7e-41	25.8
WP_047220927.1\|864894_865227_-	iron donor protein CyaY	NA	NA	NA	NA
WP_047220928.1\|866139_870255_+	hypothetical protein	NA	NA	NA	NA
WP_052692616.1\|873012_873396_+	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_012462332.1\|873426_873816_+	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_162551809.1\|874007_875798_+	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_047220932.1\|875832_876618_+	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_155377164.1\|876911_877070_+	hypothetical protein	NA	NA	NA	NA
WP_082304286.1\|877224_877437_+	conjugal transfer protein TraB	NA	NA	NA	NA
WP_047220931.1\|877467_877755_+	hypothetical protein	NA	NA	NA	NA
WP_162551770.1\|877808_878000_-	hypothetical protein	NA	NA	NA	NA
WP_109234718.1\|877993_878860_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.1e-20	28.4
WP_011945011.1\|880485_881226_+	signal peptidase I	NA	NA	NA	NA
WP_050897558.1\|881281_882022_+	ribonuclease III	A0A0P0YM82	Yellowstone_lake_phycodnavirus	1.0e-23	34.1
WP_109234719.1\|883518_884094_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	5.7e-06	37.8
WP_109234720.1\|884180_884747_-	hypothetical protein	NA	NA	NA	NA
WP_109234721.1\|884844_885300_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234722.1\|886896_887763_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	5.5e-21	29.4
WP_109234723.1\|889671_894195_-	hypothetical protein	NA	NA	NA	NA
WP_109234724.1\|894194_896648_-	virB4 protein precursor	NA	NA	NA	NA
WP_047220672.1\|896922_897939_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_047220673.1\|898019_899240_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_045917961.1\|899253_899547_+	hypothetical protein	NA	NA	NA	NA
WP_047220674.1\|899560_900862_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_045912447.1\|901091_902345_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.2e-120	53.6
WP_045916475.1\|902550_903120_+	elongation factor P	NA	NA	NA	NA
WP_109234725.1\|903116_903902_+	extragenic suppressor protein SuhB	NA	NA	NA	NA
WP_047220675.1\|904023_904725_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_082304163.1\|905600_906038_+	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_162551771.1\|905968_906118_-	hypothetical protein	NA	NA	NA	NA
906033:906092	attL	NA	NA	NA	NA
WP_109234518.1\|906663_907530_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	29.1
WP_109234726.1\|908338_909601_+	MFS transporter	NA	NA	NA	NA
WP_109234727.1\|909616_911020_+	sodium:pantothenate symporter	NA	NA	NA	NA
WP_109234728.1\|912665_912974_+	hypothetical protein	NA	NA	NA	NA
WP_109234729.1\|913508_914375_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	9.4e-21	28.8
WP_047220656.1\|914644_914980_-	hypothetical protein	NA	NA	NA	NA
WP_047220696.1\|915027_915684_-\|integrase	site-specific integrase	B6SD77	Bacteriophage	4.6e-12	27.8
WP_109234730.1\|919144_920989_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	2.2e-35	35.2
WP_109234731.1\|920972_922748_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.1e-68	36.0
WP_109234732.1\|923659_924820_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	5.5e-24	34.3
WP_012460979.1\|924860_925463_-	peroxiredoxin	NA	NA	NA	NA
WP_109234733.1\|926665_927055_+	hypothetical protein	NA	NA	NA	NA
WP_162551772.1\|927341_927500_-	hypothetical protein	NA	NA	NA	NA
WP_109234734.1\|927493_928360_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.6e-20	28.8
927415:927975	attR	NA	NA	NA	NA

DBSCAN-SWA_11

946854 : 1024978

Bodo_saltans_virus(13.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234747.1\|946854_947677_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109234748.1\|948453_949908_-	replicative DNA helicase	A0A218KST2	Xenohaliotis_phage	2.2e-62	34.2
WP_109234749.1\|950649_952161_-	histidine kinase	A0A1V0SGX0	Hokovirus	4.4e-26	34.4
WP_052692578.1\|952495_952846_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_109234750.1\|955912_956536_+	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_047220723.1\|957905_958235_+	hypothetical protein	NA	NA	NA	NA
WP_109234751.1\|959428_960331_+	TraU family protein	NA	NA	NA	NA
WP_109234527.1\|960353_960737_+	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_047220592.1\|962673_963468_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047220591.1\|963578_964145_+	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	2.0e-24	41.8
WP_109234752.1\|964149_964866_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109235184.1\|967926_969174_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_082304364.1\|971444_972413_+\|transposase	transposase	A0A1S7J231	Thermus_phage	7.8e-24	29.5
WP_162551774.1\|973094_974087_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_109234753.1\|975181_976049_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.1e-18	32.8
WP_045915087.1\|982719_983175_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_047220525.1\|983263_983839_+	hypothetical protein	NA	NA	NA	NA
WP_045915501.1\|984102_984636_-	hypothetical protein	NA	NA	NA	NA
WP_109234754.1\|984926_985913_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.4e-84	64.1
WP_082303921.1\|986033_986621_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	3.4e-06	29.0
WP_109234755.1\|986662_987157_-	ATP-binding protein	NA	NA	NA	NA
WP_109235185.1\|987175_987643_-	sensor histidine kinase	NA	NA	NA	NA
WP_047220233.1\|988837_989539_-	sensor histidine kinase	NA	NA	NA	NA
WP_047220234.1\|989603_989882_-	hypothetical protein	NA	NA	NA	NA
WP_045913641.1\|990249_991059_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	4.1e-18	26.0
WP_109234756.1\|991062_991566_-	hypothetical protein	NA	NA	NA	NA
WP_109234601.1\|991668_992313_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.0e-08	28.0
WP_047220734.1\|992350_992926_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	7.4e-06	29.6
WP_047220883.1\|993161_994610_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.7e-70	36.6
WP_109234757.1\|998685_1003611_-	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_109234758.1\|1003692_1005036_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_047220739.1\|1005061_1006000_+	tyrosine recombinase XerC	A0A0K0N6I5	Gordonia_phage	2.5e-11	34.9
WP_045912215.1\|1006033_1006465_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_012462271.1\|1006549_1007077_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.6e-39	49.7
WP_047220740.1\|1007100_1007973_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
WP_047220741.1\|1007956_1008898_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_162551775.1\|1009791_1010094_+	hypothetical protein	NA	NA	NA	NA
WP_109234759.1\|1010500_1011367_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	33.8
WP_047220742.1\|1012101_1012389_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_162551776.1\|1016262_1016727_-	ATP synthase F0 subunit B	NA	NA	NA	NA
WP_109234762.1\|1016739_1017237_-	hypothetical protein	NA	NA	NA	NA
WP_011944645.1\|1017244_1017469_-	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_109234763.1\|1017524_1018253_-	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_109234764.1\|1019603_1020278_+	queuosine precursor transporter	NA	NA	NA	NA
WP_109234765.1\|1021601_1024307_-	pyruvate, phosphate dikinase	H8YJB7	Vibrio_phage	9.0e-62	31.7
WP_146177198.1\|1024891_1024978_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1177226 : 1229124

