CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LS483356	Streptococcus pyogenes strain NCTC8230 chromosome 1	2 crisprs	DinG,csm6,cas3,DEDDh,csa3	0	0	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LS483356_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LS483356_1

125094-125200

Orphan

Consensus_repeat	Method
CCATTGATGCCAGAGTTAGATGGTCAAGAAGTCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LS483356_1

>merge|NZ_LS483356|1|125094-125200|CRISPRCasFinder
CCATTGATGCCAGAGTTAGATGGTCAAGAAGTCCCAGAAGTTCCAAGCGAGAGCTTAGAACCTGCGCTTCCTCCATTAATGCCAGAGTTAGATGGTCAAGAAGTCCC

>NZ_LS483356|1|1|125094-125200|CRISPRCasFinder
CCATTGATGCCAGAGTTAGATGGTCAAGAAGTCCC	AGAAGTTCCAAGCGAGAGCTTAGAACCTGCGCTTCCT
CCATTAATGCCAGAGTTAGATGGTCAAGAAGTCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LS483356.1\|WP_111713118.1\|127156_131260_+\|fibrinogen-binding-adhesin-SdrG-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|380076
NZ_LS483356.1\|WP_111713120.1\|133555_134401_+\|prealbumin-like-fold-domain-containing-protein	unknown	unknown	gnl\|CDD\|380024
NZ_LS483356.1\|WP_111713121.1\|137394_138060_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LS483356.1\|WP_002986502.1\|120264_121242_-\|tRNA-dihydrouridine-synthase-DusB	unknown	unknown	gnl\|CDD\|129820
NZ_LS483356.1\|WP_003053955.1\|118948_119344_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180914
NZ_LS483356.1\|WP_111713119.1\|131380_133543_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374638
NZ_LS483356.1\|WP_172452780.1\|136194_137052_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_LS483356.1\|WP_011184094.1\|116539_117541_+\|IS30-like-element-IS1239-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_LS483356.1\|WP_111713113.1\|114936_116004_-\|glutamyl-aminopeptidase	unknown	unknown	gnl\|CDD\|132151
NZ_LS483356.1\|WP_172452781.1\|138412_139819_+\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NZ_LS483356.1\|WP_111713115.1\|122247_123741_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|285470
NZ_LS483356.1\|WP_002986504.1\|119603_120245_-\|deoxynucleoside-kinase	unknown	unknown	gnl\|CDD\|224345
NZ_LS483356.1\|WP_011528176.1\|134482_135355_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_LS483356.1\|WP_085634579.1\|135341_136175_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_LS483356.1\|WP_002986511.1\|118170_118797_+\|DUF4479-and-tRNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|239196
NZ_LS483356.1\|WP_002986518.1\|117545_117839_+\|DUF4651-domain-containing-protein	unknown	unknown	gnl\|CDD\|339494
NZ_LS483356.1\|WP_002986515.1\|117835_118153_+\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_LS483356.1\|WP_111713114.1\|121228_122101_-\|Hsp33-family-molecular-chaperone-HslO	unknown	unknown	gnl\|CDD\|234643
NZ_LS483356.1\|WP_111713123.1\|140918_142103_+\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|180261
NZ_LS483356.1\|WP_111713122.1\|139886_140798_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656

Protein	Function_ID	Function_description	E-value
NZ_LS483356.1\|WP_111713118.1\|127156_131260_+\|fibrinogen-binding-adhesin-SdrG-C-terminal-domain-containing-protein	gnl\|CDD\|380076	pfam17961, Big_8, Bacterial Ig domain. This entry represents a bacterial Ig-fold domain that is found in a wide range of bacterial cell surface adherence proteins.	1.48377e-19
NZ_LS483356.1\|WP_111713120.1\|133555_134401_+\|prealbumin-like-fold-domain-containing-protein	gnl\|CDD\|380024	pfam17802, SpaA, Prealbumin-like fold domain. This entry contains a prealbumin-like domain from a wide variety of bacterial surface proteins. This entry corresponds to domain 1 and domain 3 of SpaA from Corynebacterium diphtheriae. Some members of this family contain an isopeptide bond.	3.45587e-15
NZ_LS483356.1\|WP_111713122.1\|139886_140798_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	9.15741e-30
NZ_LS483356.1\|WP_002986502.1\|120264_121242_-\|tRNA-dihydrouridine-synthase-DusB	gnl\|CDD\|129820	TIGR00737, Probable_tRNA-dihydrouridine_synthase, putative TIM-barrel protein, nifR3 family. This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). This branch includes NifR3 itself, from Rhodobacter capsulatus. It excludes a broadly distributed but more sparsely populated subfamily that contains sll0926 from Synechocystis PCC6803, HI0634 from Haemophilus influenzae, and BB0225 from Borrelia burgdorferi. It also excludes a shorter and more distant archaeal subfamily.The function of nifR3, a member of this family, is unknown, but it is found in an operon with nitrogen-sensing two component regulators in Rhodobacter capsulatus.Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Unknown function, General].	9.59848e-122
NZ_LS483356.1\|WP_003053955.1\|118948_119344_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|180914	PRK07274, PRK07274, single-stranded DNA-binding protein; Provisional.	1.44411e-89
NZ_LS483356.1\|WP_111713119.1\|131380_133543_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374638	pfam16570, GramPos_pilinD3, Gram-positive pilin backbone subunit 3, Cna-B-like domain. GramPos_pilinD3 is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.97967e-19
NZ_LS483356.1\|WP_172452780.1\|136194_137052_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.39435e-55
NZ_LS483356.1\|WP_011184094.1\|116539_117541_+\|IS30-like-element-IS1239-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.51285e-103
NZ_LS483356.1\|WP_111713113.1\|114936_116004_-\|glutamyl-aminopeptidase	gnl\|CDD\|132151	TIGR03107, Glutamyl_aminopeptidase, glutamyl aminopeptidase. This model represents the M42.001 clade within MEROPS family M42. M42 includes glutamyl aminopeptidase as in the present model, deblocking aminopeptidases as from Pyrococcus horikoshii and related species, and endo-1,4-beta-glucanase (cellulase M) as from Clostridium thermocellum. The current family includes [Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NZ_LS483356.1\|WP_172452781.1\|138412_139819_+\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	0
NZ_LS483356.1\|WP_111713115.1\|122247_123741_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|285470	pfam08270, PRD_Mga, M protein trans-acting positive regulator (MGA) PRD domain. Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions. This corresponds to the PRD like region.	5.18164e-60
NZ_LS483356.1\|WP_002986504.1\|119603_120245_-\|deoxynucleoside-kinase	gnl\|CDD\|224345	COG1428, COG1428, Deoxynucleoside kinases [Nucleotide transport and metabolism].	1.2135e-96
NZ_LS483356.1\|WP_011528176.1\|134482_135355_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	3.9234e-78
NZ_LS483356.1\|WP_085634579.1\|135341_136175_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	4.56855e-75
NZ_LS483356.1\|WP_002986511.1\|118170_118797_+\|DUF4479-and-tRNA-binding-domain-containing-protein	gnl\|CDD\|239196	cd02796, tRNA_bind_bactPheRS, tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain. PheRS aminoacylate phenylalanine transfer RNAs (tRNAphe). PheRSs belong structurally to class II aminoacyl tRNA synthetases (aaRSs) but, as they aminoacylate the 2'OH of the terminal ribose of tRNA they belong functionally to class 1 aaRSs. This domain has general tRNA binding properties and is believed to direct tRNAphe to the active site of the enzyme.	1.22775e-48
NZ_LS483356.1\|WP_002986518.1\|117545_117839_+\|DUF4651-domain-containing-protein	gnl\|CDD\|339494	pfam15513, DUF4651, Domain of unknown function (DUF4651). family of short, secreted proteins specific to the Streptococcus genus, with distant homologs, not recognized by this HMM, found in other cocci. In all sequenced genomes, proteins from this family appear in a conserved genomic context with an thioredoxin, tRNA synthase and tRNA binding protein, but the functional implication of this is unclear.	8.86115e-29
NZ_LS483356.1\|WP_002986515.1\|117835_118153_+\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	1.40404e-25
NZ_LS483356.1\|WP_111713114.1\|121228_122101_-\|Hsp33-family-molecular-chaperone-HslO	gnl\|CDD\|234643	PRK00114, hslO, Hsp33 family molecular chaperone HslO.	1.6745e-148
NZ_LS483356.1\|WP_111713123.1\|140918_142103_+\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|180261	PRK05790, PRK05790, putative acyltransferase; Provisional.	0

>NZ_LS483356.1|WP_111713115.1|122247_123741_-|helix-turn-helix-domain-containing-protein
MIEKYLESSIESKCQLIVLFFKTSYLPITEVAEKTGLTFLQLNHYCEELNAFFPGSLSMTIQKRMISCQFTHPFKETYLYQLYASSNVLQLLAFLIKNGSHSRPLTDFARNHFLSNSSAYRMREALIPLLRNFELKLSKNKIVGEEYRIRYLIALLYSKFGIKVYDLTQQDKNTIHSFLSHSSTHLKTSPWLSESFSFYDILLALSWKRHQFSVTIPQTRIFQQLKKLFIYDSLKKNSRDIIETYCQLNFSAGDLDYLYLIYITANNSFASLQWTPEHIRQCCQLFEENDTFRLLLNPIITLLPNLKEQKASLVKALMFFSKSFLFNLQHFIPETNLLVSPYYKGNQKLYTSLKLIVEEWMAKLPGKRYLNHKHFHLFCHYVEQSLRNIQPPLVVVFVASNFINAHLLTDSFPRYFSDKSIDFHSYYLLQDNVYQIPDLKPDLVITHSQLIPFVHHELTKGIAVAEISFDESILSIQELMYQVKEEKFQADLTKQLT
>NZ_LS483356.1|WP_111713114.1|121228_122101_-|Hsp33-family-molecular-chaperone-HslO
MDKIIKSIAQSGAFRAYVLDSTETVALAQEKHNTLSSSTVALGRTLIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEVLVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLSDENDKVKVAGGFMVQVLPGASEEEIARYEKRLQEMPAISHLLASKNHVDALLEAIYGDEPYKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESDLEALINDKA
>NZ_LS483356.1|WP_002986502.1|120264_121242_-|tRNA-dihydrouridine-synthase-DusB
MTKLNSSFRIGDVEIPHRTVLAPMAGVTNSAFRTIAKEFGAGLVVMEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFGGDAEGLKRAADFIQTNTKADIVDINMGCPVNKVVKNEAGAKWLRDPDKIYHIVKEVTSVLDIPLTVKMRTGWADSSLAVENALAAESAGVSALAMHGRTREQMYTGTCDHETLARVSKAITKIPFIGNGDVRSVQDAKFMIEEIGVDAVMIGRAAMNNPYLFTQINHFFETGQELPDLPFAKKLDIAKDHLKRLINLKGETIAVREFRGLAPHYLRGTAGAAKVRGAVSRAETLAEVEAIFETVR
>NZ_LS483356.1|WP_002986504.1|119603_120245_-|deoxynucleoside-kinase
MLIVLAGTIGAGKSSLAAALGEHLGTDVFYEAVDNNPVLDLYYQDPKKYAFLLQIYFLNKRFKSIKEAYQADNNILDRSIFEDELFLKLNYKNGNVTKTELDIYQELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSFEQVDGNPSLEQYYHQVHGEYPTWYEDYKVSPKMKIDGNSLDFVQNPQDLATVLKMIDTKLKELHLL
>NZ_LS483356.1|WP_003053955.1|118948_119344_+|single-stranded-DNA-binding-protein
MYNKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREADFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKYDKDGQVHYVTEVLCQSFQLLESRAQRAMRENNVTNDLVDLVLEEDTLPF
>NZ_LS483356.1|WP_002986511.1|118170_118797_+|DUF4479-and-tRNA-binding-domain-containing-protein
MIFAYNKEQVGDVLMVILQDTKDIKRQVERKGKVARVFAEESGKTLAWNIFEASSLITIEGNGQIFLTDEDLARLNAELAKEGFSERLEPTVGPVFVVGQIVEMVAHPDSDHLNICQVAIGEDQTVQIVAGAPNAALGLKTIVALPGAIMPNGSLIFPGKLRGEESYGMMCSPRELALPNAPQKRGIIELDESAVVGEAFDPAKHWKG
>NZ_LS483356.1|WP_002986515.1|117835_118153_+|thioredoxin-family-protein
MIRPTSYESLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAELTDMTFVCVNRDQFIEVAQKWDIFGIPSFVVIEKGQEVGRLVNKMRKTKTEIMHFLAAYQ
>NZ_LS483356.1|WP_002986518.1|117545_117839_+|DUF4651-domain-containing-protein
MRDMSKKKIGMISGIFGFSLAIGLGIVIKDYCQDRQRRQMTRDLRTFFSPLGQIEVLYINPCQVKQDYISGGVVMSNGKQYQFTYHSRQISFEEDKG
>NZ_LS483356.1|WP_011184094.1|116539_117541_+|IS30-like-element-IS1239-family-transposase
MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIHNEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGFRSSNLIFL
>NZ_LS483356.1|WP_111713113.1|114936_116004_-|glutamyl-aminopeptidase
MTDLFSKIKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLGGIFGIRDSKVEKAPRTLVAAHMDEVGFMVSDIKVDGTLRVVGIGGWNPLVVSSQRFTLYTRTGQVIPLISGSVPPHFLRGANGSASLPHIEDIVFDGGFTDKAEAERFGITPGDIIVPQSETILTANQKNIISKAWDNRYGVLMITEMLEALKGQDLNNTLIAGANVQEEVGLRGAHVSTTKFDPELFFAVDCSPAGDIYGNSGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEEAGVNIQYYCGKGGTDAGAAHLQNGGVPSTTIGVCARYIHSHQTLYAMDDFVEAQAFLQAIIKKLDRSTVDLIKCY
>NZ_LS483356.1|WP_111713118.1|127156_131260_+|fibrinogen-binding-adhesin-SdrG-C-terminal-domain-containing-protein
MYSRLKRELVIVINRKKKYKLIRLMVILGLIFSQLAPPFGILMALSGHSRSKSPVTEVKADSVSTPKTGSFKLKKLDEDGKTPIKDVTCQLTSETNLSNYKVEQTTSSTGDAKFANIPPGTYLLKEVAPPSGYQVMTDYYKITVSPDGYTQYTYVKVGTTTSSPTTSLPSPSGGGTGGTVLRTPKTSGVVTATDYKFTTKNKAQGNTDYTKLWATSGEFFDMSFKLKVNEGTQAGDSFTIKLSNYLSPNGIREKFISAPPLMLDQQVVATGIYDEATNSYIYTFNDLINHKQNAEITVNYTFSPEAKKVDRDWYVNTYNITNIIDGQKQDSGNFTIDYGQGQYMTGTLNSGLRLRNNITYLNRTTGEVEYTIYLDNGASPRDKDFTVKNPVTGRHFLNLEDKSASVAFTQKNITVYRVPLSQKTSKMPYSMSGEIDGLESIPFDYSSKGITFTKESFHDNETNSNTAGLLIKIKAYITADNKRSADVSLSAGWTYTNLIRSRSDAKASAFELGNTSSGVANNIEPTVTIRNYKIKKGSIVFTKQDVETKMTLSGVAFRLEKKEENDWQIIEKYKDVQTGTEGKLILSDLDPGEYQLIETKPLDGYLVSSGPVVTFTITDQGTEGTVKPSDKIIPNTKPGKQKIKVIKKDEQSRVPLAGAKFQLESNKGVVLTGETDGKGEYTFTNLPFGDYILTEIAAPKGYILDKTPRSIAIGDTVDKEPEPTVVEAATPRTVRSVSPSATVSGKDVSRNILVKKVEFTTTNGQTPLQVKPNQGENLIARSEFELKKEIDIKKGDYFAVKLSDNIDPFGVSTGETTTFNITGPYGTLAVGKYDSKSRSIIYTFTDYVEKYEVSNFSTILPYFIDRYAVTRDADINISTSVGSQTNTARVRVLYTPYYGATDSYSPVNVGSMITKLDEKNGTFTNYIYINPMQQFIRNGKLTFQGGGSAIIDNETQVTLFKVNNSTDMPPSWGITDSTLRVENDILVTKKQGEISVDFENILEARNSFIMKVVGKIASSGTSVRTSATLSQKYDNTYGYYSTNGRWIPKGPYSEYYRYDTTAILHSGDSNVDGAIRISVTNRKNSVAFTKTNGLEKPLEATFELRRLNSNKTFTSVKTTKSTKDTGKFSFEGMESGSYEVWETQSPEGYLKPDKAVATFKVDKDGTIKDLTPDNGKIINYPNTAKIIFTKMLASEKGELSPATKEKSATFSLWRLKEESLKETNTVSQAYDEQYYEPVMENNSVRTVTSDSSGNVLFDKLSPGFYAIKEEKAPDGYVKQQGIVRIFQVDSSGKVIKYQYFKDKSIAGKLTEITDLETEQLKQFNEIINKKFVFPMTGGQGIALLMIIGGTMMGIAYLGHRRKQRLND
>NZ_LS483356.1|WP_111713119.1|131380_133543_+|isopeptide-forming-domain-containing-fimbrial-protein
MKTKIFSRLAAVLLVLGSLLPTVVAVAEAESSHKTDVVIHKIKMTSLKGWPKEKNPDGTYTGLGDKNYNGEKIDTITSYFGEGAEELDGVSFTYWSVDKEKYKKLTKNPQNYDTVPKMKAFLQGAEKNKALENSSETIDGKTTGHTADKGGVKVKDLADGYYWFVENSGSNIANGETLSSSAAVPFGLELPVYKADGSTITELHVYPKNTTTKPKIDKNFSKDEKDAALAGGANYDYYQKDKGYVSRIIGSEVSYQIKTEIPAGAQYQTLRWEDTMTKGLTYKAGSLELTITTKGDGKAALNFEFQTDYKLTENQSGFVLKFTESGLEKVKKAVQATKDAKGQVTADGYPMTVDISYKATVNSDAVVDQPDKNTVIFDYSNNPKEHKDPREKSTKPKDKQITVEKTWASQSAPTGIAVTYYLYQKGDESGKDKVVDSVTLTTDYKHIFTNLDDSKDYYVKESAIGYTPEYTEAKDGKISIKNTKDDKNPDPLKPTSPAIVTHGKKFVKTSQDDERLKGATFVVVDQKTNEKYLAIKADEKQSAEEKAYHDAEQKYQDEVKKATTEKPNSQAIEKAKKARDDAFKKARTAYEWVSDKQKAVKFTSNSKGQFEVTGLAAGTYYLEEVAAPTGFAKLQEKVEFTLGFNSYNGHKDQSGQSLEGHTQYEKGTPDFGYGQRVINKKITIPQTGGIGTVIFTVVGLAIMTVTGLMMIRRNKNDKSE
>NZ_LS483356.1|WP_111713120.1|133555_134401_+|prealbumin-like-fold-domain-containing-protein
MGGTQLKIGRLICLMLSICACLYFLTSPIFALQKTSSVTIHFENSDKDTQLALWQLPEGQTLPELETLFEKTDAELTRQYPQVSTVTVPKGETKLVLSNLPVGAIYYVREAEERLGVRSLAPFILKVDTDDDQAVYTKKAKAQKRGSYPFVKVSAQGGSLEGATFEVWKQTQKQLQPVIKGSSRYLLTSSKDGSFMAKDLPFGSYVLKEITAPKGYLLSKKTIPFEVTDYSEKQAPVKVVNQPKIPPRIEIPYTGNAIMILVVLLGFALFTLGVYLVRRNG
>NZ_LS483356.1|WP_011528176.1|134482_135355_+|class-C-sortase
MKKQSKRHRLNQNIALIVVFLIGLTILLYPQISRIYYTIESNYQSKQFDREKSTLHQEDISQRIALAKAFNASLHDVDLKDPYSDDEKTKGRAEYARMLELHEQIGHVEIPKIRVDLPIYAGTSDEIISKGSGHLEGTSLPVGGENTHTVLTSHSGLPSAKLFSDLAKLKKGDIFYIHNIKEILAYQIDQIKIIEPDNFSDLLIVPGKDYATLLTCTPVGINTHRLIVRGHRVPYVSNEHKNNKQKASSGYMCYLFVLLALLTLLFGYWFYRQKKKKSQKVKREEFHAKE
>NZ_LS483356.1|WP_085634579.1|135341_136175_+|class-C-sortase
MLKNKQSLSLRERLIQVMFPLLFLMGCLIVLYPLMSNYYYRVKQNQAVTSFESAKVIVNKDDIKRRMALARAYNATLDPGRINDPYTDLEKKGVAEYARMLELNEQIGYVEVPRFDINLPIYAGTSDDVLQKAAGHLEGTSLPIGGDSTHTVITAHTGLPQAKLFTNIHKMKKGDLFFIHNIDKTLAYKVDQILVVEPDNFTPVLVKNGFDYATLLTCTPYGINSHRLLVRGYRVPYQKAFEKADAQRPWYTKAIFLVSFLLFVILVIILLINWHRK
>NZ_LS483356.1|WP_172452780.1|136194_137052_+|class-C-sortase
MSKQKCVGYVLMILGLGLPLFFLTLMSLNQFQEQVAYQKFQTENRSWKNSQKEWVNRHNQEQALTDRATTDPFVDAQNQLKQNPFDDNVIGYIIIPKLRMAQPIRVGASERHLEKGVAQVTGTSLPIGGLGTRSVIAGHRSWYDNERFLRIAELSIGDQIVIDLGVYQLEYRVKSVEIIDAKDWRQLTAKKSQDLITLLTCNPLYPPFNERLLVNAERVSPSLSDLPTKTRNKTDQSQLESPLASHKTSLVKLPLVLPFGIWVCLGWLIESYFIYRLFHQCKGDS
>NZ_LS483356.1|WP_111713121.1|137394_138060_-|hypothetical-protein
MKRCNKYLFTSLLAASMLFSSYKSVHAHDNIDEKGKVHLYWQGNYYVDNYVDYTKTLVDNNNSIEWTVTFNSAKEQWVYPDFSVFLPKGVKAPKEITYEHHYWDGTVHSEKRSNTQWHYDWENQKTNFNQEFDKFPGYTGWSPSLDKFYKLKNDGKFSHVLVDTYGRQSHTYFSHKMVWKFKTELEEGYKDKWNKLPFIAGIKQNNPLAASFPSYKGEFGE
>NZ_LS483356.1|WP_172452781.1|138412_139819_+|short-chain-fatty-acid-transporter
MNNIKTKKRFMDSYIDGFMKWMPETLFICFILTFLVVTMSVLMTDSPFIGTEKTGGIIYGWVNGFWGLLSFAMQMTILLATGNAVASSPPAHKMFKSLAKLPQTRTQIFIFSIVVGSIFGFLHWGLGMMVAIVFGKELLVQARQKGIKVHTPLFVATLFFTFLPATSGLSGAAVLYSATPDYLRNSVADAYKQVVPESVPLTESVLNLPFISLLVVCMLVPLCFALLAHPKDETKIMELDDEIYHHSLDTASHVVIARNTPAEKMNASRLVMYLVGGAIVSYSLYHFSVVGLSGLDLNSFNFLFLGLGLLLCGQQGPEYYGSLFKDGVMSSWGLVLQFPFYAGIFGIIQSTGLGLEISHFFVAISNGTTWPVFAYLYSALLNIAVPSGGSKFVIEAPYIVPATIEVGNDLGKILQAYQLGDATTNLIVPFWALSYLSNFKLKFNQIVAYTIPCVLVVTGIAIIYLFVF
>NZ_LS483356.1|WP_111713122.1|139886_140798_-|LysR-family-transcriptional-regulator
MNISSLAYFIEIVNCDFNLTKAAQKSHISQPALSSYIKTIEKEEGVVLFQRQKGRLVGLTSVGERFFENAKVVIASHEQLMADLRSESKKYKGEISIGIPQLISGIVFSELIPKLIEENPEVKFHIVETGAYELQKKLFLKEVDFAILLTPTTLDTTIADIDILLRDQLCLYMSHKTFQETFDSNPNISIKALHRQNLVTFDKTFMINHQLTTLFEEANSLPVVKCYSASWDFLLNCTRYSSYLTILPRPITHFAHMDGLVEVQLTEHPKWEVVLASLKHNKTSHLKHYIKHTILDYFTNQRF
>NZ_LS483356.1|WP_111713123.1|140918_142103_+|acetyl-CoA-C-acetyltransferase
MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLKSDAIDEVIFGNVLHAGLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQTGNADIVLVGGTENMSQAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAENIVQQYGLTREEQDAFAADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLINQDEYPKFGTTVDKLAKLRPAFIKDEGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSYASAGVDPSIMGCGPIPATKKALAKAQLTIDDINLIEANEAFAAQALAVSRDLGFDNEKVNVNGGAIALGHPIGASGARILVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LS483356_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LS483356_2

1042483-1042584

Orphan

Consensus_repeat	Method
AATAATTGGTATAGTCTAATTATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LS483356_2

>merge|NZ_LS483356|2|1042483-1042584|CRISPRCasFinder
AATAATTGGTATAGTCTAATTATACCGATAAAAACATTATGTTTACAGTATATAATATCCACAATGTCTTGTCAAACATAAAATTGGTATAGTCTAATTATA

>NZ_LS483356|2|2|1042483-1042584|CRISPRCasFinder
AATAATTGGTATAGTCTAATTATA	CCGATAAAAACATTATGTTTACAGTATATAATATCCACAATGTCTTGTCAAACA
TAAAATTGGTATAGTCTAATTATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LS483356.1\|WP_111713276.1\|1032154_1033165_-\|IS30-like-element-IS1239-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_LS483356.1\|WP_002989607.1\|1051330_1051945_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_LS483356.1\|WP_002984447.1\|1043382_1044885_-\|pyruvate-kinase	unknown	unknown	gnl\|CDD\|235619
NZ_LS483356.1\|WP_021340779.1\|1052838_1053627_-\|streptococcal-pyrogenic-exotoxin-SpeL	unknown	unknown	gnl\|CDD\|280949
NZ_LS483356.1\|WP_002984449.1\|1042607_1043165_-\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NZ_LS483356.1\|WP_002984455.1\|1039338_1039980_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_LS483356.1\|WP_002984465.1\|1033657_1034980_+\|sodium:alanine-symporter-family-protein	unknown	unknown	gnl\|CDD\|224040
NZ_LS483356.1\|WP_011017829.1\|1035099_1036335_+\|cation-diffusion-facilitator-family-transporter	unknown	unknown	gnl\|CDD\|223131
NZ_LS483356.1\|WP_002984441.1\|1046040_1049151_-\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|180917
NZ_LS483356.1\|WP_011284834.1\|1040617_1042432_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	unknown	unknown	gnl\|CDD\|234729
NZ_LS483356.1\|WP_002989617.1\|1049335_1049707_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224639
NZ_LS483356.1\|WP_002984462.1\|1036704_1037478_-\|CAMP-factor-pore-forming-toxin-Cfa	unknown	unknown	gnl\|CDD\|369335
NZ_LS483356.1\|WP_002984437.1\|1049706_1050405_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_LS483356.1\|WP_002984453.1\|1040086_1040422_-\|alkylphosphonate-utilization-protein	unknown	unknown	gnl\|CDD\|225380
NZ_LS483356.1\|WP_011054546.1\|1052535_1052724_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|269889
NZ_LS483356.1\|WP_023612213.1\|1038699_1039329_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_LS483356.1\|WP_002984444.1\|1044947_1045961_-\|6-phosphofructokinase	unknown	unknown	gnl\|CDD\|235111
NZ_LS483356.1\|WP_002984433.1\|1050414_1051200_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS483356.1\|WP_111713275.1\|1029724_1032043_-\|DNA-helicase-PcrA	unknown	unknown	gnl\|CDD\|273429
NZ_LS483356.1\|WP_002984460.1\|1037847_1038684_-\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270217