Bodo_saltans_virus(14.29%)

tRNA,integrase,transposase

attL 1155426:1155484|attR 1208333:1208391

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1155426:1155484	attL	NA	NA	NA	NA
WP_109234804.1\|1177226_1178094_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	8.5e-22	29.1
WP_109234805.1\|1179078_1182516_-	response regulator	A0A1V0SGX0	Hokovirus	1.2e-15	22.8
WP_109234806.1\|1183278_1183692_+	hypothetical protein	NA	NA	NA	NA
WP_047221028.1\|1183997_1184300_+	hypothetical protein	NA	NA	NA	NA
WP_109234807.1\|1184516_1185146_+	hypothetical protein	NA	NA	NA	NA
WP_109234808.1\|1185708_1185990_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234809.1\|1186311_1186767_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_162551780.1\|1187042_1187471_+	MobA/MobL family protein	NA	NA	NA	NA
WP_109234811.1\|1193365_1194337_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_045919030.1\|1196125_1196455_-	hypothetical protein	NA	NA	NA	NA
WP_082304167.1\|1196454_1196940_-	conjugal transfer protein	NA	NA	NA	NA
WP_047220680.1\|1197027_1197429_-	hypothetical protein	NA	NA	NA	NA
WP_162551778.1\|1197977_1198139_-	hypothetical protein	NA	NA	NA	NA
WP_047220681.1\|1198278_1198479_-	hypothetical protein	NA	NA	NA	NA
WP_082304173.1\|1199207_1199489_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_109234812.1\|1199717_1200101_-	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_109234747.1\|1201238_1202061_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_047220685.1\|1203032_1203374_-	DUF2610 domain-containing protein	NA	NA	NA	NA
WP_047220686.1\|1203513_1204350_-	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_109234813.1\|1204513_1205863_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_012462194.1\|1206153_1207071_+	S49 family peptidase	E5AFY0	Erwinia_phage	2.1e-15	30.5
WP_162551781.1\|1209222_1209369_+	hypothetical protein	NA	NA	NA	NA
1208333:1208391	attR	NA	NA	NA	NA
WP_012462191.1\|1209869_1210085_-	hypothetical protein	NA	NA	NA	NA
WP_047220688.1\|1211836_1213078_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	1.5e-67	35.5
WP_109235193.1\|1213430_1213511_+	hypothetical protein	NA	NA	NA	NA
WP_047220689.1\|1214036_1215602_+	hypothetical protein	NA	NA	NA	NA
WP_047220690.1\|1215610_1217059_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.8e-70	36.4
WP_109234814.1\|1217988_1219035_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.5e-84	64.1
WP_109234815.1\|1219379_1221194_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047220817.1\|1221529_1221973_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_174190499.1\|1222851_1225215_+	AAA family ATPase	A0A2H4ZK82	Cryptophlebia_leucotreta_granulosis_virus	4.0e-05	23.5
WP_109235164.1\|1227054_1228149_+	toprim domain-containing protein	NA	NA	NA	NA
WP_109234816.1\|1228200_1229124_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1232620 : 1301035

Bodo_saltans_virus(15.38%)

protease,tRNA,head,transposase,tail,integrase,capsid

attL 1213789:1213831|attR 1301106:1301148

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1213789:1213831	attL	NA	NA	NA	NA
WP_047220159.1\|1232620_1233892_+\|tRNA	tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB	NA	NA	NA	NA
WP_047220158.1\|1233954_1234947_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_047220157.1\|1235188_1235758_-	hypothetical protein	NA	NA	NA	NA
WP_109234818.1\|1236898_1237345_+	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_109235195.1\|1239250_1240498_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_109234819.1\|1240507_1241479_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109234820.1\|1241530_1242628_-	toprim domain-containing protein	NA	NA	NA	NA
WP_109234821.1\|1243254_1245078_+	hypothetical protein	NA	NA	NA	NA
WP_082303913.1\|1245306_1247292_-	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	1.4e-06	27.0
WP_162551782.1\|1248045_1248360_+	hypothetical protein	NA	NA	NA	NA
WP_109234823.1\|1248415_1249564_+	radical SAM protein	A0A1B2IE34	Erwinia_phage	2.1e-12	38.6
WP_162551783.1\|1249687_1251268_+	hypothetical protein	NA	NA	NA	NA
WP_047220144.1\|1252212_1252668_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_047221078.1\|1254059_1254302_-	ATP-binding protein	NA	NA	NA	NA
WP_109234825.1\|1254417_1255285_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	5.5e-21	28.8
WP_082303909.1\|1255738_1256254_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_109234826.1\|1262237_1263105_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.6e-20	28.4
WP_012462169.1\|1266785_1267055_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_109234827.1\|1267098_1267425_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_109234828.1\|1267562_1268231_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_047220137.1\|1268335_1269085_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_047220136.1\|1269305_1270676_+	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	5.2e-42	33.5
WP_109234829.1\|1270734_1272210_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_109234830.1\|1272301_1274539_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_047220134.1\|1275595_1277275_+	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	8.4e-42	39.1
WP_047220133.1\|1277286_1277847_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_047220132.1\|1278110_1278824_+	metal ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.2e-17	29.0
WP_109234831.1\|1278804_1279593_+	metal ABC transporter permease	NA	NA	NA	NA
WP_082303888.1\|1280427_1280604_+	reverse transcriptase N-terminal domain-containing protein	A0A0U4J920	Pseudomonas_phage	1.6e-07	52.8
WP_082303886.1\|1282087_1282423_+	hypothetical protein	NA	NA	NA	NA
WP_047220129.1\|1282747_1283077_-	hypothetical protein	NA	NA	NA	NA
WP_082303883.1\|1283076_1284402_-	conjugal transfer protein	NA	NA	NA	NA
WP_109234567.1\|1284444_1284771_-	hypothetical protein	NA	NA	NA	NA
WP_047220205.1\|1284915_1285392_-	hypothetical protein	NA	NA	NA	NA
WP_041621693.1\|1285955_1286291_-	hypothetical protein	NA	NA	NA	NA
WP_109234832.1\|1286416_1287559_-\|integrase	site-specific integrase	A0A0R6PHM8	Moraxella_phage	1.8e-19	24.1
WP_047220125.1\|1287790_1287991_-	hypothetical protein	NA	NA	NA	NA
WP_162551784.1\|1288325_1288487_+	hypothetical protein	NA	NA	NA	NA
WP_109235196.1\|1289050_1289377_+	hypothetical protein	NA	NA	NA	NA
WP_109234833.1\|1293082_1294687_+	hypothetical protein	NA	NA	NA	NA
WP_011944597.1\|1295477_1295861_-	glutaredoxin family protein	A0A223FNA2	NY_014_poxvirus	1.2e-09	41.2
WP_109234835.1\|1296595_1297399_-	DUF2163 domain-containing protein	NA	NA	NA	NA
WP_047220120.1\|1297411_1298014_-	DUF2460 domain-containing protein	A0A1W6DWM9	Sphingobium_phage	2.0e-17	32.2
WP_109234836.1\|1298006_1298432_-	hypothetical protein	NA	NA	NA	NA
WP_045914454.1\|1298431_1298773_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_045916848.1\|1298774_1299320_-	hypothetical protein	NA	NA	NA	NA
WP_109234837.1\|1299353_1300469_-\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	1.1e-53	40.3
WP_045915866.1\|1300480_1301035_-\|head,protease	HK97 family phage prohead protease	I6S2W2	Marinomonas_phage	2.9e-23	43.8
1301106:1301148	attR	NA	NA	NA	NA

DBSCAN-SWA_14

1323160 : 1381956

Bodo_saltans_virus(57.14%)

integrase,tRNA,transposase

attL 1361416:1361475|attR 1393061:1393164

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234850.1\|1323160_1324129_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_109234851.1\|1324157_1324496_-	DUF167 domain-containing protein	NA	NA	NA	NA
WP_109234852.1\|1324636_1325377_+	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_047220707.1\|1325363_1326230_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_047220706.1\|1326231_1327083_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_045914431.1\|1327224_1327707_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_045914430.1\|1327710_1328202_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_047220705.1\|1328540_1329287_+	hypothetical protein	NA	NA	NA	NA
WP_155377112.1\|1331439_1331580_+	hypothetical protein	NA	NA	NA	NA
WP_047220704.1\|1332889_1333156_+\|transposase	transposase	NA	NA	NA	NA
WP_109234853.1\|1333368_1334236_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	28.8
WP_082304180.1\|1334567_1335425_+\|integrase	integrase family protein	NA	NA	NA	NA
WP_109234854.1\|1337349_1338217_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.6e-20	33.3
WP_047220698.1\|1338911_1340021_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_109234855.1\|1340253_1341597_-	DUF2748 family protein	NA	NA	NA	NA
WP_162551785.1\|1342769_1342985_-	hypothetical protein	NA	NA	NA	NA
WP_047220696.1\|1345257_1345914_+\|integrase	site-specific integrase	B6SD77	Bacteriophage	4.6e-12	27.8
WP_047220695.1\|1345961_1346297_+	hypothetical protein	NA	NA	NA	NA
WP_174190484.1\|1347221_1347398_+	hypothetical protein	NA	NA	NA	NA
WP_109234519.1\|1348400_1348784_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234857.1\|1351682_1352987_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234858.1\|1353097_1353664_+	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_109234859.1\|1353668_1354241_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234860.1\|1354886_1355754_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.5e-21	28.8
WP_162551786.1\|1355747_1355933_+	hypothetical protein	NA	NA	NA	NA
WP_109234861.1\|1355929_1357075_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234862.1\|1357277_1358145_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	3.6e-20	33.3
WP_109235198.1\|1358316_1359357_-	toprim domain-containing protein	NA	NA	NA	NA
1361416:1361475	attL	NA	NA	NA	NA
WP_162551787.1\|1365162_1366176_+	hypothetical protein	NA	NA	NA	NA
WP_047220916.1\|1366730_1367459_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_080943627.1\|1368570_1368870_+	hypothetical protein	NA	NA	NA	NA
WP_109234864.1\|1369078_1369981_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	8.7e-86	57.3
WP_047220918.1\|1370102_1370510_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	NA	NA	NA	NA
WP_047220125.1\|1370844_1371045_+	hypothetical protein	NA	NA	NA	NA
WP_109234865.1\|1371276_1372419_+\|integrase	site-specific integrase	A0A0R6PHM8	Moraxella_phage	8.3e-25	26.3
WP_041621693.1\|1372544_1372880_+	hypothetical protein	NA	NA	NA	NA
WP_047220920.1\|1372879_1373437_+	conjugal transfer protein	NA	NA	NA	NA
WP_082304283.1\|1373426_1373735_+	hypothetical protein	NA	NA	NA	NA
WP_109234567.1\|1373869_1374196_+	hypothetical protein	NA	NA	NA	NA
WP_082304281.1\|1374238_1375558_+	conjugal transfer protein	NA	NA	NA	NA
WP_047220723.1\|1375557_1375887_+	hypothetical protein	NA	NA	NA	NA
WP_109234866.1\|1377101_1377761_+	conjugal transfer protein	NA	NA	NA	NA
WP_109234867.1\|1377846_1378044_+	hypothetical protein	NA	NA	NA	NA
WP_109234868.1\|1378056_1379196_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234869.1\|1379199_1380954_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_109234870.1\|1380963_1381956_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
1393061:1393164	attR	NA	NA	NA	NA

DBSCAN-SWA_15

1416908 : 1463369

Bodo_saltans_virus(22.22%)

portal,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047220353.1\|1416908_1418099_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.1e-59	37.4
WP_012461133.1\|1418117_1418384_+	hypothetical protein	NA	NA	NA	NA
WP_011945001.1\|1418872_1419112_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_109234879.1\|1419290_1420844_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_082304163.1\|1423804_1424242_+	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_162551788.1\|1424172_1424316_-	hypothetical protein	NA	NA	NA	NA
WP_109234880.1\|1425455_1426279_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109234881.1\|1426291_1426570_-	hypothetical protein	NA	NA	NA	NA
WP_011945086.1\|1427293_1428163_-	RMD1 family protein	NA	NA	NA	NA
WP_174190485.1\|1428758_1428914_-	conjugal transfer protein TraB	NA	NA	NA	NA
WP_052692525.1\|1429010_1429199_-	hypothetical protein	NA	NA	NA	NA
WP_047220347.1\|1429936_1430128_-	hypothetical protein	NA	NA	NA	NA
WP_047220346.1\|1430620_1431700_-	COX15/CtaA family protein	NA	NA	NA	NA
WP_082303979.1\|1433878_1435387_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047220591.1\|1435496_1436063_+	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	2.0e-24	41.8
WP_052692526.1\|1436067_1436784_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234882.1\|1438093_1440739_+	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_047220342.1\|1440754_1441900_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_082303976.1\|1441903_1442662_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_162551789.1\|1442672_1443659_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109234883.1\|1443668_1444685_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109235200.1\|1444669_1445773_-	toprim domain-containing protein	NA	NA	NA	NA
WP_109234884.1\|1447025_1447893_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.1e-20	28.8
WP_109234885.1\|1448576_1449374_-	toprim domain-containing protein	NA	NA	NA	NA
WP_052692557.1\|1449388_1450099_-	AAA family ATPase	NA	NA	NA	NA
WP_109234886.1\|1450088_1451411_-	MobA/MobL family protein	NA	NA	NA	NA
WP_047220226.1\|1451688_1452144_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_047220227.1\|1452466_1453540_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047220228.1\|1454139_1455126_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.4e-84	64.1
WP_082303921.1\|1455246_1455834_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	3.4e-06	29.0
WP_047220230.1\|1455875_1456370_-	ATP-binding protein	NA	NA	NA	NA
WP_052692513.1\|1456388_1456853_-	sensor histidine kinase	NA	NA	NA	NA
WP_082303934.1\|1457340_1457820_-	ATP-binding protein	NA	NA	NA	NA
WP_047220233.1\|1458048_1458750_-	sensor histidine kinase	NA	NA	NA	NA
WP_047220234.1\|1458814_1459093_-	hypothetical protein	NA	NA	NA	NA
WP_045917470.1\|1459460_1460270_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.4e-18	26.7
WP_082303937.1\|1460373_1460781_-	hypothetical protein	NA	NA	NA	NA
WP_109234887.1\|1460827_1461472_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.1e-13	30.0
WP_047220235.1\|1461509_1462085_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	7.4e-06	29.6
WP_109234545.1\|1462501_1463369_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.0e-19	33.8