Protein	Function_ID	Function_description	E-value
NZ_LS483356.1\|WP_111713276.1\|1032154_1033165_-\|IS30-like-element-IS1239-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.10125e-103
NZ_LS483356.1\|WP_002989607.1\|1051330_1051945_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	1.14841e-31
NZ_LS483356.1\|WP_002984447.1\|1043382_1044885_-\|pyruvate-kinase	gnl\|CDD\|235619	PRK05826, PRK05826, pyruvate kinase; Provisional.	0
NZ_LS483356.1\|WP_021340779.1\|1052838_1053627_-\|streptococcal-pyrogenic-exotoxin-SpeL	gnl\|CDD\|280949	pfam02876, Stap_Strp_tox_C, Staphylococcal/Streptococcal toxin, beta-grasp domain.	3.5341e-08
NZ_LS483356.1\|WP_002984449.1\|1042607_1043165_-\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	2.3728e-38
NZ_LS483356.1\|WP_002984455.1\|1039338_1039980_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.36474e-71
NZ_LS483356.1\|WP_002984465.1\|1033657_1034980_+\|sodium:alanine-symporter-family-protein	gnl\|CDD\|224040	COG1115, AlsT, Na+/alanine symporter [Amino acid transport and metabolism].	0
NZ_LS483356.1\|WP_011017829.1\|1035099_1036335_+\|cation-diffusion-facilitator-family-transporter	gnl\|CDD\|223131	COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	4.75704e-95
NZ_LS483356.1\|WP_002984441.1\|1046040_1049151_-\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|180917	PRK07279, dnaE, DNA polymerase III DnaE; Reviewed.	0
NZ_LS483356.1\|WP_011284834.1\|1040617_1042432_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	gnl\|CDD\|234729	PRK00331, PRK00331, isomerizing glutamine--fructose-6-phosphate transaminase.	0
NZ_LS483356.1\|WP_002989617.1\|1049335_1049707_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224639	COG1725, COG1725, Predicted transcriptional regulators [Transcription].	4.0536e-49
NZ_LS483356.1\|WP_002984462.1\|1036704_1037478_-\|CAMP-factor-pore-forming-toxin-Cfa	gnl\|CDD\|369335	pfam07373, CAMP_factor, CAMP factor (Cfa). This family consists of several bacterial CAMP factor (Cfa) proteins which seem to be specific to Streptococcus species. The CAMP reaction is a synergistic lysis of erythrocytes by the interaction of an extracellular protein (CAMP factor) produced by some streptococcal species with the Staphylococcus aureus sphingomyelinase C (beta-toxin).	3.19117e-97
NZ_LS483356.1\|WP_002984437.1\|1049706_1050405_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	7.28377e-64
NZ_LS483356.1\|WP_002984453.1\|1040086_1040422_-\|alkylphosphonate-utilization-protein	gnl\|CDD\|225380	COG2824, PhnA, Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism].	1.37463e-64
NZ_LS483356.1\|WP_011054546.1\|1052535_1052724_-\|hypothetical-protein	gnl\|CDD\|269889	cd06603, GH31_GANC_GANAB_alpha, neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.	0.00788697
NZ_LS483356.1\|WP_023612213.1\|1038699_1039329_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.38566e-110
NZ_LS483356.1\|WP_002984444.1\|1044947_1045961_-\|6-phosphofructokinase	gnl\|CDD\|235111	PRK03202, PRK03202, ATP-dependent 6-phosphofructokinase.	0
NZ_LS483356.1\|WP_111713275.1\|1029724_1032043_-\|DNA-helicase-PcrA	gnl\|CDD\|273429	TIGR01073, ATP-dependent_DNA_helicase_PcrA, ATP-dependent DNA helicase PcrA. Designed to identify pcrA members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_LS483356.1\|WP_002984460.1\|1037847_1038684_-\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270217	cd00996, PBP2_AatB_like, Polar amino acids-binding domain of ATP-binding cassette transporter-like systems that belong to the type 2 periplasmic binding fold protein superfamily. This subfamily includes periplasmic binding domain of ATP-binding cassette transporter-like systems that serve as initial receptors in the ABC transport of amino acids and their derivatives in eubacteria. After binding their ligand with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically-located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The Abp proteins belong to the PBPI superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.79673e-109

>NZ_LS483356.1|WP_011284834.1|1040617_1042432_-|glutamine--fructose-6-phosphate-transaminase-(isomerizing)
MCGIVGVVGNRNATDILMQGLEKLEYRGYDSAGIFVANANQTNLIKSVGRIADLRAKIGIDVAGSTGIGHTRWATHGQSTEDNAHPHTSQTGRFVLVHNGVIENYLHIKTEFLAGHDFKGQTDTEIAVHLIGKFVEEDKLSVLEAFKKALSIIEGSYAFALMDSQATDTIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETSEFMEIHDKELVILTKDKVTVTDYDGKELIRDSYTAELDLSDIGKGTYPFYMLKEIDEQPTVMRQLISTYADETGNVQVDPAIITSIQEADRLYILAAGTSYHAGFATKNMLEQLTDTPVELGVASEWGYHMPLLSKKPMFILLSQSGETADSRQVLVKANAMGIPSLTVTNVPGSTLSREATYTMLIHAGPEIAVASTKAYTAQIAALAFLAKAVGEANGKQEALDFNLVHELSLVAQSIEATLSEKDLVAEKVQALLATTRNAFYIGRGNDYYVAMEAALKLKEISYIQCEGFAAGELKHGTISLIEEDTPVIALISSSQLVASHTRGNIQEVAARGAHVLTVVEEGLDREGDDIIVNKVHPFLAPIAMVIPTQLIAYYASLQRGLDVDKPRNLAKAVTVE
>NZ_LS483356.1|WP_002984453.1|1040086_1040422_-|alkylphosphonate-utilization-protein
MSLPNCLQCQSEYVYEDGLLLICPMCAFEWTPGEEATEEEGLVVFDSNGVRLSDGDTITVIKDLKVKGAPKDLKQGTRVKNIRLVEGDHNIDCKIDGFGAMKLKSEFVKKI
>NZ_LS483356.1|WP_002984455.1|1039338_1039980_-|amino-acid-ABC-transporter-permease
MTYIQQVLPSLLDGALVTLQVFFIVIILSIPLGAILAFLMKVPFKPLQWFLTLYVWMMRGTPLLLQLIFFYYVLPSVGISFDRMPAAILAFTLNYAAYFAEIFRGGIEAIPKGQYEAAKVLKLKPLQTIRYIILPQVFKIVLPSVFNEVINLVKDSSLVYVLGVGDLLLASKTAANRDATLAPMFIAGLIYLLLIGLVTIISKQVEKRFNYYQ
>NZ_LS483356.1|WP_023612213.1|1038699_1039329_-|amino-acid-ABC-transporter-ATP-binding-protein
MLELKNISKQFGQKTIFDGFNLTVQDGEVLSLVGPSGGGKTTLLRMLAGLESIDSGQVFYNGEDVGIDHLENRNLLGFVFQDFQLFPHLTVLDNLTLSPTITMGKQKADAKEKALDLLARLGLKEHSQVYPYSLSGGQKQRVALARAMMIDPQIIGYDEPTSALDPELRQTVEALIVQNREMGITQIVVTHDLVFAEAISDRIIRVNPK
>NZ_LS483356.1|WP_002984460.1|1037847_1038684_-|amino-acid-ABC-transporter-substrate-binding-protein
MIIKKRTVAILAIASSFFLVACQATKSLKSGDAWGVYQKQKSITVGFDNTFVPMGYKDESGKCKGFDIDLAKEVFHQYGLKVNFQAINWDMKEAELNNGKIDVIWNGYSITKERQNKVAFTDSYMRNEQIIVVKKRSDIKTISDMKHKVLGAQSASSGYDSLLRTPKLLKDFIKNKDANQYETFTQAFIDLKSDRIDGILIDKVYANYYLAKEGQLENYRMIPTTFENEAFSVGLRKEDKTLQAKINRAFRVLYQNGKFQAISEKWFGDDVATANIKS
>NZ_LS483356.1|WP_002984462.1|1036704_1037478_-|CAMP-factor-pore-forming-toxin-Cfa
MKPKHLLCLSTVVAGLALFSTMTHSVLADDASNPDTILMNNNQANLQRDALVQKLDEGHQQLEAIKHEAKGTDIEATVNKAIDAVDHMKSSIRFNTETIYDFSSIGARVEALSDAIKAIVFSTTQLTHKVEKAHTDMGFAITKLVIRIIDPFASVDAIKAQVQEIKALEEKVINYPDLQPTDRATIYTKAKLNKAIWNTRLERDKKVLGIKSFDVYNRLNKAITHAVGVQLNPTTTVQQVDDEVIAVQNALETALKS
>NZ_LS483356.1|WP_011017829.1|1035099_1036335_+|cation-diffusion-facilitator-family-transporter
MTQDPIANLKLARKGPIVSIIVYLLLSAAKLLAGYLLNASSLIADGFNNLSDIVGNVALLIGLHLASQPADANHKFGHWKIEDLSSLVTSFIMFLVGFQVLIHTIKSIFSGQQVDIDPLGAIVGIVSAFVMLGVYVFNKRLSKRVKSSALVAASKDNLADAVTSIGTSIAIIAASLHLPVIDHIAAMIITFFILKTAFDIFMESSFSLSDGFDSRHLKKYEKAILEIPKIVAVKSQRARTYGSNVYLDIVLEMNPDLSVYESHSITEKVEQLLSDQFSIYDIDIHVEPAMILEEEIFDNVAKKLYRYEKLILSKVPDYDHYIAKSFQLVDANGQTVNYEQFLNQEIYYPSNFNHFQIESISQKTMLVTYQLNGNQHTSIWRRHESWSLLFHQITPIAKRQLHHTHYRIVKM
>NZ_LS483356.1|WP_002984465.1|1033657_1034980_+|sodium:alanine-symporter-family-protein
MIALVKLIDNLVWGPPLLILLVGTGIYLTSRLGLIQILKLPRAFKLIFSDDEGHGDISSFAALATALAATVGTGNIVGVATAIKSGGPGALFWMWVAAFFGMATKYAEGVLAIKYRTKDANGHISGGPMYYIVNGMGTKWKPLAILFAGSGILVALFGIGTFAQVNSITSSLGHSFGLSPQMVSIVLAIFVAAIIFGGIHSISKVAEKVVPFMAIFYILSSLAVIFSHYQQLLPVIRLVFQSAFTPTAAIGGFAGSLMKDAIQKGIARGVFSNESGLGSAPIAAAAAKTNESVEQGLISMTGTFIDTIIICTLTGLSILVTGQWTGQLEGAPLTQSAFATVFGNLGTFGLTFSLVLFAFTTILGWSYYGERCFEFLFGITHLTYFRIVFILMVGLGGFLKLELIWVLADIVNGLMALPNLIALLALSPVVILETKHYFIK
>NZ_LS483356.1|WP_111713276.1|1032154_1033165_-|IS30-like-element-IS1239-family-transposase
MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIHNEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNYSPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNKALTGILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKGTKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGEIAIIFKYLILN
>NZ_LS483356.1|WP_111713275.1|1029724_1032043_-|DNA-helicase-PcrA
MNPLLNGMNDRQAQAVQTTEGPLLIMAGAGSGKTRVLTHRIAYLIDEKFVNPWNILAITFTNKAAREMKERALSLNPATKDTLIATFHSMCVRILRREADHIGYNRNFTIVDPGEQRTLMKRILKQLNIDPKKWNERSILGTISNAKNDLLDEKGYEAQAADMYSQIVARCYKAYQEELRRSEALDFDDLIMMTLRLFDANPDVLAYYQQRYQYIHVDEYQDTNHAQYQLIKLLASRFKNICVVGDADQSIYGWRGADMQNILDFEKDYPDAKVVLLEENYRSTKKILQAANDVINNNRNRRPKKLWTQNADGEQLVYYRANDERDEAVFVASTISNMSQELGKNFKDFAVLYRTNTQSRTIEEALLKSNIPYTMVGGTKFYSRKEIRDLIAYLTIVANPADNISFERIVNEPKRGVGPGTLDKLRQFAYESDQSLLEAASNLLMSPLKGKAAQAIMDLANSLGQLRQDLDQMSITDLAEALLEKTGYLDSLRLQNTLESQARIENIEEFLSVTKNFDESSASQEEDETGVDRLGRFLNDLALIADTDDSQAEAAEVTLMTLHAAKGLEFPVVFLIGMEEGVFPLSRASEDPDELEEERRLAYVGITRAEEVLFMTNANTRTLFGKSSYNRPTRFLKEISEELLSYKGLARPAQSSFGVRFSTETHTQFGQGMSLSEALQARKAQAQVRQSAQPMQAHTIPSASTSSVLPFGSNSSVEEVTWQIGDIAHHKKWGDGTVLEVSGSGKTMELKIKFPEVGLKKLLASVAPIEKK
>NZ_LS483356.1|WP_002984449.1|1042607_1043165_-|signal-peptidase-I
MVKRDFIRNILLLLIVIIGAILLRIFVFSTFKVSPETANTYLKSGDLVTIKKNIQPKYKDFVVYRVGKKDYVSRVIAVEGDSVTYMDDIFYLNNMVESQAYLEKMKAHYLNHAPFGTLYTDDFTVATITADKYQKVPKGKYLLLNDNRKNTNDSRRFGLINASQIKGLVTFRVLPLSDFGFVEVE
>NZ_LS483356.1|WP_002984447.1|1043382_1044885_-|pyruvate-kinase
MNKRVKIVATLGPAVEIRGGKKYGEDGYWAGQLDVEESAKKIAELIEAGANVFRFNFSHGDHKEQGDRMATVRLAEEIARQKVGFLLDTKGPEMRTELFADDAKEFSYVTGEKIRVATTQGIQSTRDVIALNVAGSLDIYDEVEVGHTILIDDGKLGLKVIDKDIATRQFIVEVENDGIIAKQKGVNIPNTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEEVREICRETGNDHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVFQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIDRNAQTLLNEYGRLDSSAFPRTNKTDVIASAVKDATHSMDIKLVVTITETGNTARAISKFRPDADILAVTFDEKVQRALMINWGVIPVLAEKPASTDDMFEVAERVAVEAGLVQSGDNIVIVAGVPVGTGGTNTMRVRTVK
>NZ_LS483356.1|WP_002984444.1|1044947_1045961_-|6-phosphofructokinase
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGDKSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILGTAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
>NZ_LS483356.1|WP_002984441.1|1046040_1049151_-|DNA-polymerase-III-subunit-alpha
MFAQLDTKTVYSFMDSLIDLNHYFERAKQFGYHTIGIMDKDNLYGAYHFIKGCQKNGLQPVLGLEVEILYQERQVLLNLIAQNTQGYHQLLKISTAKMSGKLHMDYLCQHLEGIAVIIPSKGWSDTLVVPFDYYIGVDQYTDLSHMDSKRQLIPLRTVRYFAQDDMETLHMLHAIRDNLSLAETPVVESDQELTDCQQLTTFYQTHCPQALQNLEDLVSGIYYDFDTNLKLPHFNRDKSAKQELQELTEAGLKEKGLWKEPYQSRLLHELVIISDMGFDDYFLIVWDLLRFGRSKGYYMGMGRGSAAGSLVAYALNITGIDPVQHDLLFERFLNKERYSMPDIDIDLPDIYRSEFLRYVRNRYGSDHSAQIVTFSTFGPKQAIRDVFKRFGVPEYELTNLTKKIGFKDSLATVYEKSISFRQVINSRTEFQKAFAIAKRIEGNPRQTSIHAAGIVMSDDTLTNHIPLKSGDDMMITQYDAHAVEANGLLKMDFLGLRNLTFVQKMQEKVAKDYGCQIDIAAIDLEDPQTLALFAKGDTKGIFQFEQNGAINLLKRIKPQRFEEIVATTSLNRPGASDYTTNFIKRREGQEKIDLIDPVIAPILEPTYGIMLYQEQVMQIAQVYAGFTLGKADLLRRAMSKKNLQEMQKMEEDFIASAKHLGRAEETARGLFKRMEKFAGYGFNRSHAFAYSALAFQLAYFKAHYPAVFYDIMMNYSSSDYITDALESDFQVAQVTINSIPYTDKIEASKIYMGLKNIKGLPRDFAYWIIEQRPFNSVEDFLTRTPEKYQKKVFLEPLIKIGLFDCFEPNRKKILDNLDGLLVFVNELGSLFSDSSFSWVDAKDYSATEKYSLEQEIVGVGMSKHPLIDIAEKSTQTFTPISQLVKESEAVVLIQIDSIRIIRTKTSGQQMAFLSVNDTKKKLDVTLFPQEYAIYKDQLKEGEFYYLKGRIKERDHRLQMVCQQVQMAISQKYWLLVENHQFDSQISEILGAFPGTTPVVIHYQKNKETIALTKIQVHVTENLKEKLRPFVLKTVFR
>NZ_LS483356.1|WP_002989617.1|1049335_1049707_+|GntR-family-transcriptional-regulator
MSWKFDEKSPIYAQIAQHVMMQIISQEIKSGDQLPTVREYAEIAGVNPNTMQRAFTELEREGMVYSQRTAGRFVTDDQKLIARKRRELAISELESFITNMTKMGFSHTEIIPVLTSFLKEDSQ
>NZ_LS483356.1|WP_002984437.1|1049706_1050405_+|ABC-transporter-ATP-binding-protein
MAHLLQLHHVSKSYREKKAIDDLTITIPNGKIIGLLGPNGSGKTTLIKLINGLLQPNKGEIVIDGYRPCVETKKIISYLPDTTYLNENMRIKDMLEFFSDFYSDFDKSKATSLLRDLELDPEDRFKTLSKGNKEKVQLILVMSRKARLYVLDEPIGGVDPAARDYILKTIINSYCENASVIISTHLISDIEPILDEVIFLKQGRLFLSGNADDLRQEYQQSIDSLFRETYKV
>NZ_LS483356.1|WP_002984433.1|1050414_1051200_+|hypothetical-protein
MFGKLLKYEFRSIGKWYFALNAFVIAIAAILSFTIKLFAQSNSDGLFGVLTNKMLPLTLGLTFGSLIAGSLLSTLLIIIKRFSKSVFGREGYLTLTLPVNSHQIILSKLLASFICSVFNTIILAFAIAIVIVPMFNINELLEGFFNSFKMDYFINMLTVLAYVLLSTFTSILLIYLSISIGQLFSNRRGLMAFIAYFILVILISVAATYVHSHIFNINTSADSFPFTEQKTIYLLILEQFIEMIMFYLATNFIIKNKLNLQ
>NZ_LS483356.1|WP_002989607.1|1051330_1051945_-|TVP38/TMEM64-family-protein
MTKRNSKAYILWQKIIKILGIIALIGTFFLAFWLYRLGILNDSNALKDLVQRYRLWGPFVFIVVQIIQIVFPVIPGGLTTVAGFLIFGPVTGFIYNYVGIIIGSIVLFLLVKTYGRKFILLFVNDKTFYKYERRLETPGYEKLFIFCMASPVSPADIMVMITGLTDMSLKRFVTILLITKPISIIGYSYLFIFGKDVISWFLQH
>NZ_LS483356.1|WP_011054546.1|1052535_1052724_-|hypothetical-protein
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
>NZ_LS483356.1|WP_021340779.1|1052838_1053627_-|streptococcal-pyrogenic-exotoxin-SpeL
MRIFLHQNCRLVNMSTTFFIVVLSLMVFSVRMVSAEGTINIKDIYSPRWDVDKTLSPTTLREIYNRDTIKKVNKPITGKRGTQVIMDAQHKTKVWEFDDYNFIISSNLHPSVEGKFNVGDNVDVFGLALSAEVFSKDQIHSINGGLVKVNERKGAGKTIYMNVFIDGHKKDDTSKYKITFEKSPVTFQEVDVRLRKSFMLNDEIKLYQYDSKVLSGNWEFHGSGEKEEGADLFKYPDYRYNNLIDIDKKSHIDVYLFTNKEN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