DBSCAN-SWA_16

1488198 : 1580581

Bodo_saltans_virus(18.75%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234892.1\|1488198_1489066_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	28.8
WP_047220254.1\|1489743_1490613_+	hypothetical protein	NA	NA	NA	NA
WP_047220255.1\|1490818_1491484_+	guanylate kinase	A0A223FN12	Murmansk_poxvirus	6.5e-14	31.2
WP_045913535.1\|1496917_1497859_-	acetylglutamate kinase	NA	NA	NA	NA
WP_045912141.1\|1497806_1498433_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_109234893.1\|1498429_1500133_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_109234894.1\|1501230_1502097_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	4.7e-20	28.8
WP_047220260.1\|1504745_1506161_-	amino acid permease	NA	NA	NA	NA
WP_047220261.1\|1506464_1506989_+	hypothetical protein	NA	NA	NA	NA
WP_174190501.1\|1507026_1509432_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	9.3e-111	34.2
WP_109234895.1\|1509564_1510425_+	TIGR01459 family HAD-type hydrolase	NA	NA	NA	NA
WP_012461430.1\|1510977_1511307_+	monovalent cation/H(+) antiporter subunit G	NA	NA	NA	NA
WP_109234897.1\|1511303_1511894_+	DUF4040 domain-containing protein	NA	NA	NA	NA
WP_109234898.1\|1511914_1512349_+	Na(+)/H(+) antiporter subunit B	NA	NA	NA	NA
WP_012461427.1\|1512326_1512728_+	cation:proton antiporter subunit C	NA	NA	NA	NA
WP_109234899.1\|1512720_1514211_+	cation:proton antiporter	NA	NA	NA	NA
WP_109234900.1\|1514220_1515693_+	hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_109234901.1\|1519871_1520207_+	hypothetical protein	NA	NA	NA	NA
WP_109234522.1\|1520755_1521232_+	hypothetical protein	NA	NA	NA	NA
WP_108839640.1\|1521376_1521703_+	hypothetical protein	NA	NA	NA	NA
WP_047220723.1\|1523063_1523393_+	hypothetical protein	NA	NA	NA	NA
WP_109234902.1\|1525513_1525897_+	conjugal transfer protein	NA	NA	NA	NA
WP_162551810.1\|1527536_1528322_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_082304364.1\|1530532_1531501_+\|transposase	transposase	A0A1S7J231	Thermus_phage	7.8e-24	29.5
WP_162551774.1\|1532182_1533175_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_109234753.1\|1534269_1535137_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.1e-18	32.8
WP_174190502.1\|1535308_1536349_-	toprim domain-containing protein	NA	NA	NA	NA
WP_109234802.1\|1537168_1537912_-	hypothetical protein	NA	NA	NA	NA
WP_109234903.1\|1542617_1543412_-	hypothetical protein	NA	NA	NA	NA
WP_109234904.1\|1543849_1544746_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234905.1\|1544893_1545157_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234906.1\|1545235_1546198_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	5.1e-84	64.1
WP_082304270.1\|1547817_1548201_+	hypothetical protein	NA	NA	NA	NA
WP_047220881.1\|1548287_1548863_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	3.3e-06	37.1
WP_047220302.1\|1548963_1549821_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_047220301.1\|1549842_1550571_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_045917470.1\|1550937_1551747_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.4e-18	26.7
WP_082304271.1\|1551850_1552258_-	hypothetical protein	NA	NA	NA	NA
WP_052692606.1\|1552828_1554565_+	hypothetical protein	NA	NA	NA	NA
WP_047220883.1\|1555112_1556561_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.7e-70	36.6
WP_109234907.1\|1556569_1558285_-	hypothetical protein	NA	NA	NA	NA
WP_162551792.1\|1558757_1558907_-	hypothetical protein	NA	NA	NA	NA
WP_081257826.1\|1560103_1560280_+	hypothetical protein	NA	NA	NA	NA
WP_047220884.1\|1560413_1561340_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.9e-35	37.5
WP_109234908.1\|1561423_1564093_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.5e-32	24.1
WP_109234909.1\|1564145_1565678_-	ADP/ATP carrier protein	NA	NA	NA	NA
WP_109234910.1\|1566044_1566902_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_109234911.1\|1566903_1568193_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.0e-100	48.7
WP_011944753.1\|1568170_1568938_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	8.0e-32	38.7
WP_045913575.1\|1569113_1569680_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_047220991.1\|1569686_1570484_+	AAA family ATPase	A0A240F4U1	Ochrobactrum_phage	1.7e-16	32.4
WP_047220990.1\|1570495_1571377_+	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	3.6e-12	29.1
WP_047220988.1\|1573142_1574885_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_109234912.1\|1575119_1575971_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_109234913.1\|1576070_1576715_+	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_109234915.1\|1579588_1580581_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_17

1655235 : 1736352

Bodo_saltans_virus(28.57%)

integrase,tRNA,transposase

attL 1640908:1640967|attR 1722532:1722950

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1640908:1640967	attL	NA	NA	NA	NA
WP_047220187.1\|1655235_1657677_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_047220186.1\|1657673_1658708_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	5.4e-31	40.7
WP_109234927.1\|1659646_1660514_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.6e-20	28.8
WP_047220182.1\|1665453_1666392_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_047220181.1\|1666433_1668431_+	lytic transglycosylase domain-containing protein	I1VXB7	Halocynthia_phage	4.4e-05	39.4
WP_047220180.1\|1668827_1669595_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_052692508.1\|1669630_1670770_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_045916191.1\|1671111_1672548_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_047220179.1\|1672544_1672949_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_047220177.1\|1674981_1677483_-	hypothetical protein	NA	NA	NA	NA
WP_047220176.1\|1677530_1680110_-	hypothetical protein	NA	NA	NA	NA
WP_109234929.1\|1680562_1682281_+	hypothetical protein	NA	NA	NA	NA
WP_109234930.1\|1682289_1683726_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.1e-71	36.8
WP_045913638.1\|1683961_1684537_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A292GI44	Xanthomonas_phage	4.6e-08	29.2
WP_047220174.1\|1684571_1685216_+	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	2.2e-14	33.0
WP_047220173.1\|1685263_1685812_+	hypothetical protein	NA	NA	NA	NA
WP_047220172.1\|1685815_1686628_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	7.4e-28	33.1
WP_082303900.1\|1687106_1687634_+	hypothetical protein	NA	NA	NA	NA
WP_155377060.1\|1688455_1688596_+	hypothetical protein	NA	NA	NA	NA
WP_109234540.1\|1690652_1691228_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.8e-07	30.2
WP_109234931.1\|1691348_1692335_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.8e-84	64.1
WP_109234932.1\|1692402_1692858_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234933.1\|1693152_1695954_+	AAA family ATPase	A0A0H3UZA5	Geobacillus_virus	4.5e-08	21.1
WP_109235204.1\|1697791_1698886_+	toprim domain-containing protein	NA	NA	NA	NA
WP_109234934.1\|1698937_1700041_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109234935.1\|1700050_1701805_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109234936.1\|1701810_1702950_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234937.1\|1705614_1706916_-	conjugal transfer protein TraH	NA	NA	NA	NA
WP_109234938.1\|1706912_1707629_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234939.1\|1707640_1708201_-	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	2.0e-24	41.8
WP_109234940.1\|1708311_1709715_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234941.1\|1709966_1711655_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_109234942.1\|1711651_1712035_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_174190486.1\|1712057_1713035_-	TraU family protein	NA	NA	NA	NA
WP_174190469.1\|1713035_1713209_-	hypothetical protein	NA	NA	NA	NA
WP_109234943.1\|1713293_1713953_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_109234944.1\|1713949_1716439_-	TraC family protein	NA	NA	NA	NA
WP_045915079.1\|1716419_1716749_-	hypothetical protein	NA	NA	NA	NA
WP_109234945.1\|1716748_1718077_-	conjugal transfer protein	NA	NA	NA	NA
WP_109234946.1\|1718115_1718451_-	hypothetical protein	NA	NA	NA	NA
WP_109234947.1\|1718857_1719346_-	hypothetical protein	NA	NA	NA	NA
WP_045912835.1\|1719342_1719894_-	conjugal transfer protein	NA	NA	NA	NA
WP_041621693.1\|1719893_1720229_-	hypothetical protein	NA	NA	NA	NA
WP_109227201.1\|1720320_1721604_-\|integrase	site-specific integrase	Q9T1P3	Pseudomonas_phage	1.9e-14	25.4
WP_109234948.1\|1726010_1726622_-	CvpA family protein	NA	NA	NA	NA
1722532:1722950	attR	NA	NA	NA	NA
WP_109234949.1\|1726618_1727191_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_109234950.1\|1727363_1729106_+	cation:proton antiporter	NA	NA	NA	NA
WP_109234951.1\|1729086_1729584_+	hypothetical protein	NA	NA	NA	NA
WP_109234952.1\|1729863_1731078_+	aspartate kinase	NA	NA	NA	NA
WP_162551794.1\|1731139_1731289_-	hypothetical protein	NA	NA	NA	NA
WP_109234953.1\|1731834_1732701_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	9.4e-21	28.8
WP_109234954.1\|1735485_1736352_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	28.8

DBSCAN-SWA_18

1752654 : 1815542

Bodo_saltans_virus(25.0%)

tRNA,protease,integrase,transposase

attL 1771561:1771588|attR 1815587:1815614

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234959.1\|1752654_1753797_-\|integrase	site-specific integrase	A0A0R6PHM8	Moraxella_phage	4.3e-21	25.5
WP_047220125.1\|1754028_1754229_-	hypothetical protein	NA	NA	NA	NA
WP_082304227.1\|1754313_1754775_-\|transposase	transposase	NA	NA	NA	NA
WP_011944867.1\|1756040_1756661_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.3e-59	59.3
WP_041621747.1\|1758615_1759410_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_155377126.1\|1759757_1759919_-	hypothetical protein	NA	NA	NA	NA
WP_047220763.1\|1760460_1760736_-	hypothetical protein	NA	NA	NA	NA
WP_012461055.1\|1764552_1765290_+	response regulator transcription factor	A0A0K0PVG9	Roseobacter_phage	1.5e-14	57.7
WP_109234961.1\|1765405_1767142_+	ribonuclease J	NA	NA	NA	NA
WP_109234962.1\|1767224_1767524_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_109234963.1\|1767523_1769002_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_109234964.1\|1769004_1770465_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
1771561:1771588	attL	NA	NA	NA	NA
WP_109234965.1\|1771589_1772457_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	29.1
WP_109234966.1\|1779514_1780048_+	hypothetical protein	NA	NA	NA	NA
WP_109234967.1\|1781400_1781973_+	hypothetical protein	NA	NA	NA	NA
WP_109234968.1\|1785105_1785966_-	peptidase	NA	NA	NA	NA
WP_011944828.1\|1786044_1786512_-	single-stranded DNA-binding protein	A0A1B1IVU7	uncultured_Mediterranean_phage	3.8e-37	50.6
WP_109234970.1\|1788667_1789490_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011944758.1\|1789795_1790035_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_047220596.1\|1790088_1790370_+	ETC complex I subunit	NA	NA	NA	NA
WP_052692559.1\|1792705_1793989_+\|integrase	site-specific integrase	Q9T1R0	Acyrthosiphon_pisum_secondary_endosymbiont_phage	5.7e-14	25.9
WP_047220595.1\|1794080_1794416_+	hypothetical protein	NA	NA	NA	NA
WP_082304027.1\|1794979_1795288_+	hypothetical protein	NA	NA	NA	NA
WP_108839640.1\|1795422_1795749_+	hypothetical protein	NA	NA	NA	NA
WP_082304103.1\|1795791_1797117_+	conjugal transfer protein	NA	NA	NA	NA
WP_047220594.1\|1797116_1797446_+	hypothetical protein	NA	NA	NA	NA
WP_109234527.1\|1799566_1799950_+	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_047220592.1\|1801886_1802681_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047220591.1\|1802791_1803358_+	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	2.0e-24	41.8
WP_052692634.1\|1803362_1804079_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234514.1\|1807523_1808669_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047221003.1\|1808672_1810427_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109234535.1\|1810436_1811468_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109234802.1\|1813434_1814178_-	hypothetical protein	NA	NA	NA	NA
WP_109234972.1\|1814674_1815542_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.0e-19	28.4
1815587:1815614	attR	NA	NA	NA	NA

DBSCAN-SWA_19

1829392 : 1901944

Tupanvirus(26.09%)

tRNA,integrase,transposase

attL 1859670:1859687|attR 1903849:1903866

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109234977.1\|1829392_1830841_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	5.7e-71	37.2
WP_047220734.1\|1831076_1831652_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	7.4e-06	29.6
WP_109234601.1\|1831689_1832334_+	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.0e-08	28.0
WP_109234978.1\|1832436_1832940_+	hypothetical protein	NA	NA	NA	NA
WP_045913641.1\|1832943_1833753_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	4.1e-18	26.0
WP_047220841.1\|1834868_1835726_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_047220712.1\|1835826_1836402_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	5.7e-06	38.6
WP_109234598.1\|1836522_1837521_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.4e-84	64.1
WP_047220548.1\|1837593_1838049_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109234597.1\|1838344_1841167_+	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	3.6e-05	23.8
WP_082304340.1\|1842997_1844101_+	toprim domain-containing protein	NA	NA	NA	NA
WP_109234979.1\|1844152_1845148_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109235171.1\|1845157_1846405_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_109234980.1\|1847133_1848001_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	4.7e-20	32.8
WP_109234517.1\|1850433_1851132_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234982.1\|1851128_1852820_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_047220457.1\|1852816_1853206_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_174190487.1\|1853228_1854206_-	TraU family protein	NA	NA	NA	NA
WP_174190477.1\|1854206_1854380_-	hypothetical protein	NA	NA	NA	NA
WP_109234957.1\|1854463_1855123_-	conjugal transfer protein	NA	NA	NA	NA
WP_109234569.1\|1857589_1857919_-	conjugal transfer protein	NA	NA	NA	NA
WP_109234568.1\|1857918_1859238_-	conjugal transfer protein	NA	NA	NA	NA
WP_109234567.1\|1859280_1859607_-	hypothetical protein	NA	NA	NA	NA
1859670:1859687	attL	NA	NA	NA	NA
WP_082304027.1\|1859741_1860050_-	hypothetical protein	NA	NA	NA	NA
WP_041621693.1\|1860613_1860949_-	hypothetical protein	NA	NA	NA	NA
WP_082304268.1\|1861074_1861287_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012460767.1\|1862703_1863153_-	ribose 5-phosphate isomerase B	NA	NA	NA	NA
WP_109234983.1\|1865489_1866357_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	7.9e-20	28.8
WP_109234984.1\|1867423_1868291_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.1e-20	28.8
WP_155377142.1\|1868467_1868635_+	hypothetical protein	NA	NA	NA	NA
WP_047220860.1\|1868854_1869868_-	porphobilinogen synthase	NA	NA	NA	NA
WP_047220859.1\|1870038_1870728_+	protein TolQ	NA	NA	NA	NA
WP_011944822.1\|1870733_1871192_+	protein TolR	NA	NA	NA	NA
WP_109234985.1\|1871178_1872399_+	hypothetical protein	NA	NA	NA	NA
WP_109234986.1\|1872498_1873290_-	NAD kinase	NA	NA	NA	NA
WP_109234987.1\|1873302_1874337_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-68	44.3
WP_012461359.1\|1874360_1874870_-	CarD family transcriptional regulator	NA	NA	NA	NA
WP_109234988.1\|1875089_1875758_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	5.5e-37	47.5
WP_109234989.1\|1876501_1879939_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.0e-09	22.6
WP_047220726.1\|1880987_1881878_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	E9P639	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.2e-87	62.5
WP_174190488.1\|1883570_1883729_-	hypothetical protein	NA	NA	NA	NA
WP_082304200.1\|1883722_1884589_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	28.8
WP_109234990.1\|1885028_1887485_+	hypothetical protein	NA	NA	NA	NA
WP_109234991.1\|1887804_1888909_-	peptide chain release factor 2	NA	NA	NA	NA
WP_047220729.1\|1889056_1890862_+	elongation factor 4	A0A2K9L6L3	Tupanvirus	3.3e-20	32.6
WP_109234992.1\|1891905_1892727_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	3.7e-19	31.5
WP_082304203.1\|1892741_1893116_-	ankyrin repeat domain-containing protein	A0A068ELU4	Penguinpox_virus	8.2e-06	41.3
WP_047220734.1\|1893150_1893726_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	7.4e-06	29.6
WP_082304206.1\|1893961_1894978_-	replicative DNA helicase	A0A218KST2	Xenohaliotis_phage	5.8e-62	43.5
WP_109234993.1\|1895538_1897245_+	hypothetical protein	NA	NA	NA	NA
WP_047220735.1\|1897474_1898050_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	5.1e-07	30.4
WP_109234994.1\|1898084_1898729_+	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	6.8e-08	27.8
WP_162551754.1\|1898776_1898950_+	hypothetical protein	NA	NA	NA	NA
WP_047220125.1\|1900376_1900577_+	hypothetical protein	NA	NA	NA	NA
WP_109234995.1\|1900705_1901944_+\|integrase	site-specific integrase	A0A0R6PHM8	Moraxella_phage	1.3e-26	26.3
1903849:1903866	attR	NA	NA	NA	NA