41607 : 50035

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004218736.1\|41607_43062_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.7e-54	33.3
WP_002986701.1\|43089_44112_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	6.9e-63	41.4
WP_002986700.1\|44279_44834_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-25	36.1
WP_002986697.1\|45017_46565_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	E3SNU8	Prochlorococcus_phage	9.8e-45	52.4
WP_111713102.1\|46623_47748_-	SH3 domain-containing protein	F8HGP2	Streptococcus_phage	7.7e-07	28.6
WP_111713103.1\|48000_49266_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_002987716.1\|49543_50035_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.2e-18	42.3

DBSCAN-SWA_2

168436 : 251566

Streptococcus_phage(41.67%)

holin,tRNA,capsid,tail,transposase,protease,integrase,head,terminase,portal

attL 188035:188052|attR 232608:232625

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002986372.1\|168436_170938_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	65.7
WP_002986370.1\|171244_172678_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002986367.1\|172748_173027_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002986362.1\|173149_173635_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002986359.1\|173725_174388_+	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	NA	NA	NA	NA
WP_002987909.1\|174392_175256_+	L-ribulose-5-phosphate 3-epimerase	NA	NA	NA	NA
WP_002987910.1\|175257_175962_+	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_002986350.1\|176286_177933_+	transcription antiterminator	NA	NA	NA	NA
WP_002986347.1\|178185_179277_+	L-ascorbate 6-phosphate lactonase	NA	NA	NA	NA
WP_002986345.1\|179765_180962_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-30	39.2
WP_002986341.1\|180977_182705_+	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_111713128.1\|182835_185478_+	DNA polymerase I	A0A142F1Q9	Bacillus_phage	2.5e-64	35.9
WP_002986334.1\|185664_186120_+	CoA-binding protein	NA	NA	NA	NA
WP_002986328.1\|186171_186639_+	peroxide-responsive transcriptional repressor PerR	NA	NA	NA	NA
WP_014635671.1\|186764_187898_+\|transposase	ISAs1-like element IS1548 family transposase	NA	NA	NA	NA
188035:188052	attL	NA	NA	NA	NA
WP_011054151.1\|188067_188931_-	DUF975 family protein	NA	NA	NA	NA
WP_002986319.1\|189149_190292_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.9e-86	43.9
WP_002987947.1\|190509_190821_+	hypothetical protein	NA	NA	NA	NA
WP_002986314.1\|190824_191364_+	biotin transporter BioY	NA	NA	NA	NA
WP_002986311.1\|191503_192283_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_002992549.1\|192282_192798_+	nucleoside deaminase	NA	NA	NA	NA
WP_020833235.1\|193411_194644_-	S-layer protein	NA	NA	NA	NA
WP_002986298.1\|195019_195721_-\|integrase	site-specific integrase	A0A141E0H2	Streptococcus_phage	4.1e-83	65.8
WP_002986291.1\|196288_196822_-	hypothetical protein	A0A1S5SAH9	Streptococcus_phage	1.3e-20	55.3
WP_002986288.1\|196833_197214_-	hypothetical protein	Q938N7	Temperate_phage	1.4e-40	64.0
WP_032467305.1\|197223_197574_-	helix-turn-helix transcriptional regulator	A0A1S5SFC6	Streptococcus_phage	4.8e-32	60.3
WP_002986282.1\|197884_198100_+	hypothetical protein	M1Q1B4	Streptococcus_phage	2.2e-24	78.6
WP_002986270.1\|198304_199048_+	ORF6C domain-containing protein	A3F617	Streptococcus_phage	1.5e-120	86.1
WP_002986266.1\|199123_199336_+	hypothetical protein	NA	NA	NA	NA
WP_002986264.1\|199369_199561_+	hypothetical protein	NA	NA	NA	NA
WP_002986261.1\|199592_199748_+	hypothetical protein	NA	NA	NA	NA
WP_002986259.1\|199749_200292_-	hypothetical protein	NA	NA	NA	NA
WP_002986256.1\|200422_200683_+	hypothetical protein	A0A1S5SAL2	Streptococcus_phage	1.1e-28	73.3
WP_002986254.1\|200701_200890_+	hypothetical protein	NA	NA	NA	NA
WP_111680752.1\|200876_202223_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	9.3e-209	84.9
WP_002986249.1\|202209_202812_+	hypothetical protein	A0A1P8VVT8	Streptococcus_phage	1.7e-106	93.0
WP_002986245.1\|202789_203536_+	conserved phage C-terminal domain-containing protein	A0A1P8VVR3	Streptococcus_phage	2.2e-135	96.8
WP_002986242.1\|203536_204361_+	ATP-binding protein	A0A1P8VVV9	Streptococcus_phage	1.4e-127	79.6
WP_002986238.1\|204360_204588_+	hypothetical protein	C5J991	Streptococcus_phage	7.1e-13	50.7
WP_111713441.1\|204601_204778_+	peptide chain release factor 2	NA	NA	NA	NA
WP_002986233.1\|204774_205059_+	hypothetical protein	A0A097PAV1	Streptococcus_pyogenes_phage	5.9e-41	93.6
WP_050452837.1\|205061_205700_+	DNA cytosine methyltransferase	A0A140HLV8	Bacillus_phage	2.7e-65	65.6
WP_002986227.1\|205687_205843_+	hypothetical protein	A0A1S5SFL7	Streptococcus_phage	1.6e-08	60.5
WP_002986215.1\|206869_207202_+	hypothetical protein	A0A1S5SCX1	Streptococcus_phage	1.2e-32	57.4
WP_002986212.1\|207194_207524_+	helix-turn-helix transcriptional regulator	A0A1P8VVV5	Streptococcus_phage	3.2e-22	45.5
WP_002986209.1\|207520_207694_+	hypothetical protein	A0A1J0MGB9	Staphylococcus_phage	1.1e-05	46.9
WP_002986206.1\|207696_207945_+	hypothetical protein	NA	NA	NA	NA
WP_002986201.1\|208129_208279_+	hypothetical protein	NA	NA	NA	NA
WP_002986198.1\|208247_208448_+	hypothetical protein	NA	NA	NA	NA
WP_002986196.1\|208471_208891_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SF97	Streptococcus_phage	1.1e-19	42.0
WP_032467304.1\|208985_209549_+\|integrase	site-specific integrase	A0A1S5SCL7	Streptococcus_phage	5.4e-62	61.5
WP_002986191.1\|209720_210014_+	hypothetical protein	NA	NA	NA	NA
WP_002986189.1\|210010_210340_+	HNH endonuclease	A0A1S7FZ53	Listeria_phage	6.7e-20	49.5
WP_002986187.1\|210461_210809_+	hypothetical protein	E2ELI1	Clostridium_phage	4.0e-07	34.5
WP_002986185.1\|210789_212448_+\|terminase	terminase large subunit	E2ELI2	Clostridium_phage	4.0e-129	44.4
WP_002986182.1\|212646_213882_+\|portal	phage portal protein	A0A1S7FYX7	Listeria_phage	3.6e-74	37.6
WP_002986180.1\|213885_214602_+\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	1.4e-38	42.9
WP_002986177.1\|214637_215831_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.7e-41	30.8
WP_002986176.1\|215845_216133_+	hypothetical protein	NA	NA	NA	NA
WP_002986174.1\|216152_216446_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_111680753.1\|216447_216825_+\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_002986170.1\|216796_217168_+	hypothetical protein	NA	NA	NA	NA
WP_002986168.1\|217176_217599_+	hypothetical protein	A0A1S7FZ20	Listeria_phage	3.1e-25	48.5
WP_002986166.1\|217609_218197_+	hypothetical protein	A0A1B1P778	Bacillus_phage	1.1e-28	36.4
WP_002986164.1\|218217_218589_+	hypothetical protein	NA	NA	NA	NA
WP_002986162.1\|218624_218783_+	hypothetical protein	NA	NA	NA	NA
WP_111713129.1\|218856_222258_+\|tail	phage tail tape measure protein	J7KDT4	Streptococcus_phage	9.5e-93	58.8
WP_111680754.1\|222257_222965_+\|tail	phage tail family protein	A0A1B1P761	Bacillus_phage	1.3e-28	35.2
WP_002986155.1\|222961_225010_+\|tail	phage tail protein	Q938K1	Temperate_phage	2.2e-121	44.0
WP_111713130.1\|225009_226026_+	hyaluronoglucosaminidase	Q938K0	Temperate_phage	1.2e-157	86.7
WP_111713131.1\|226041_228057_+	gp58-like family protein	Q938J9	Temperate_phage	3.6e-180	74.1
WP_111713132.1\|228068_228500_+	DUF1617 family protein	Q938J8	Temperate_phage	4.0e-73	99.3
WP_111713133.1\|228502_229120_+	DUF1366 domain-containing protein	Q938J7	Temperate_phage	8.3e-80	89.8
WP_002986151.1\|229129_229585_+\|holin	phage holin family protein	A0A0M4R3G6	Streptococcus_phage	8.9e-63	80.8
WP_002986150.1\|229696_230902_+	glucosaminidase domain-containing protein	Q938J4	Temperate_phage	3.1e-208	84.5
WP_032467302.1\|231017_232190_-	streptodornase Sda1	A7J2B8	Streptococcus_phage	1.4e-75	49.5
WP_002986147.1\|232428_232611_+	hypothetical protein	A3F673	Streptococcus_phage	1.1e-19	80.0
WP_002986145.1\|232660_232852_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
232608:232625	attR	NA	NA	NA	NA
WP_010921857.1\|233523_234228_+	streptococcal pyrogenic exotoxin SpeG	NA	NA	NA	NA
WP_014635263.1\|234683_236033_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_111713134.1\|236381_237890_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011017305.1\|238577_239249_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002986125.1\|239347_240247_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	9.6e-77	52.2
WP_002986123.1\|240279_241296_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_111713135.1\|241593_242043_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_031488680.1\|242035_243742_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.1e-36	26.9
WP_002986115.1\|243744_245529_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.3e-44	28.1
WP_011054158.1\|245646_246414_+	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_111713136.1\|246523_246970_+	dUTP diphosphatase	A0A1P8BLJ0	Lactococcus_phage	1.5e-35	53.5
WP_002986109.1\|247050_248412_+	DNA repair protein RadA	NA	NA	NA	NA
WP_111713137.1\|248600_249098_+	carbonic anhydrase	NA	NA	NA	NA
WP_011017311.1\|249228_249939_+	TIGR00266 family protein	NA	NA	NA	NA
WP_111684545.1\|250120_251566_+\|tRNA	glutamate--tRNA ligase	A0A2K9L481	Tupanvirus	6.8e-08	31.2

DBSCAN-SWA_3

377507 : 383539

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032464192.1\|377507_378143_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.2e-65	63.4
WP_111713154.1\|378160_379036_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	4.1e-72	47.9
WP_032467296.1\|379054_379294_+	Tpl protein	NA	NA	NA	NA
WP_002985838.1\|379697_380021_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	1.3e-28	59.4
WP_002985836.1\|380025_380889_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.7e-115	75.0
WP_002985833.1\|380915_381308_+	hypothetical protein	NA	NA	NA	NA
WP_002985831.1\|381354_381984_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_111713155.1\|382281_382638_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.1e-39	65.8
WP_111713156.1\|382711_383539_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	3.2e-127	79.1

DBSCAN-SWA_4

563960 : 573629

Streptococcus_phage(50.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_111713180.1\|563960_566456_+	bifunctional DnaQ family exonuclease/ATP-dependent helicase	A0A1X9I5C8	Streptococcus_phage	1.1e-202	48.3
WP_111713181.1\|566392_567373_-\|transposase	IS30-like element IS1239 family transposase	H7BW61	unidentified_phage	2.7e-32	35.0
WP_002985439.1\|567882_569076_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002985437.1\|569096_570443_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.1e-55	30.8
WP_002985434.1\|570856_571747_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	8.8e-06	29.8
WP_011017561.1\|571743_572721_+	YvcK family protein	A1IMD5	Streptococcus_phage	1.2e-138	74.2
WP_063631823.1\|572717_573629_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.7e-105	64.7

DBSCAN-SWA_5

657559 : 668162

Streptococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_111713196.1\|657559_659770_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.3e-268	69.2
WP_002985142.1\|659877_661041_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.4e-143	65.1
WP_002985140.1\|661037_661724_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	7.0e-88	68.9
WP_002985136.1\|661817_662984_+	chorismate synthase	A0A291AU41	Pandoravirus	4.5e-34	32.8
WP_111713197.1\|663044_663386_+	YlbF/YmcA family competence regulator	A0A1X9I5Y8	Streptococcus_phage	5.0e-18	39.3
WP_002985132.1\|663606_664959_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	4.5e-30	24.0
WP_002990257.1\|665046_666315_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_032467286.1\|666344_666785_-	membrane protein	NA	NA	NA	NA
WP_002985123.1\|667019_668162_+	cysteine desulfurase	A0A1X6WFP1	Pacmanvirus	4.1e-24	27.0

DBSCAN-SWA_6

759944 : 872310

110

Streptococcus_phage(38.33%)

holin,tRNA,capsid,tail,transposase,integrase,terminase,portal

attL 774247:774297|attR 816381:816431

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032461034.1\|759944_760844_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_010922191.1\|760916_762155_+	GTPase HflX	NA	NA	NA	NA
WP_002990114.1\|762147_762783_+	cystathionine beta-lyase	NA	NA	NA	NA
WP_111713215.1\|762797_763727_+	ribonuclease Z	NA	NA	NA	NA
WP_111713216.1\|763726_764491_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_111713217.1\|764487_766698_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.1e-70	30.0
WP_002984891.1\|766847_767366_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.7e-30	42.9
WP_002984890.1\|767446_768130_+	DnaD domain-containing protein	Q938N2	Temperate_phage	2.9e-09	36.8
WP_010922193.1\|768126_768783_+	endonuclease III	NA	NA	NA	NA
WP_002990104.1\|768854_769541_+\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_002984887.1\|769530_770319_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_032462948.1\|770358_771465_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_010922195.1\|771522_772392_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	3.2e-101	64.2
WP_002984882.1\|772391_772985_+	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	H9NC63	Sphingomonas_phage	1.3e-08	29.5
WP_023612000.1\|773228_774269_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.1e-68	43.9
774247:774297	attL	NA	NA	NA	NA
WP_111713218.1\|774351_775491_-\|integrase	site-specific integrase	A1EAB7	Streptococcus_phage	1.3e-118	56.1
WP_023613222.1\|775610_776468_-	DNA adenine methylase	A0A2H4UUI2	Bodo_saltans_virus	8.1e-17	29.7
WP_023613205.1\|776506_778171_-	AAA family ATPase	NA	NA	NA	NA
WP_111690776.1\|778172_778556_-	ImmA/IrrE family metallo-endopeptidase	A0A1P8VVK5	Streptococcus_phage	1.2e-52	76.0
WP_011888679.1\|778539_778881_-	helix-turn-helix transcriptional regulator	J7KJZ4	Streptococcus_phage	1.2e-48	85.8
WP_014635614.1\|779078_779291_+	DNA-binding protein	J7KBP9	Streptococcus_phage	9.2e-31	95.7
WP_111713219.1\|779318_780038_+	phage antirepressor KilAC domain-containing protein	M1Q1T4	Streptococcus_phage	1.5e-88	70.7
WP_110410816.1\|780041_780392_+	hypothetical protein	NA	NA	NA	NA
WP_032461901.1\|780366_780681_-	hypothetical protein	NA	NA	NA	NA
WP_111713220.1\|780831_781017_+	helix-turn-helix transcriptional regulator	J7KH19	Streptococcus_phage	6.8e-22	82.0
WP_014411880.1\|781095_781407_+	hypothetical protein	A0A1S5SA25	Streptococcus_phage	1.4e-43	78.6
WP_011888947.1\|781408_781579_+	hypothetical protein	A7J273	Streptococcus_phage	1.2e-20	89.3
WP_000049475.1\|781571_781775_+	hypothetical protein	NA	NA	NA	NA
WP_002983407.1\|782301_782505_+	hypothetical protein	A7J276	Streptococcus_phage	9.4e-33	100.0
WP_002988708.1\|782592_782892_+	hypothetical protein	A7J277	Streptococcus_phage	1.8e-43	100.0
WP_011888943.1\|782891_784049_+	DUF2800 domain-containing protein	A7J278	Streptococcus_phage	1.0e-216	98.2
WP_086934854.1\|784057_784621_+	DUF2815 family protein	D2J040	Enterococcus_phage	3.3e-51	58.5
WP_015898617.1\|784663_786586_+	DNA polymerase	A7J280	Streptococcus_phage	0.0e+00	98.9
WP_111713221.1\|786590_788975_+	DNA primase	A7J282	Streptococcus_phage	2.8e-285	97.6
WP_023613183.1\|789340_789616_+	VRR-NUC domain-containing protein	A7J283	Streptococcus_phage	1.3e-45	97.8
WP_111694889.1\|789612_790935_+	DEAD/DEAH box helicase family protein	A7J284	Streptococcus_phage	3.0e-252	97.7
WP_164972002.1\|790935_791106_+	hypothetical protein	A7J285	Streptococcus_phage	9.0e-21	92.3
WP_011054882.1\|791098_791371_+	hypothetical protein	A7J287	Streptococcus_phage	5.7e-25	73.3
WP_011054881.1\|791503_791920_+	transcriptional regulator	A7J289	Streptococcus_phage	3.3e-72	99.3
WP_111713222.1\|792039_792735_+\|terminase	terminase	A0A2H4J4R0	uncultured_Caudovirales_phage	3.4e-29	34.5
WP_165363098.1\|792727_794023_+\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	7.8e-221	85.0
WP_111713223.1\|794036_795539_+\|portal	phage portal protein	Q938L2	Temperate_phage	3.8e-280	99.4
WP_111694888.1\|795543_797022_+\|capsid	phage minor capsid protein	Q938L1	Temperate_phage	9.0e-274	99.6
WP_002986829.1\|796993_797233_+	hypothetical protein	Q938L0	Temperate_phage	2.8e-36	100.0
WP_111694887.1\|797294_797561_+	hypothetical protein	Q938K9	Temperate_phage	1.1e-36	95.5
WP_010922079.1\|797686_798301_+	hypothetical protein	Q938K8	Temperate_phage	3.1e-95	95.0
WP_010922080.1\|798304_799123_+\|capsid	N4-gp56 family major capsid protein	Q79S85	Temperate_phage	4.0e-146	100.0
WP_010922081.1\|799176_799593_+	hypothetical protein	Q938K7	Temperate_phage	4.3e-56	99.1
WP_010922082.1\|799582_799915_+	hypothetical protein	Q79S86	Temperate_phage	9.6e-59	100.0
WP_010922083.1\|799914_800271_+	hypothetical protein	Q79S88	Temperate_phage	4.5e-62	100.0
WP_011018121.1\|800267_800666_+\|capsid	phage capsid protein	Q79S87	Temperate_phage	1.3e-70	99.2
WP_111713224.1\|800665_801127_+\|tail	phage tail protein	Q938K6	Temperate_phage	1.4e-60	78.8
WP_111713225.1\|801170_801605_+	hypothetical protein	Q938K5	Temperate_phage	5.5e-70	98.6
WP_111713226.1\|801608_802190_+	hypothetical protein	Q938K4	Temperate_phage	1.6e-104	98.4
WP_111713227.1\|802179_805440_+	tape measure protein	Q938K3	Temperate_phage	0.0e+00	99.3
WP_011888697.1\|805436_806153_+\|tail	phage tail family protein	Q938K2	Temperate_phage	1.2e-135	99.2
WP_111713228.1\|806149_808297_+\|tail	phage tail protein	Q938K1	Temperate_phage	0.0e+00	93.2
WP_111713229.1\|808296_809415_+	hyaluronoglucosaminidase	A7J2A8	Streptococcus_phage	1.5e-135	78.3
WP_111713230.1\|809429_811316_+	gp58-like family protein	Q938J9	Temperate_phage	1.9e-215	84.4
WP_063662164.1\|811327_811759_+	DUF1617 family protein	Q938J8	Temperate_phage	1.4e-70	96.5
WP_111713231.1\|811761_812373_+	DUF1366 domain-containing protein	Q938J7	Temperate_phage	1.0e-82	92.6
WP_011017397.1\|812384_812657_+	hypothetical protein	A7J2B2	Streptococcus_phage	5.5e-36	91.0
WP_003058873.1\|812653_812881_+\|holin	phage holin	A7J2B3	Streptococcus_phage	2.0e-31	100.0
WP_015898599.1\|812997_814332_+	lysin	Q5MY96	Streptococcus_phage	5.9e-248	93.2
WP_080286815.1\|814605_815283_+	streptococcal pyrogenic exotoxin SpeI	A0A075M4C7	Staphylococcus_phage	1.2e-26	32.0
WP_002984880.1\|816623_817100_+	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
816381:816431	attR	NA	NA	NA	NA
WP_111713232.1\|817157_818339_+	AI-2E family transporter	NA	NA	NA	NA
WP_111713233.1\|818328_819576_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_111713234.1\|819634_821287_-	PavA family fibronectin-binding protein Fbp54	A0A1J0F9J4	Only_Syngen_Nebraska_virus	1.7e-07	41.0
WP_111713235.1\|821640_822639_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_168389613.1\|822589_822808_+	hypothetical protein	NA	NA	NA	NA
WP_002989993.1\|822983_823853_+	ABC transporter permease	NA	NA	NA	NA
WP_002989991.1\|823849_824608_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	5.9e-11	28.3
WP_002984872.1\|824811_826473_+	ribonuclease J	NA	NA	NA	NA
WP_002984871.1\|826605_827391_+	esterase family protein	NA	NA	NA	NA
WP_002984870.1\|827420_827747_+	hypothetical protein	NA	NA	NA	NA
WP_002984869.1\|827792_829700_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.6e-55	31.3
WP_002989983.1\|829984_830953_+	thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha	NA	NA	NA	NA
WP_111713447.1\|831011_832010_+	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_111713236.1\|832194_833604_+	dihydrolipoamide acetyltransferase	NA	NA	NA	NA
WP_002989978.1\|833931_835695_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.2e-33	25.5
WP_111713237.1\|836367_838647_-	polysaccharide lyase 8 family protein	NA	NA	NA	NA
WP_002992006.1\|838879_839869_+	lipoate--protein ligase	A0A2H4UVX5	Bodo_saltans_virus	8.2e-13	25.2
WP_010922242.1\|839977_840769_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_172452788.1\|840768_842112_-	Mur ligase family protein	NA	NA	NA	NA
WP_002984858.1\|842218_843070_+	TIGR00159 family protein	NA	NA	NA	NA
WP_002989967.1\|843066_844023_+	YbbR-like domain-containing protein	NA	NA	NA	NA
WP_010922245.1\|844076_845432_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_111713239.1\|845565_846207_+	hypothetical protein	NA	NA	NA	NA
WP_111713240.1\|846269_847400_+	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_111713241.1\|847409_848162_+	acyl-[acyl-carrier-protein] thioesterase	NA	NA	NA	NA
WP_002984852.1\|848161_848926_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_014635437.1\|848925_849558_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_111713243.1\|852664_854497_+	elongation factor 4	A0A2K9L2P9	Tupanvirus	2.2e-19	41.0
WP_172452797.1\|854781_855729_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_111713245.1\|855914_856352_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_111713246.1\|856481_857501_+	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_111713247.1\|857707_858133_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002989934.1\|858159_858651_+	PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB	NA	NA	NA	NA
WP_002984844.1\|858667_859477_+	PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC	NA	NA	NA	NA
WP_002989931.1\|859473_860301_+	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_002984838.1\|860436_862086_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.8e-12	33.3
WP_002984836.1\|862089_862878_+	response regulator transcription factor	NA	NA	NA	NA
WP_011017728.1\|862871_863918_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_111688298.1\|864039_865437_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_002984829.1\|865538_867335_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_002989923.1\|867519_868122_+	nitroreductase family protein	NA	NA	NA	NA
WP_111713248.1\|868246_869656_+	dipeptidase PepV	NA	NA	NA	NA
WP_111713249.1\|869723_871100_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_111713250.1\|871302_872310_+\|transposase	IS30-like element IS1239 family transposase	H7BW61	unidentified_phage	2.1e-32	35.0