DBSCAN-SWA_20

1989671 : 2059955

Bodo_saltans_virus(30.77%)

integrase,tRNA,transposase

attL 2024537:2024579|attR 2052209:2052251

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052692533.1\|1989671_1989911_+\|transposase	transposase	NA	NA	NA	NA
WP_109235027.1\|1990643_1993454_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_162551796.1\|1994364_1994511_-	hypothetical protein	NA	NA	NA	NA
WP_045915935.1\|1997561_1998008_-	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_045912306.1\|1998028_1998937_-	lipoyl synthase	NA	NA	NA	NA
WP_109235028.1\|1998947_1999856_-	signal peptide peptidase SppA	A0A0F6TJW1	Escherichia_coli_O157_typing_phage	2.4e-19	31.6
WP_012460806.1\|1999876_2000338_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.4e-28	48.6
WP_109235029.1\|2000340_2001237_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_047220380.1\|2001217_2002120_-	aminotransferase class IV	NA	NA	NA	NA
WP_109235030.1\|2002331_2004527_-	ATP-dependent RecD-like DNA helicase	A0A0H3UZA5	Geobacillus_virus	1.5e-54	27.4
WP_012460802.1\|2004553_2004928_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_109235031.1\|2004924_2005689_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_109235032.1\|2005735_2007565_-	hypothetical protein	NA	NA	NA	NA
WP_047220382.1\|2007566_2008139_-	DUF2497 domain-containing protein	NA	NA	NA	NA
WP_109235033.1\|2008183_2009557_-	TolC family protein	NA	NA	NA	NA
WP_047220389.1\|2009899_2010829_+	site-specific tyrosine recombinase XerD	S5W9T9	Leptospira_phage	1.9e-19	29.3
WP_047220383.1\|2011537_2012011_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_047220384.1\|2012005_2012728_-	SURF1 family protein	NA	NA	NA	NA
WP_047220385.1\|2012967_2013471_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_047220386.1\|2013474_2014047_+	RsmD family RNA methyltransferase	NA	NA	NA	NA
WP_109235034.1\|2014046_2015402_+	DNA repair protein RadA	NA	NA	NA	NA
WP_109235035.1\|2015441_2016362_-	DMT family transporter	NA	NA	NA	NA
WP_109235036.1\|2016511_2018410_+	DUF3857 domain-containing protein	NA	NA	NA	NA
WP_109235037.1\|2018455_2020384_+	DUF3857 domain-containing protein	NA	NA	NA	NA
WP_174190489.1\|2023080_2023218_-	hypothetical protein	NA	NA	NA	NA
WP_109235038.1\|2023706_2024099_+	ankyrin repeat domain-containing protein	A0A2L2DI10	Acanthamoeba_polyphaga_mimivirus	4.4e-10	34.2
2024537:2024579	attL	NA	NA	NA	NA
WP_047220803.1\|2024722_2025184_+	hypothetical protein	NA	NA	NA	NA
WP_045917470.1\|2025187_2025997_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.4e-18	26.7
WP_174190504.1\|2027407_2027824_+\|integrase	site-specific integrase	A0A0R6PGY7	Moraxella_phage	1.4e-09	34.2
WP_109235039.1\|2030496_2031363_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	9.4e-21	29.1
WP_109235040.1\|2032132_2033101_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	1.5e-38	34.1
WP_109235041.1\|2033078_2035130_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_047220807.1\|2035122_2036001_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_109235042.1\|2036544_2038119_+	type-specific antigen TSA56	NA	NA	NA	NA
WP_109235043.1\|2038349_2039090_+	type-specific antigen TSA56	NA	NA	NA	NA
WP_047220810.1\|2039293_2040766_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_047220808.1\|2040734_2041646_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_109235045.1\|2041623_2042598_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_047220811.1\|2042608_2043421_+	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_047220809.1\|2043441_2044578_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_109235046.1\|2045881_2046748_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.2e-20	28.8
WP_047220414.1\|2046749_2047040_+	hypothetical protein	NA	NA	NA	NA
WP_162551798.1\|2047026_2047425_+\|transposase	transposase	A0A2H4UV16	Bodo_saltans_virus	1.1e-11	34.9
WP_011944565.1\|2053689_2054175_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
2052209:2052251	attR	NA	NA	NA	NA
WP_174190505.1\|2056410_2058240_+	AAA family ATPase	W5S5P4	Pithovirus	3.5e-09	22.9
WP_109235047.1\|2059088_2059955_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	3.9e-19	28.4

DBSCAN-SWA_21

2067045 : 2123966

Bodo_saltans_virus(23.08%)

integrase,tRNA,transposase

attL 2092085:2092124|attR 2094843:2094882

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047220405.1\|2067045_2068992_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	8.9e-120	38.2
WP_047220404.1\|2069044_2069548_+	translation initiation factor IF-3	A0A2C9CXP5	Yersinia_phage	1.9e-05	26.7
WP_047220403.1\|2069868_2070315_+	dUTP diphosphatase	V9SFR6	Tunisvirus	2.6e-35	55.4
WP_047220402.1\|2070409_2070955_+	ATP synthase F1 subunit delta	NA	NA	NA	NA
WP_109235048.1\|2070998_2072537_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_047220401.1\|2072551_2073442_+	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_047220400.1\|2073452_2074085_-	hypothetical protein	NA	NA	NA	NA
WP_047220399.1\|2074086_2075700_-	hypothetical protein	NA	NA	NA	NA
WP_109235049.1\|2075832_2078499_+\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	2.3e-70	37.5
WP_047220398.1\|2078697_2080131_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_047220397.1\|2080131_2080476_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	3.4e-14	34.3
WP_109235050.1\|2080641_2082414_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_047220396.1\|2082425_2083178_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_109235051.1\|2086662_2086911_-	hypothetical protein	NA	NA	NA	NA
WP_109235052.1\|2088857_2089725_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.3e-19	28.4
WP_162551799.1\|2089718_2089883_+	hypothetical protein	NA	NA	NA	NA
2092085:2092124	attL	NA	NA	NA	NA
WP_109235053.1\|2093465_2093921_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012461748.1\|2093901_2094372_+	peroxiredoxin	NA	NA	NA	NA
WP_109235054.1\|2095781_2097257_-	NTP/NDP exchange transporter	NA	NA	NA	NA
2094843:2094882	attR	NA	NA	NA	NA
WP_109235055.1\|2097397_2097925_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_041621791.1\|2097967_2098240_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_045912125.1\|2098321_2098678_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_109235056.1\|2098970_2099720_+	winged helix-turn-helix domain-containing protein	W8CYM9	Bacillus_phage	2.0e-11	27.5
WP_109235057.1\|2099827_2101498_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-44	29.2
WP_109235058.1\|2101595_2101913_+\|transposase	transposase	NA	NA	NA	NA
WP_109235059.1\|2103834_2105490_+	ankyrin repeat domain-containing protein	Q6VZY0	Canarypox_virus	6.2e-05	28.9
WP_109235060.1\|2105773_2106640_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	3.6e-20	29.2
WP_109235061.1\|2107915_2108086_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_109235062.1\|2108094_2108424_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_012461400.1\|2113263_2113629_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_011944543.1\|2113648_2113855_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_047220765.1\|2114294_2116187_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.2e-89	30.9
WP_109235063.1\|2116351_2117518_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_109234487.1\|2119299_2120167_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	4.7e-20	28.4
WP_047220766.1\|2122979_2123966_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.4e-84	64.1

DBSCAN-SWA_22

2218184 : 2272484

Bodo_saltans_virus(42.86%)

integrase,transposase

attL 2228743:2228760|attR 2274799:2274816

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109235097.1\|2218184_2219201_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109235098.1\|2219223_2220966_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_109235099.1\|2220971_2222111_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109235100.1\|2222123_2224793_-	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_109234562.1\|2226102_2226819_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_047220715.1\|2226823_2227390_-	DUF4065 domain-containing protein	NA	NA	NA	NA
2228743:2228760	attL	NA	NA	NA	NA
WP_109234563.1\|2228853_2230542_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_047220457.1\|2230538_2230928_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_109235101.1\|2231919_2232579_-	conjugal transfer protein	NA	NA	NA	NA
WP_109235102.1\|2235049_2235379_-	conjugal transfer protein	NA	NA	NA	NA
WP_109234699.1\|2236739_2237066_-	hypothetical protein	NA	NA	NA	NA
WP_082304027.1\|2237200_2237509_-	hypothetical protein	NA	NA	NA	NA
WP_041621693.1\|2238072_2238408_-	hypothetical protein	NA	NA	NA	NA
WP_174190506.1\|2238533_2239121_-\|integrase	site-specific integrase	A0A0R6PGY7	Moraxella_phage	1.3e-10	29.1
WP_082304017.1\|2239319_2239748_-	DUF4102 domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.1e-06	34.5
WP_047220456.1\|2240415_2241039_-	30S ribosomal protein S4	NA	NA	NA	NA
WP_047220455.1\|2241174_2241966_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_162551811.1\|2242076_2242865_+	MlaE family lipid ABC transporter permease subunit	NA	NA	NA	NA
WP_047220454.1\|2242891_2243647_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	9.7e-22	34.9
WP_047220450.1\|2249789_2250971_-	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	6.2e-15	22.3
WP_162551802.1\|2253297_2253453_-	hypothetical protein	NA	NA	NA	NA
WP_109235103.1\|2253629_2254496_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.6e-20	29.1
WP_174190507.1\|2256938_2257685_-	rhodanese domain-containing protein	NA	NA	NA	NA
WP_047220442.1\|2257800_2258436_-	Tim44 domain-containing protein	NA	NA	NA	NA
WP_109235104.1\|2260557_2261712_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_109235105.1\|2263024_2263892_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	3.6e-20	28.4
WP_011944522.1\|2265986_2266286_-	hypothetical protein	NA	NA	NA	NA
WP_162551803.1\|2267170_2267350_+	hypothetical protein	NA	NA	NA	NA
WP_109235106.1\|2267500_2267812_+	conjugative transfer protein	NA	NA	NA	NA
WP_109235107.1\|2267963_2268786_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109235108.1\|2270015_2270333_+	hypothetical protein	NA	NA	NA	NA
WP_109235109.1\|2271131_2271461_+	conjugal transfer protein	NA	NA	NA	NA
WP_109235110.1\|2271616_2272484_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.8e-19	28.4
2274799:2274816	attR	NA	NA	NA	NA

DBSCAN-SWA_23

2285761 : 2345768

Bodo_saltans_virus(33.33%)

tRNA,integrase,transposase

attL 2316189:2316219|attR 2352305:2352335

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109235114.1\|2285761_2286688_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	3.4e-85	61.7
WP_047220621.1\|2286978_2287512_+	hypothetical protein	NA	NA	NA	NA
WP_047220525.1\|2287775_2288351_-	hypothetical protein	NA	NA	NA	NA
WP_047220622.1\|2288439_2288895_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109235115.1\|2289189_2292030_+	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	8.7e-07	24.5
WP_109235175.1\|2293861_2294965_+	toprim domain-containing protein	NA	NA	NA	NA
WP_047220626.1\|2295016_2295952_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_109234630.1\|2295961_2297716_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_047221041.1\|2297721_2298870_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109234571.1\|2298896_2301116_-	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_109234570.1\|2302303_2303002_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109234631.1\|2302998_2304549_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_047220434.1\|2304545_2304929_-	conjugal transfer protein	NA	NA	NA	NA
WP_174190477.1\|2305931_2306105_-	hypothetical protein	NA	NA	NA	NA
WP_109235116.1\|2306188_2306848_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_109234999.1\|2309315_2309645_-	conjugal transfer protein	NA	NA	NA	NA
WP_109235117.1\|2309644_2310973_-	conjugal transfer protein	NA	NA	NA	NA
WP_109235118.1\|2311015_2311342_-	hypothetical protein	NA	NA	NA	NA
WP_109235119.1\|2311476_2311965_-	hypothetical protein	NA	NA	NA	NA
WP_045917801.1\|2312513_2312849_-	hypothetical protein	NA	NA	NA	NA
WP_109235120.1\|2312940_2314224_-\|integrase	site-specific integrase	Q9T1R0	Acyrthosiphon_pisum_secondary_endosymbiont_phage	1.1e-14	26.3
WP_047220982.1\|2314660_2314960_+	hypothetical protein	NA	NA	NA	NA
WP_082304295.1\|2315270_2316138_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	9.4e-21	28.8
2316189:2316219	attL	NA	NA	NA	NA
WP_174190504.1\|2317116_2317533_-\|integrase	site-specific integrase	A0A0R6PGY7	Moraxella_phage	1.4e-09	34.2
WP_047220972.1\|2319200_2320445_+	ankyrin repeat domain-containing protein	A0A0M3PB69	Turkeypox_virus	1.1e-06	34.5
WP_109235208.1\|2320639_2321356_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109235121.1\|2325687_2326077_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_082304156.1\|2327099_2327804_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_052692573.1\|2327971_2328325_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_052692574.1\|2328318_2328495_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_082304159.1\|2328519_2329387_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	7.2e-21	28.8
WP_162551804.1\|2329380_2329533_+	hypothetical protein	NA	NA	NA	NA
WP_047220652.1\|2330303_2331767_+	exopolyphosphatase	NA	NA	NA	NA
WP_047220653.1\|2332871_2333603_+	intradiol ring-cleavage dioxygenase	NA	NA	NA	NA
WP_047220654.1\|2334223_2336743_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	3.7e-158	38.5
WP_047220665.1\|2336762_2337782_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_045916062.1\|2337967_2339335_+	magnesium transporter	NA	NA	NA	NA
WP_109235122.1\|2339431_2340922_-	carboxypeptidase M32	NA	NA	NA	NA
WP_047220656.1\|2344296_2344632_+	hypothetical protein	NA	NA	NA	NA
WP_109234729.1\|2344900_2345768_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	9.4e-21	28.8
2352305:2352335	attR	NA	NA	NA	NA

DBSCAN-SWA_24

2362475 : 2415032

Wolbachia_phage(14.29%)

integrase,transposase

attL 2351529:2351568|attR 2418997:2419036

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2351529:2351568	attL	NA	NA	NA	NA
WP_109235130.1\|2362475_2363570_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.5e-84	64.1
WP_045915406.1\|2363637_2364093_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109235131.1\|2364389_2367218_+	AAA family ATPase	A0A2H4ZK82	Cryptophlebia_leucotreta_granulosis_virus	4.8e-05	23.5
WP_082303970.1\|2369057_2370152_+	toprim domain-containing protein	NA	NA	NA	NA
WP_109235132.1\|2370203_2370764_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_012460827.1\|2370779_2371748_-\|transposase	IS110-like element ISOt5 family transposase	A0A1S7J231	Thermus_phage	5.9e-24	30.2
WP_109235133.1\|2371958_2372444_+\|transposase	transposase	NA	NA	NA	NA
WP_162551805.1\|2372453_2373440_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_082303976.1\|2373450_2374209_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_047220342.1\|2374212_2375358_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_109235134.1\|2375373_2378019_-	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_109235135.1\|2378018_2379320_-	conjugal transfer protein TraH	NA	NA	NA	NA
WP_109235136.1\|2379316_2380015_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_109235137.1\|2380011_2381703_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_109234675.1\|2381699_2382083_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_174190478.1\|2382105_2383083_-	TraU family protein	NA	NA	NA	NA
WP_174190477.1\|2383083_2383257_-	hypothetical protein	NA	NA	NA	NA
WP_109234674.1\|2383340_2384000_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_109235138.1\|2383996_2386486_-	TraC family protein	NA	NA	NA	NA
WP_109235139.1\|2386466_2386796_-	conjugal transfer protein	NA	NA	NA	NA
WP_109235140.1\|2386795_2388112_-	conjugal transfer protein	NA	NA	NA	NA
WP_109235141.1\|2388154_2388484_-	hypothetical protein	NA	NA	NA	NA
WP_109235142.1\|2388989_2389466_-	hypothetical protein	NA	NA	NA	NA
WP_047220326.1\|2389462_2390014_-	conjugal transfer protein	NA	NA	NA	NA
WP_045916792.1\|2390013_2390349_-	hypothetical protein	NA	NA	NA	NA
WP_109235143.1\|2390404_2391724_-\|integrase	site-specific integrase	Q9T1R0	Acyrthosiphon_pisum_secondary_endosymbiont_phage	6.9e-15	26.0
WP_109235209.1\|2393048_2393330_+	hypothetical protein	NA	NA	NA	NA
WP_045917470.1\|2393352_2394162_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.4e-18	26.7
WP_052692591.1\|2396403_2396994_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_047220817.1\|2397329_2397773_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_162551806.1\|2401245_2401473_-	hypothetical protein	NA	NA	NA	NA
WP_109235145.1\|2401845_2402451_+	heme ABC exporter ATP-binding protein CcmA	W6JKT0	Anomala_cuprea_entomopoxvirus	2.0e-06	26.4
WP_047220814.1\|2402447_2403098_+	heme exporter protein CcmB	NA	NA	NA	NA
WP_109235146.1\|2403251_2404391_+	DUF2670 domain-containing protein	NA	NA	NA	NA
WP_109227398.1\|2404475_2405168_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_109235147.1\|2405317_2406514_+	cytochrome b N-terminal domain-containing protein	NA	NA	NA	NA
WP_109235148.1\|2408085_2411019_+	hypothetical protein	NA	NA	NA	NA
WP_047220046.1\|2411358_2412642_-	amino acid permease	NA	NA	NA	NA
WP_109235149.1\|2414164_2415032_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	5.5e-21	28.8
2418997:2419036	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_LS398551.1|WP_047220681.1|1198278_1198479_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_LS398551.1|WP_047220681.1|1198278_1198479_-|hypothetical-protein

1198278_1198479_-

66 aa aa

1177226-1229124

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_LS398551_3	Orphan	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	1194139-1194156	1
NZ_LS398551_3	Orphan	3.1\|1699747\|18\|NZ_LS398551\|CRT	1699747-1699764	18	1194175-1194192	1
NZ_LS398551_3	Orphan	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	1194199-1194216	0
NZ_LS398551_3	Orphan	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	1228986-1229003	0
NZ_LS398551_3	Orphan	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	1228974-1228991	1
NZ_LS398551_3	Orphan	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	1218732-1218749	2
NZ_LS398551_3	Orphan	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	1218780-1218797	2
NZ_LS398551_3	Orphan	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	1218852-1218869	2
NZ_LS398551_3	Orphan	3.4\|1699867\|18\|NZ_LS398551\|CRT	1699867-1699884	18	1218864-1218881	2

1. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1194139-1194156, mismatch: 1

agagattggtgagactaa	CRISPR spacer
agagatcggtgagactaa	Protospacer
******.***********

2. spacer 3.1|1699747|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1194175-1194192, mismatch: 1

agagattggtgagactaa	CRISPR spacer
agagattggtgaaactaa	Protospacer
************.*****

3. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1194199-1194216, mismatch: 0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

4. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1228986-1229003, mismatch: 0

agctgaaggcagagctga	CRISPR spacer
agctgaaggcagagctga	Protospacer
******************

5. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1228974-1228991, mismatch: 1

agctgaaggcagagctga	CRISPR spacer
agctgaaggcatagctga	Protospacer
*********** ******

6. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1218732-1218749, mismatch: 2

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

7. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1218780-1218797, mismatch: 2

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

8. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1218852-1218869, mismatch: 2

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

9. spacer 3.4|1699867|18|NZ_LS398551|CRT matches to NZ_LS398551 position: 1218864-1218881, mismatch: 2

agctgaaggcagagctga	CRISPR spacer
agctgaaggtaaagctga	Protospacer
*********.*.******

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LS398551

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information