DBSCAN-SWA_7

1017924 : 1100891

Streptococcus_phage(51.56%)

tRNA,capsid,tail,transposase,protease,integrase,head,terminase,portal

attL 1052366:1052425|attR 1097519:1097596

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002989678.1\|1017924_1018809_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_009880635.1\|1018924_1020265_-	DUF2130 domain-containing protein	NA	NA	NA	NA
WP_002984488.1\|1020361_1021318_-	aromatic acid exporter family protein	NA	NA	NA	NA
WP_002993908.1\|1021328_1021925_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_111713274.1\|1022016_1024653_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_030126662.1\|1024667_1025369_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.9e-36	37.0
WP_002984482.1\|1025486_1026029_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002984480.1\|1026171_1026813_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002994467.1\|1026975_1027464_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002984476.1\|1027474_1027675_-	CsbD family protein	J7KJ36	Streptococcus_phage	1.8e-07	50.0
WP_002984475.1\|1027715_1028255_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002984473.1\|1028267_1028456_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002984470.1\|1028466_1029078_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002984469.1\|1029114_1029363_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_111713275.1\|1029724_1032043_-	DNA helicase PcrA	A7KV33	Bacillus_phage	2.1e-131	41.2
WP_111713276.1\|1032154_1033165_-\|transposase	IS30-like element IS1239 family transposase	H7BW61	unidentified_phage	2.1e-32	35.0
WP_002984465.1\|1033657_1034980_+	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_011017829.1\|1035099_1036335_+	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_002984462.1\|1036704_1037478_-	CAMP factor pore-forming toxin Cfa	NA	NA	NA	NA
WP_002984460.1\|1037847_1038684_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023612213.1\|1038699_1039329_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-27	35.5
WP_002984455.1\|1039338_1039980_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_002984453.1\|1040086_1040422_-	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_011284834.1\|1040617_1042432_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.2e-97	38.7
WP_002984449.1\|1042607_1043165_-	signal peptidase I	NA	NA	NA	NA
WP_002984447.1\|1043382_1044885_-	pyruvate kinase	NA	NA	NA	NA
WP_002984444.1\|1044947_1045961_-	6-phosphofructokinase	NA	NA	NA	NA
WP_002984441.1\|1046040_1049151_-	DNA polymerase III subunit alpha	A0A2L1IZ23	Streptomyces_phage	1.4e-119	29.8
WP_002989617.1\|1049335_1049707_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002984437.1\|1049706_1050405_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.6e-09	27.3
WP_002984433.1\|1050414_1051200_+	hypothetical protein	NA	NA	NA	NA
WP_002989607.1\|1051330_1051945_-	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	6.2e-51	52.3
1052366:1052425	attL	NA	NA	NA	NA
WP_011054546.1\|1052535_1052724_-	hypothetical protein	A3F673	Streptococcus_phage	1.2e-21	84.7
WP_021340779.1\|1052838_1053627_-	streptococcal pyrogenic exotoxin SpeL	Q938J1	Temperate_phage	9.1e-47	41.4
WP_014635497.1\|1053908_1054622_-	streptococcal pyrogenic exotoxin SpeM	Q938J1	Temperate_phage	9.0e-78	59.5
WP_011054729.1\|1054925_1055792_-	DUF334 domain-containing protein	Q938J2	Temperate_phage	3.7e-134	100.0
WP_011017840.1\|1055779_1056304_-	DUF4065 domain-containing protein	Q938J3	Temperate_phage	4.0e-99	100.0
WP_111713277.1\|1056443_1057640_-	streptodornase Sda1	Q938J4	Temperate_phage	1.8e-200	84.2
WP_111713278.1\|1057750_1057936_-	hypothetical protein	Q938J5	Temperate_phage	1.1e-24	96.7
WP_111713279.1\|1057932_1058232_-	hypothetical protein	Q938J6	Temperate_phage	6.7e-35	79.2
WP_111713280.1\|1058242_1058860_-	DUF1366 domain-containing protein	Q938J7	Temperate_phage	1.5e-81	90.7
WP_002987513.1\|1058862_1059294_-	DUF1617 family protein	Q938J8	Temperate_phage	1.1e-73	100.0
WP_111713281.1\|1059305_1061342_-	gp58-like family protein	Q938J9	Temperate_phage	9.1e-184	71.4
WP_111713282.1\|1061351_1062359_-	hyaluronoglucosaminidase	Q938K0	Temperate_phage	7.6e-107	62.3
WP_111713283.1\|1062355_1064500_-\|tail	phage tail protein	Q938K1	Temperate_phage	0.0e+00	90.9
WP_111688276.1\|1064496_1065204_-\|tail	phage tail family protein	Q938K2	Temperate_phage	1.1e-91	69.8
WP_111713284.1\|1065203_1069127_-\|tail	phage tail tape measure protein	J7KDT4	Streptococcus_phage	5.0e-239	48.6
WP_021299462.1\|1069139_1069289_-	hypothetical protein	J7KBS0	Streptococcus_phage	1.7e-15	85.7
WP_011017586.1\|1069336_1069663_-	hypothetical protein	J7KK85	Streptococcus_phage	8.3e-39	75.0
WP_011017585.1\|1069715_1070324_-	hypothetical protein	J7KKC8	Streptococcus_phage	6.7e-74	71.9
WP_011017584.1\|1070339_1070765_-	hypothetical protein	J7KBZ9	Streptococcus_phage	7.2e-67	84.4
WP_003055321.1\|1070761_1071139_-	HK97 gp10 family phage protein	J7KDM3	Streptococcus_phage	1.5e-47	76.0
WP_003055344.1\|1071135_1071483_-\|head	phage head closure protein	J7KJ42	Streptococcus_phage	2.6e-46	80.9
WP_021340811.1\|1071479_1071782_-\|head,tail	phage head-tail connector protein	J7KC36	Streptococcus_phage	3.0e-43	88.8
WP_021340812.1\|1071926_1073111_-\|capsid	phage major capsid protein	J7KJ82	Streptococcus_phage	1.5e-162	76.6
WP_032465106.1\|1073135_1073801_-\|protease	Clp protease ClpP	M1Q115	Streptococcus_phage	1.9e-90	77.7
WP_111688275.1\|1073778_1074999_-\|portal	phage portal protein	J7KDU3	Streptococcus_phage	5.8e-186	81.9
WP_002985363.1\|1075032_1075257_-	hypothetical protein	Q938K9	Temperate_phage	3.6e-17	61.4
WP_002985365.1\|1075249_1075420_-	hypothetical protein	J7KK43	Streptococcus_phage	2.3e-08	62.5
WP_021340859.1\|1075416_1077171_-\|terminase	terminase large subunit	J7KKD1	Streptococcus_phage	0.0e+00	96.1
WP_002985371.1\|1077185_1077653_-\|terminase	phage terminase small subunit P27 family	J7KC46	Streptococcus_phage	3.9e-82	98.7
WP_029714359.1\|1077821_1078163_-	HNH endonuclease	J7KH36	Streptococcus_phage	9.6e-54	89.8
WP_001132273.1\|1078398_1078584_+	type II toxin-antitoxin system HicA family toxin	D6PSW1	Lactobacillus_phage	1.7e-09	54.0
WP_002987543.1\|1078635_1079013_+	type II toxin-antitoxin system HicB family antitoxin	I3NLB2	Bifidobacterium_phage	3.3e-15	44.0
WP_002990048.1\|1079328_1079541_+	hypothetical protein	NA	NA	NA	NA
WP_011284864.1\|1079630_1080545_-	hypothetical protein	NA	NA	NA	NA
WP_011017866.1\|1081465_1081906_-	ArpU family transcriptional regulator	Q938L8	Temperate_phage	5.0e-79	100.0
WP_021340848.1\|1082178_1082814_-	SAM-dependent DNA methyltransferase	L0P368	Streptococcus_phage	2.5e-87	68.4
WP_002987468.1\|1082813_1083215_-	hypothetical protein	NA	NA	NA	NA
WP_021340166.1\|1083312_1083540_-	hypothetical protein	A3F630	Streptococcus_phage	1.9e-26	76.0
WP_021340844.1\|1083543_1084029_-	class I SAM-dependent methyltransferase	A0A097PAU8	Streptococcus_pyogenes_phage	4.6e-94	98.8
WP_032459898.1\|1084032_1084317_-	hypothetical protein	A3F628	Streptococcus_phage	8.6e-40	91.5
WP_021340843.1\|1084313_1084727_-	hypothetical protein	Q938M1	Temperate_phage	2.4e-35	63.8
WP_011018137.1\|1084723_1085008_-	DUF3310 domain-containing protein	A0A1P8VVP5	Streptococcus_phage	2.7e-49	97.9
WP_032459900.1\|1085249_1085606_-	hypothetical protein	A0A097PAU4	Streptococcus_pyogenes_phage	4.6e-59	96.6
WP_032459901.1\|1085589_1085910_-	VRR-NUC domain-containing protein	A0A1P8VVL5	Streptococcus_phage	5.5e-51	94.3
WP_021340849.1\|1086569_1088045_-	nucleoside triphosphatase	A0A1P8VVM0	Streptococcus_phage	2.0e-249	87.1
WP_014411877.1\|1088034_1088847_-	bifunctional DNA primase/polymerase	A0A1P8VVM6	Streptococcus_phage	1.3e-152	97.4
WP_002995969.1\|1088849_1089308_-	DUF669 domain-containing protein	A0A1P8VVN0	Streptococcus_phage	3.8e-82	100.0
WP_021340851.1\|1089323_1090553_-	DEAD/DEAH box helicase	A0A1P8VVM2	Streptococcus_phage	1.3e-236	99.8
WP_002995975.1\|1090654_1091335_-	AAA family ATPase	A0A1P8VVS4	Streptococcus_phage	1.6e-129	100.0
WP_021340846.1\|1091335_1091818_-	siphovirus Gp157 family protein	A0A1P8VVS5	Streptococcus_phage	7.9e-78	98.8
WP_021340847.1\|1092046_1092361_-	helix-turn-helix transcriptional regulator	A0A1P8VVN6	Streptococcus_phage	1.2e-50	95.2
WP_165357622.1\|1092376_1092514_-	hypothetical protein	A0A1P8VVR9	Streptococcus_phage	5.4e-16	91.1
WP_111713286.1\|1092510_1092807_-	hypothetical protein	A0A097PAT8	Streptococcus_pyogenes_phage	1.4e-48	99.0
WP_011054585.1\|1092885_1093071_-	helix-turn-helix transcriptional regulator	A0A1X9I6I3	Streptococcus_phage	3.3e-16	72.1
WP_011284879.1\|1093237_1093477_+	hypothetical protein	NA	NA	NA	NA
WP_002984292.1\|1093626_1093836_+	hypothetical protein	NA	NA	NA	NA
WP_021340169.1\|1094051_1094291_-	helix-turn-helix transcriptional regulator	A0A097PBE6	Streptococcus_pyogenes_phage	3.1e-35	97.5
WP_111688274.1\|1094340_1094847_+	hypothetical protein	NA	NA	NA	NA
WP_021340823.1\|1094843_1094990_-	hypothetical protein	NA	NA	NA	NA
WP_021340822.1\|1095164_1095953_+	peptidase S24	A0A1S5SD15	Streptococcus_phage	2.9e-85	62.6
WP_011106738.1\|1095962_1096268_+	membrane protein	NA	NA	NA	NA
WP_011054595.1\|1096387_1097476_+\|integrase	site-specific integrase	A0A097PAS9	Streptococcus_pyogenes_phage	4.7e-203	99.2
WP_002989605.1\|1097749_1098370_+	DUF3862 domain-containing protein	NA	NA	NA	NA
1097519:1097596	attR	NA	NA	NA	NA
WP_111713287.1\|1098626_1100891_-	glycogen/starch/alpha-glucan family phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.2e-11	43.7

DBSCAN-SWA_8

1214149 : 1255275

Streptococcus_phage(70.83%)

holin,tail,integrase,terminase,portal

attL 1216355:1216374|attR 1252648:1252667

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002983921.1\|1214149_1216012_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.1e-90	34.0
1216355:1216374	attL	NA	NA	NA	NA
WP_011017964.1\|1216543_1216726_-	hypothetical protein	A3F673	Streptococcus_phage	1.4e-19	76.7
WP_011285611.1\|1216964_1217765_+	streptodornase Sda3	NA	NA	NA	NA
WP_011017966.1\|1218035_1218470_+	hypothetical protein	NA	NA	NA	NA
WP_111713311.1\|1218539_1219748_-	glucosaminidase domain-containing protein	Q938J4	Temperate_phage	4.1e-208	84.6
WP_000609113.1\|1219863_1220091_-\|holin	phage holin	A7J2B3	Streptococcus_phage	5.8e-31	98.7
WP_002987582.1\|1220087_1220363_-	hypothetical protein	A7J2B2	Streptococcus_phage	2.6e-41	100.0
WP_010922094.1\|1220372_1220990_-	DUF1366 domain-containing protein	Q938J7	Temperate_phage	1.1e-76	88.3
WP_111713312.1\|1220992_1221424_-	DUF1617 family protein	Q938J8	Temperate_phage	3.9e-68	95.8
WP_111713313.1\|1221435_1223220_-	hypothetical protein	Q938J9	Temperate_phage	4.1e-95	47.3
WP_023079488.1\|1223234_1224236_-	hyaluronidase HylP	Q938K0	Temperate_phage	2.3e-127	71.6
WP_010922451.1\|1224235_1226194_-\|tail	phage tail protein	M1PKG3	Streptococcus_phage	5.3e-96	49.2
WP_010922452.1\|1226190_1226886_-	hypothetical protein	A0A1B1P761	Bacillus_phage	7.6e-05	29.6
WP_010922453.1\|1226882_1229240_-	hypothetical protein	M1NRG5	Streptococcus_phage	6.5e-141	50.6
WP_010922454.1\|1229239_1229611_-	DUF5361 domain-containing protein	M1PL84	Streptococcus_phage	2.9e-35	62.4
WP_111713314.1\|1229900_1230494_-\|tail	phage tail protein	M1PKG8	Streptococcus_phage	2.7e-59	62.5
WP_000573598.1\|1230505_1230841_-	hypothetical protein	A0A1P8BMR5	Lactococcus_phage	9.8e-35	64.9
WP_010922457.1\|1230841_1231078_-	hypothetical protein	A0A0B5A7G2	Streptococcus_phage	2.5e-21	71.4
WP_011285617.1\|1231070_1231409_-	hypothetical protein	M1PFF8	Streptococcus_phage	2.2e-42	70.3
WP_010922459.1\|1231368_1231791_-	hypothetical protein	A0A0B5A2F6	Streptococcus_phage	3.7e-47	70.8
WP_010922460.1\|1231800_1232001_-	hypothetical protein	NA	NA	NA	NA
WP_010922462.1\|1232937_1233399_-	DUF4355 domain-containing protein	M1Q1L0	Streptococcus_phage	4.5e-38	53.2
WP_011285619.1\|1233479_1234895_-\|terminase	terminase	A0A0B5A091	Streptococcus_phage	2.9e-213	74.2
WP_010922464.1\|1235004_1235271_-	hypothetical protein	A0A097PAR8	Streptococcus_pyogenes_phage	7.3e-33	86.4
WP_015055972.1\|1235263_1235443_-	hypothetical protein	NA	NA	NA	NA
WP_010922466.1\|1235492_1235717_-	hypothetical protein	NA	NA	NA	NA
WP_010922467.1\|1235722_1237216_-	hypothetical protein	M1Q184	Streptococcus_phage	2.0e-87	55.0
WP_010922468.1\|1237208_1238477_-\|portal	phage portal protein	M1PFL4	Streptococcus_phage	2.2e-188	75.6
WP_002994106.1\|1238473_1238830_-	hypothetical protein	M1PRL3	Streptococcus_phage	2.4e-07	57.8
WP_010922469.1\|1238978_1239323_-	HNH endonuclease	M1Q0W7	Streptococcus_phage	5.5e-41	68.5
WP_010922470.1\|1239431_1239851_-	DUF1492 domain-containing protein	A0A1X9I5B5	Streptococcus_phage	8.7e-57	79.9
WP_010922070.1\|1240118_1240754_-	SAM-dependent DNA methyltransferase	L0P368	Streptococcus_phage	2.0e-89	69.4
WP_002988369.1\|1240755_1241025_-	hypothetical protein	A7J287	Streptococcus_phage	9.6e-25	71.9
WP_002988366.1\|1241108_1241621_-	hypothetical protein	Q708P9	Streptococcus_phage	2.3e-67	78.0
WP_020837403.1\|1241617_1241959_-	hypothetical protein	M1NS23	Streptococcus_phage	1.1e-12	38.7
WP_011285624.1\|1242136_1242304_-	hypothetical protein	A0A1S5SEF3	Streptococcus_phage	3.3e-07	51.9
WP_011285625.1\|1242313_1243111_-	PD-(D/E)XK nuclease-like domain-containing protein	J7KGZ1	Streptococcus_phage	6.0e-131	84.5
WP_011285626.1\|1243107_1244037_-	recombinase RecT	M1NRN6	Streptococcus_phage	1.1e-91	72.2
WP_002988359.1\|1244039_1244369_-	hypothetical protein	J7KGX3	Streptococcus_phage	2.1e-45	83.5
WP_011017565.1\|1244424_1244631_-	hypothetical protein	NA	NA	NA	NA
WP_011017992.1\|1244639_1244780_-	hypothetical protein	NA	NA	NA	NA
WP_002985387.1\|1244776_1245010_-	hypothetical protein	Q938N1	Temperate_phage	6.1e-36	94.8
WP_011285627.1\|1244990_1245380_-	DnaD domain protein	Q938N2	Temperate_phage	9.3e-45	81.4
WP_011285628.1\|1245863_1246049_-	hypothetical protein	Q938N3	Temperate_phage	5.8e-21	88.5
WP_002990080.1\|1246050_1246362_-	hypothetical protein	A0A1S5SA25	Streptococcus_phage	4.1e-43	78.4
WP_011054585.1\|1246439_1246625_-	helix-turn-helix transcriptional regulator	A0A1X9I6I3	Streptococcus_phage	3.3e-16	72.1
WP_011284879.1\|1246791_1247031_+	hypothetical protein	NA	NA	NA	NA
WP_011285629.1\|1247172_1247979_+	TIGR02391 family protein	A0A1S5SBU1	Streptococcus_phage	7.9e-123	82.1
WP_010922204.1\|1247913_1248180_-	hypothetical protein	A0A1S5SC19	Streptococcus_phage	1.1e-23	66.3
WP_111713315.1\|1248211_1248928_-	phage antirepressor KilAC domain-containing protein	C9WB91	Streptococcus_virus	5.8e-117	87.3
WP_002993390.1\|1248939_1249131_-	hypothetical protein	A7J270	Streptococcus_phage	4.0e-25	92.1
WP_020837421.1\|1249766_1249862_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_011285631.1\|1250284_1250632_+	helix-turn-helix transcriptional regulator	A0A1S5SEQ8	Streptococcus_phage	3.6e-40	71.8
WP_002994744.1\|1250635_1251016_+	ImmA/IrrE family metallo-endopeptidase	A0A1S5SFH2	Streptococcus_phage	8.0e-41	61.1
WP_011285632.1\|1251027_1251294_+	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_003051793.1\|1251417_1252560_+\|integrase	site-specific integrase	M1NRJ9	Streptococcus_phage	2.4e-173	77.4
WP_002983920.1\|1252649_1252925_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	2.6e-25	73.0
1252648:1252667	attR	NA	NA	NA	NA
WP_111713316.1\|1253023_1253611_-	YpmS family protein	NA	NA	NA	NA
WP_172450323.1\|1253588_1254431_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002983913.1\|1254423_1255275_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	5.4e-13	35.7

DBSCAN-SWA_9

1260625 : 1268430

Klosneuvirus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011017997.1\|1260625_1261966_-	exodeoxyribonuclease VII large subunit	A0A1V0SIT1	Klosneuvirus	8.2e-40	30.9
WP_010922486.1\|1262118_1262973_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.0e-39	39.8
WP_032467264.1\|1263180_1264875_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	4.5e-128	42.2
WP_111713318.1\|1265130_1266129_+\|transposase	IS30-like element IS1239 family transposase	H7BW61	unidentified_phage	2.7e-32	35.0
WP_002983891.1\|1266138_1267548_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	4.4e-60	32.6
WP_002983889.1\|1267695_1268430_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.3e-34	38.4

DBSCAN-SWA_10

1492776 : 1594827

109

Streptococcus_phage(35.29%)

holin,tRNA,capsid,tail,transposase,integrase,head,terminase,portal

attL 1545063:1545080|attR 1591903:1591920

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_111713344.1\|1492776_1494216_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_002983290.1\|1494215_1495682_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_002988561.1\|1495681_1495984_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_002983281.1\|1496977_1497532_-	cysteine hydrolase	G3MA16	Bacillus_virus	2.0e-24	38.5
WP_002983278.1\|1497678_1498461_-	GTP-sensing pleiotropic transcriptional regulator CodY	NA	NA	NA	NA
WP_011528914.1\|1498677_1499892_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002983265.1\|1500122_1500575_+	universal stress protein	NA	NA	NA	NA
WP_111713345.1\|1500696_1502085_-	Cof-type HAD-IIB family hydrolase	A0A0H3UZF4	Geobacillus_virus	4.7e-22	37.1
WP_002983258.1\|1502156_1503122_+	asparaginase	NA	NA	NA	NA
WP_002988556.1\|1503470_1504175_-	ABC transporter permease	NA	NA	NA	NA
WP_002991995.1\|1504187_1505090_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.9e-38	44.2
WP_111713346.1\|1505382_1507398_-	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_011285690.1\|1507772_1509227_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-12	31.2
WP_002983239.1\|1509163_1509844_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_002983234.1\|1509840_1510434_-	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_014635665.1\|1510430_1512101_-	ABC transporter ATP-binding protein	F2Y165	Organic_Lake_phycodnavirus	1.3e-18	29.1
WP_111713347.1\|1512093_1513857_-	ABC transporter ATP-binding protein/permease	F2Y1V5	Organic_Lake_phycodnavirus	5.9e-22	31.1
WP_010922614.1\|1513853_1514690_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.9e-17	27.2
WP_111713348.1\|1514686_1515709_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	9.1e-15	27.2
WP_111713349.1\|1515710_1516595_-	heme ABC transporter substrate-binding protein IsdE	NA	NA	NA	NA
WP_011285109.1\|1516578_1517454_-	heme-binding protein	NA	NA	NA	NA
WP_111713350.1\|1517650_1521478_-	NEAT domain-containing protein	NA	NA	NA	NA
WP_002983203.1\|1521970_1523482_-	CHAP domain-containing protein	NA	NA	NA	NA
WP_038432480.1\|1523568_1524669_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	3.3e-31	31.0
WP_002983199.1\|1524665_1525022_-	holo-ACP synthase	NA	NA	NA	NA
WP_002983193.1\|1525137_1527657_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_111713351.1\|1527750_1528734_-\|transposase	IS30-like element IS1239 family transposase	H7BW61	unidentified_phage	2.1e-32	35.0
WP_002983189.1\|1528876_1529830_-	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_023078710.1\|1529924_1530809_-	ROK family protein	NA	NA	NA	NA
WP_111713352.1\|1531072_1534072_-	endo-beta-N-acetylglucosaminidase	NA	NA	NA	NA
WP_002983178.1\|1534302_1536186_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_111713353.1\|1536427_1537867_+	sucrose-6-phosphate hydrolase	NA	NA	NA	NA
WP_002988504.1\|1537871_1538837_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	8.0e-21	27.7
WP_002983167.1\|1538977_1539430_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_002983163.1\|1539422_1539812_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002988496.1\|1539857_1540415_-	elongation factor P	NA	NA	NA	NA
WP_002988493.1\|1540510_1540972_-	hypothetical protein	F8WPT6	Bacillus_phage	1.1e-33	55.1
WP_111713354.1\|1541006_1542080_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	3.0e-16	32.2
WP_111713355.1\|1542195_1545024_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.4e-304	55.6
1545063:1545080	attL	NA	NA	NA	NA
WP_011184907.1\|1545250_1545433_-	hypothetical protein	A3F673	Streptococcus_phage	4.4e-21	83.3
WP_172452791.1\|1545670_1546471_+	streptodornase Sda3	NA	NA	NA	NA
WP_011017966.1\|1546740_1547175_+	hypothetical protein	NA	NA	NA	NA
WP_111713357.1\|1547244_1548453_-	glucosaminidase domain-containing protein	Q938J4	Temperate_phage	2.6e-210	85.8
WP_011054444.1\|1548568_1548796_-\|holin	phage holin	A7J2B3	Streptococcus_phage	7.6e-31	98.7
WP_011017397.1\|1548792_1549065_-	hypothetical protein	A7J2B2	Streptococcus_phage	5.5e-36	91.0
WP_011054443.1\|1549076_1549709_-	hypothetical protein	Q938J7	Temperate_phage	2.0e-44	49.5
WP_002988448.1\|1549711_1550140_-	DUF1617 family protein	Q938J8	Temperate_phage	8.1e-58	84.3
WP_011017395.1\|1550151_1552056_-	gp58-like family protein	Q938J9	Temperate_phage	1.1e-210	83.7
WP_111713358.1\|1552065_1553073_-	hyaluronoglucosaminidase	Q938K0	Temperate_phage	1.3e-109	63.2
WP_111713359.1\|1553069_1555121_-\|tail	phage tail protein	A3F656	Streptococcus_phage	0.0e+00	85.2
WP_011284845.1\|1555117_1555897_-\|tail	phage tail family protein	A3F655	Streptococcus_phage	1.9e-65	54.0
WP_111713360.1\|1555928_1559564_-	tape measure protein	U6E979	Streptococcus_phage	3.0e-04	44.4
WP_002984407.1\|1559578_1559908_-	hypothetical protein	A0A1P8BLR3	Lactococcus_phage	2.0e-11	41.5
WP_002984405.1\|1559949_1560309_-	hypothetical protein	D7RWD6	Brochothrix_phage	4.3e-20	44.5
WP_111713361.1\|1560361_1560964_-\|tail	phage major tail protein, TP901-1 family	D7RWD5	Brochothrix_phage	1.5e-41	52.0
WP_111713362.1\|1561018_1561408_-\|capsid	phage capsid protein	B5SP36	Lactococcus_phage	9.3e-45	67.4
WP_030126607.1\|1561404_1561770_-	HK97 gp10 family phage protein	A0A097BY98	Enterococcus_phage	5.9e-17	46.3
WP_111713363.1\|1561750_1562059_-	hypothetical protein	A0A2P1JTW8	Anoxybacillus_phage	3.3e-13	41.2
WP_002988412.1\|1562055_1562409_-\|head,tail	phage head-tail connector protein	A0A2H4J002	uncultured_Caudovirales_phage	9.7e-25	49.6
WP_002988409.1\|1562422_1562665_-	hypothetical protein	NA	NA	NA	NA
WP_063662363.1\|1562674_1563757_-\|capsid	major capsid protein	A0A2H4J022	uncultured_Caudovirales_phage	9.1e-106	57.4
WP_002988404.1\|1563759_1564140_-\|head	head decoration protein	A0A0K2CNR0	Brevibacillus_phage	2.4e-05	32.5
WP_032460165.1\|1564149_1564683_-	DUF4355 domain-containing protein	A0A141E0S7	Streptococcus_phage	4.7e-15	84.2
WP_002984382.1\|1564794_1565538_-	phage repressor protein/antirepressor Ant	M1PKL6	Streptococcus_phage	5.3e-73	56.9
WP_002984380.1\|1565539_1565788_-	hypothetical protein	NA	NA	NA	NA
WP_011017861.1\|1565902_1566082_-	hypothetical protein	M1NRK8	Streptococcus_phage	2.6e-18	79.7
WP_002984375.1\|1566177_1566447_-	hypothetical protein	A0A097PAR8	Streptococcus_pyogenes_phage	2.3e-34	84.1
WP_010922213.1\|1566506_1566686_-	hypothetical protein	NA	NA	NA	NA
WP_111713364.1\|1566676_1568302_-\|capsid	minor capsid protein	U6E9F1	Streptococcus_phage	1.7e-47	44.2
WP_111713365.1\|1568282_1569785_-\|portal	phage portal protein	C9W9H5	Streptococcus_virus	6.0e-140	54.3
WP_012560959.1\|1569796_1571086_-\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	1.7e-183	74.9
WP_002990047.1\|1571063_1571546_-\|terminase	terminase small subunit	E0Y3R8	Staphylococcus_virus	3.3e-15	40.3
WP_011017866.1\|1572020_1572461_-	ArpU family transcriptional regulator	Q938L8	Temperate_phage	5.0e-79	100.0
WP_164997036.1\|1572734_1572905_-	hypothetical protein	A0A097PAS8	Streptococcus_pyogenes_phage	1.1e-26	98.2
WP_111710973.1\|1572901_1573633_-	DUF1642 domain-containing protein	A0A2H4JBN7	uncultured_Caudovirales_phage	1.4e-25	38.1
WP_021299463.1\|1573680_1574445_-	site-specific DNA-methyltransferase	A0A1S5SE41	Streptococcus_phage	4.2e-134	92.3
WP_063632581.1\|1574434_1574917_-	class I SAM-dependent methyltransferase	A0A097PAU8	Streptococcus_pyogenes_phage	5.6e-92	99.4
WP_111713366.1\|1574904_1575132_-	hypothetical protein	NA	NA	NA	NA
WP_111713367.1\|1575135_1575408_-	hypothetical protein	A7J287	Streptococcus_phage	1.7e-21	64.4
WP_010922069.1\|1575410_1575632_-	hypothetical protein	NA	NA	NA	NA
WP_010922068.1\|1575628_1576024_-	RusA family crossover junction endodeoxyribonuclease	Q5YA86	Bacillus_phage	9.4e-45	65.6
WP_010922067.1\|1576016_1576235_-	hypothetical protein	A0A1S5SEA6	Streptococcus_phage	1.3e-16	64.3
WP_111713368.1\|1576512_1578786_-	AAA family ATPase	Q5YA88	Bacillus_phage	6.4e-279	64.0
WP_010922065.1\|1578775_1579405_-	hypothetical protein	A0A2R4P8H7	Staphylococcus_phage	9.1e-42	43.1
WP_010922064.1\|1579414_1580998_-	DEAD/DEAH box helicase family protein	A0A097BY72	Enterococcus_phage	1.3e-233	77.4
WP_010922063.1\|1580997_1581633_-	hypothetical protein	A0A097BY29	Enterococcus_phage	4.3e-31	46.7
WP_111713369.1\|1581654_1582389_-	hypothetical protein	Q0R597	Streptococcus_phage	1.0e-76	61.3
WP_010922061.1\|1582390_1582813_-	hypothetical protein	M1I9V9	Streptococcus_phage	4.2e-35	59.9
WP_111713370.1\|1582852_1583932_-	ATP-binding protein	A0A0K2CZH1	Paenibacillus_phage	1.8e-98	52.6
WP_094398261.1\|1583946_1585266_-	AAA family ATPase	A0A097BY67	Enterococcus_phage	2.9e-154	64.3
WP_063632643.1\|1585249_1585495_-	hypothetical protein	NA	NA	NA	NA
WP_094398260.1\|1585496_1585715_-	hypothetical protein	NA	NA	NA	NA
WP_003056191.1\|1585724_1585865_-	hypothetical protein	A0A1P8VVR9	Streptococcus_phage	2.1e-15	88.9
WP_001191791.1\|1585894_1586152_-	hypothetical protein	NA	NA	NA	NA
WP_021340658.1\|1586229_1586415_-	helix-turn-helix transcriptional regulator	J7KH19	Streptococcus_phage	1.4e-22	83.6
WP_023078400.1\|1586558_1586789_+	hypothetical protein	NA	NA	NA	NA
WP_021733331.1\|1586914_1587121_-	hypothetical protein	NA	NA	NA	NA
WP_000164463.1\|1587268_1587484_-	helix-turn-helix transcriptional regulator	J7KK54	Streptococcus_phage	5.0e-32	98.6
WP_011017887.1\|1587581_1588265_+	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	1.2e-71	59.4
WP_011184610.1\|1588391_1588550_-	hypothetical protein	J7KH24	Streptococcus_phage	1.7e-21	92.3
WP_111713371.1\|1588608_1588824_+	hypothetical protein	J7KBX0	Streptococcus_phage	8.8e-29	95.7
WP_021340643.1\|1588809_1588959_-	hypothetical protein	J7KH12	Streptococcus_phage	4.3e-19	91.8
WP_111713372.1\|1589318_1590059_+	helix-turn-helix transcriptional regulator	J7KJ52	Streptococcus_phage	1.3e-127	92.2
WP_021340646.1\|1590130_1590553_+	Ltp family lipoprotein	NA	NA	NA	NA
WP_023078397.1\|1590668_1591823_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	1.2e-196	94.8
WP_002983147.1\|1592066_1593011_+	magnesium transporter CorA family protein	NA	NA	NA	NA
1591903:1591920	attR	NA	NA	NA	NA
WP_002983144.1\|1593142_1593799_+	DUF1129 domain-containing protein	NA	NA	NA	NA
WP_002983142.1\|1593931_1594171_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_002983122.1\|1594335_1594827_-	single-stranded DNA-binding protein	A0A286QNX2	Streptococcus_phage	1.7e-59	74.2

DBSCAN-SWA_11

1884391 : 1897076

Streptococcus_phage(61.54%)

holin,integrase

attL 1873642:1873657|attR 1890270:1890285

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1873642:1873657	attL	NA	NA	NA	NA
WP_021299091.1\|1884391_1885537_-\|integrase	site-specific integrase	A0A1X9I5Y5	Streptococcus_phage	2.7e-84	44.9
WP_011185066.1\|1885739_1885883_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_011529101.1\|1886780_1887428_-	helix-turn-helix transcriptional regulator	A0A2H4JGT9	uncultured_Caudovirales_phage	4.4e-15	28.1
WP_011529102.1\|1887593_1887791_+	helix-turn-helix transcriptional regulator	A0A1X9I5U5	Streptococcus_phage	3.7e-18	72.3
WP_172452795.1\|1887804_1888431_+	phage repressor protein	A0A1W6JPC3	Staphylococcus_phage	8.8e-37	41.8
WP_021299105.1\|1888444_1888687_+	hypothetical protein	NA	NA	NA	NA
WP_011529105.1\|1888942_1889275_+	hypothetical protein	NA	NA	NA	NA
WP_011529106.1\|1889271_1889493_+	hypothetical protein	NA	NA	NA	NA
WP_011529107.1\|1889495_1889687_+	hypothetical protein	NA	NA	NA	NA
WP_000206026.1\|1889698_1890061_+	hypothetical protein	NA	NA	NA	NA
WP_011529108.1\|1890057_1890387_+	hypothetical protein	NA	NA	NA	NA
1890270:1890285	attR	NA	NA	NA	NA
WP_011529109.1\|1890389_1890662_+	hypothetical protein	A0A1X9I5U9	Streptococcus_phage	3.6e-19	60.0
WP_011529110.1\|1890662_1891523_+	primase C-terminal domain-containing protein	A0A1X9I6L2	Streptococcus_phage	2.5e-119	72.0
WP_042769766.1\|1891597_1893037_+	DNA primase	Q9AZI5	Lactococcus_phage	1.1e-69	38.0
WP_042769761.1\|1893313_1893487_+	hypothetical protein	A0A1X9I5U0	Streptococcus_phage	3.3e-10	57.9
WP_011529113.1\|1893492_1893666_+	hypothetical protein	NA	NA	NA	NA
WP_011529114.1\|1893667_1893934_+	hypothetical protein	A0A1X9I5U4	Streptococcus_phage	8.9e-15	46.2
WP_111713428.1\|1893940_1894099_+	DUF2292 domain-containing protein	NA	NA	NA	NA
WP_011529116.1\|1894199_1894802_+	hypothetical protein	NA	NA	NA	NA
WP_009880490.1\|1894785_1895121_+	hypothetical protein	NA	NA	NA	NA
WP_011529118.1\|1895255_1895663_+	hypothetical protein	A0A1X9I6S2	Streptococcus_phage	4.7e-07	30.8
WP_012560493.1\|1895768_1896182_+	DUF1492 domain-containing protein	A0A1S5S8W3	Streptococcus_phage	5.1e-09	30.8
WP_011529120.1\|1896256_1896457_+	hypothetical protein	S6C469	Thermus_phage	5.1e-07	43.9
WP_011285285.1\|1896692_1897076_+	ArpU family transcriptional regulator	Q938L8	Temperate_phage	3.7e-14	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LS483356

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection