CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LS483405	Lactobacillus brevis strain NCTC13768 chromosome 1	3 crisprs	cas3,csa3,DEDDh,DinG	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LS483405_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LS483405_1

124843-124997

Orphan

I-E,II-B

Consensus_repeat	Method
TAGTGTATTCCCCACATGTGTGGGGGTGATCCT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_LS483405_1

>merge|NZ_LS483405|1|124843-124997|CRISPRCasFinder
TAGTGTATTCCCCACATGTGTGGGGGTGATCCTCGTGGATTATATCACACCGATTCCCGAATAGTGTATTCCCCACATGTGTGGGGGTGATCCTAAGTCAGTGCTTAAGCCTATCCATTATGCAGCGTATTCCCCACATATGTGAGGGTGAACGG

>NZ_LS483405|1|1|124843-124997|CRISPRCasFinder
TAGTGTATTCCCCACATGTGTGGGGGTGATCCT	CGTGGATTATATCACACCGATTCCCGAA
TAGTGTATTCCCCACATGTGTGGGGGTGATCCT	AAGTCAGTGCTTAAGCCTATCCATTATG
CAGCGTATTCCCCACATATGTGAGGGTGAACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LS483405.1\|WP_035464637.1\|118754_119183_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_LS483405.1\|WP_035464635.1\|123688_124510_+\|AAC(3)-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|376807
NZ_LS483405.1\|WP_024525962.1\|130959_132306_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340903
NZ_LS483405.1\|WP_021741897.1\|119788_121522_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372109
NZ_LS483405.1\|WP_021741907.1\|113148_113724_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_LS483405.1\|WP_024525964.1\|121740_123228_-\|glucose-6-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235579
NZ_LS483405.1\|WP_021742823.1\|133114_134584_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_LS483405.1\|WP_021741893.1\|125959_127387_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143451
NZ_LS483405.1\|WP_024525968.1\|117167_118610_-\|NADP-dependent-phosphogluconate-dehydrogenase	unknown	unknown	gnl\|CDD\|236453
NZ_LS483405.1\|WP_021741904.1\|114832_115144_+\|DUF2316-family-protein	unknown	unknown	gnl\|CDD\|370809
NZ_LS483405.1\|WP_021741903.1\|115158_115752_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS483405.1\|WP_021742822.1\|134748_135408_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_LS483405.1\|WP_021741894.1\|125314_125890_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_LS483405.1\|WP_021741898.1\|119267_119705_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225064
NZ_LS483405.1\|WP_021741891.1\|128570_129386_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235640
NZ_LS483405.1\|WP_021741892.1\|127488_128331_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381314
NZ_LS483405.1\|WP_021742821.1\|135556_136303_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|380322
NZ_LS483405.1\|WP_024525970.1\|115884_116148_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LS483405.1\|WP_021742824.1\|132396_133011_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|225462
NZ_LS483405.1\|WP_021741890.1\|129635_130802_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887

Protein	Function_ID	Function_description	E-value
NZ_LS483405.1\|WP_035464637.1\|118754_119183_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	5.23633e-15
NZ_LS483405.1\|WP_035464635.1\|123688_124510_+\|AAC(3)-family-N-acetyltransferase	gnl\|CDD\|376807	pfam02522, Antibiotic_NAT, Aminoglycoside 3-N-acetyltransferase. This family consists of bacterial aminoglycoside 3-N-acetyltransferases EC:2.3.1.81, these catalyze the reaction: Acetyl-Co + a 2-deoxystreptamine antibiotic <=> CoA + N3'-acetyl-2-deoxystreptamine antibiotic. The enzyme can use a range of antibiotics with 2-deoxystreptamine rings as acceptor for its acetyltransferase activity, this inactivates and confers resistance to gentamicin, kanamycin, tobramycin, neomycin and apramycin amongst others.	3.04712e-82
NZ_LS483405.1\|WP_024525962.1\|130959_132306_+\|MFS-transporter	gnl\|CDD\|340903	cd17345, MFS_GlpT, Glycerol-3-Phosphate Transporter of the Major Facilitator Superfamily of transporters. Glycerol-3-Phosphate Transporter (also called GlpT or G-3-P permease) is responsible for glycerol-3-phosphate uptake. It is part of the Organophosphate:Pi antiporter (OPA) family of integral membrane proteins responsible for the transport of specific organophosphates or sugar phosphates across biological membranes with the simultaneous translocation of inorganic phosphate into the opposite direction. The GlpT group belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.09754e-142
NZ_LS483405.1\|WP_021741897.1\|119788_121522_-\|hypothetical-protein	gnl\|CDD\|372109	pfam12440, MAGE_N, Melanoma associated antigen family N terminal. This domain family is found in eukaryotes, and is typically between 82 and 96 amino acids in length. The family is found in association with pfam01454. This family is the N terminal of various melanoma associated antigens. These are tumor rejection antigens which are expressed on HLA-A1 of tumor cells and they are recognized by cytotoxic T lymphocytes (CTLs).	4.58198e-05
NZ_LS483405.1\|WP_021741907.1\|113148_113724_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	0.00129112
NZ_LS483405.1\|WP_024525964.1\|121740_123228_-\|glucose-6-phosphate-dehydrogenase	gnl\|CDD\|235579	PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated.	0
NZ_LS483405.1\|WP_021742823.1\|133114_134584_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.21799e-55
NZ_LS483405.1\|WP_021741893.1\|125959_127387_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143451	cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like. Coniferyl aldehyde dehydrogenase (CALDH, EC=1.2.1.68) of Pseudomonas sp. strain HR199 (CalB) which catalyzes the NAD+-dependent oxidation of coniferyl aldehyde to ferulic acid, and similar sequences, are present in this CD.	0
NZ_LS483405.1\|WP_024525968.1\|117167_118610_-\|NADP-dependent-phosphogluconate-dehydrogenase	gnl\|CDD\|236453	PRK09287, PRK09287, NADP-dependent phosphogluconate dehydrogenase.	0
NZ_LS483405.1\|WP_021741904.1\|114832_115144_+\|DUF2316-family-protein	gnl\|CDD\|370809	pfam10078, DUF2316, Uncharacterized protein conserved in bacteria (DUF2316). Members of this family of hypothetical bacterial proteins have no known function.	1.18782e-41
NZ_LS483405.1\|WP_021741892.1\|127488_128331_-\|aldo/keto-reductase	gnl\|CDD\|381314	cd19088, AKR_AKR13B1, AKR13B family of aldo-keto reductase (AKR). Xylella fastidiosa phenylacetaldehyde dehydrogenase is a founding member of aldo-keto reductase family 13 member B1 (AKR13B1). phenylacetaldehyde dehydrogenase (EC 1.2.1.39) catalyzes the NAD+-dependent oxidation of phenylactealdehyde to phenylacetic acid.	2.34671e-134
NZ_LS483405.1\|WP_021742822.1\|134748_135408_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.61549e-09
NZ_LS483405.1\|WP_021741894.1\|125314_125890_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.98151e-10
NZ_LS483405.1\|WP_021741898.1\|119267_119705_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225064	COG2153, ElaA, Predicted acyltransferase [General function prediction only].	1.98458e-34
NZ_LS483405.1\|WP_021741891.1\|128570_129386_+\|hypothetical-protein	gnl\|CDD\|235640	PRK05901, PRK05901, RNA polymerase sigma factor; Provisional.	0.00230747
NZ_LS483405.1\|WP_021742824.1\|132396_133011_-\|NAD(P)H-binding-protein	gnl\|CDD\|225462	COG2910, COG2910, Putative NADH-flavin reductase [General function prediction only].	1.5499e-53
NZ_LS483405.1\|WP_021742821.1\|135556_136303_-\|nitroreductase-family-protein	gnl\|CDD\|380322	cd02146, NfsA-like, nitroreductase similar to Escherichia coli NfsA. This family contains NADPH-dependent flavin reductase and oxygen-insensitive nitroreductase. These enzymes are homodimeric flavoproteins that contain one FMN per monomer as a cofactor. Flavin reductase catalyzes the reduction of flavin by using NADPH as an electron donor. Oxygen-insensitive nitroreductase, such as NfsA protein in Escherichia coli, catalyzes reduction of nitrocompounds using NADPH as electron donor.	1.05595e-79
NZ_LS483405.1\|WP_021741890.1\|129635_130802_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.26943e-63

>NZ_LS483405.1|WP_035464635.1|123688_124510_+|AAC(3)-family-N-acetyltransferase
MTNWQEREITRVTTAIDLYDLFDRLGLRATDSCLVHTSLSAFGYIPGGEQTLVTALKTTLSQGNIVMPAQSADYTDPREWLYPPVRQDLQAKVMAGMPAYDRTLTPCHFIGITPEYFRTLPDTQRSGHPTCSMTAWGRNAAQICATPTLDLPFGAQGPLQKLYDLNAKVVCLGTDFETATAIHLAESIIGRPVFEEQAPISVAGKPQWRSYQMVELEPYDDFNVMGAAFCQAHPEQVVQQPLGQHHQARAIGMRTLVDFAREYYREKDRREMS
>NZ_LS483405.1|WP_024525964.1|121740_123228_-|glucose-6-phosphate-dehydrogenase
MATERTALFMFFGGTGDLAYRKLYPSLFNLYRKGNLRTHFAVIGTSRQSIDDDKFRAAVKKSLADSGNRADSKEASDFISHFYYQSHDVTDTAHYSVLKELAEKLDKKYKLQGNRIFYLSMAPQFFGTIAQDLKTQGLMSTDKDAFNRLVIEKPFGRDFDSAKQLNDALSKSFEEEQIFRIDHYLGKEMIQNIEALRFGNTLVESLWNNRYIDNIQVTLSEKLGVEERASYYDNSGALRDMVQNHIMQIVSLLAMEQPVAFTDTDIRAEKVKALRSLRVYNVADAATNFVRGQYGSVNDQPDYRHEDNVPVDSTTETFVAGKLLFDNYRWSGTPFYVRTGKMLADKFTRVDVVFKRPLVDIFAFPQSQNTPLAANVLTIFVEPHAGFSLQLNAKTNDTGFQTEPIKLDYIVGAEKSKDTPEPYERLIHDVLKGDGTNFSSWPEVSYAWKFVDQIRRVWDLQEPNFPNYTPHSMGPAAAEELIQRDHREWIYRLNN
>NZ_LS483405.1|WP_021741897.1|119788_121522_-|hypothetical-protein
MTFSPLNVPILLLSTSLLTLTLANVQPVTAHATATSVSLAEKTTTSTATAQLFTSPVNQPLTLTADTYPLYNNEGQETTDTLPGKQQLTTTKILVDPLAGTTYYRVQENPDRFIKYDATTVNLKHTLTLNFFNTSGGLIANPVSFRMTQGNDFDAIASDLKDQYAAVIDGFVFNKTTVDNTTDPYNTQFNFSYDKAGSSSTDESHTSIPASSLPSLSTLTNEKIRLTSPNDYSLYDNGGNNLTTGKTTVAGSSYYSATGLYLFHQKLTNADNVFYQISPDAFIKGDNTTALTSPITFKYETSDGQSIKTDSMLDTGLVTGDDLNNLIKELQTWQPTIDGYTYQSVNPTADTLTFKYTPTSTSSSSDTSSPSSDSSQSSSSTSTDSTASSSQTSSSTSTDSTASSDTHNSVVTSASSTRPDKSIVPKGAAVTAIRKIGVYRDVQFTKQNRRHWYQRQPQTKRPQFVVTGYARTKAGTLRYQIRGVNHHSATDGQRGYITANSKFVMPTYYQAAPKRIKVISPHGVNAYRQINLTQKKRHYRVGTTITVKAIKSYHLTTRLVLSNGTYVTANKILVAKK
>NZ_LS483405.1|WP_021741898.1|119267_119705_+|GNAT-family-N-acetyltransferase
MEWQAKSFDELSREEFFDIAYERIRTFVIAQHRPYQEIDATDKVARHILGYQAGQLVAYARVFREAGHVTFGRVLTIPEQRGTGLGRQLMVQIEAEIRRNFAGEAISIEAQIDKQHFYEKFGYAAIGAVFDFNGTPHIRMDKAGL
>NZ_LS483405.1|WP_035464637.1|118754_119183_-|winged-helix-turn-helix-transcriptional-regulator
MPNAFRSIGLIARATAAMGNKLFQADDLNNNQFIFLMRIVETPGITQAELATQLHVDPSTCLRAVRKLIATQYVTRGTDAHDKKRRPLLATAKGQAMYPALEDYEQQILSVGTQGLSTGETALLEELLAKVARNVRDYQNQH
>NZ_LS483405.1|WP_024525968.1|117167_118610_-|NADP-dependent-phosphogluconate-dehydrogenase
MADQKANIGVVGMAVMGKNLALNIESRGYTVGIYNRSANKTEQVMKDHSEKKLVPSYTVEDFVKSLETPRRILLMVKAGKPTDAVIHELLPLLDKGDVLIDGGNTNFHDTMARNAELDKSGINFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILEKIAAKAPQDGKPCVTYIGPNGAGHYVKMVHNGIEYGDEELIDESYNIMRNVAGISVDDMADIFKEWNKGELDSYLIEITADILTRKDDLGDDKNLPIVDAIKDRGNNKGTGKWSSEDALDVQVPQSVITESVYARYISMLKDERVKASKVLPAAEKQGKADIADKDKFVEEVRQALFFGKLMSYAQGFEQLRFASEANDWDLKFGELAQIWRGGCIIRAQFLQNITDAFDKDPKLSNLLFDDYFKDIAGKYQQSIRDVVAMAVQAGIPVPSLSAAITYYDSFRAEVLPANLLQAQRDYFGAHTYERNDREGNFHYSWYEEQ
>NZ_LS483405.1|WP_024525970.1|115884_116148_+|hypothetical-protein
MTENVVLAPPEALELAKHLDEWAKWRQTHDRTTADMDWDQFIAKSREKAQWQAGLATEIDHWESLHAIQLALTDNLMGTAHGGHTRQ
>NZ_LS483405.1|WP_021741903.1|115158_115752_+|hypothetical-protein
MSRGEDIAEISELVARERLFRARHNPAIADCYYPDATVATSWQQGPLSTFLNAESTEVDPRFAIVGNNSGAVVHLNGRRAYVELPTCTHMRMMVNGTLAQIESYRRLLYRVEKRTTDWKISQMTSINENDDLRPVIAGQDLHINPQDLVGLRPSYQFLAYVRQAAGGKISANLLGTDRPADVDQLYAEAENWLRQTK
>NZ_LS483405.1|WP_021741904.1|114832_115144_+|DUF2316-family-protein
MSLNAQQLVATRQELHANFILTGLTKEQVAADLHISLTKLDHLFTLTQQSLNDPWILRNYLLERVVATGQDPVPFTALSGDWHRHWFLDSEVIDRREMSAGDR
>NZ_LS483405.1|WP_021741907.1|113148_113724_-|TetR/AcrR-family-transcriptional-regulator
MSKLSINSDLHIDHRTHQTHVKLMTALLAAFTAHQPAQTLTVSQLCREARVSRATFYRHHQDIGDIVTVAYLITLRELSDQLSALPTVTYGNLTNAIVHTMVAHPQLPQLAAWLHVEPRVISLESGLVQRVLADLEVDDQQPQFTATYLGNCLHQFNWQLSQMRPQLTLIETARLFNRLIPNVLQSARITP
>NZ_LS483405.1|WP_021741894.1|125314_125890_+|TetR/AcrR-family-transcriptional-regulator
MREKDTAKQTSIIDEVSNIILNEGIAAVSMSKIAKASGISSSTIYVYFTDKEDVLKQVYLAKKEMLATFLLKNIEATTDNPVIFAQQFMRALYEFGMQHYEALMIIEQFNSSPVRNNLQISQAESYRGFERLFEATSHAPQFVTDSAAVILGFAYAPIVLYVKARKTNQLAAQTISIEQVIDMCMHALLKE
>NZ_LS483405.1|WP_021741893.1|125959_127387_+|aldehyde-dehydrogenase-family-protein
MTTNVEMTKIFEDQRQQYNRAQPMSLATRLTTLDQLERLLRENLNAFVEALQADFDQRDPLQIIGADLTGPLTTIAYTRKHLRKWMKPDKKRLGLMGLSGGREYVYNEPLGVVGIMSPFNAPIDLALDPAIEAIAAGNRVMVKISEYTPKAAALLQKLAKKYVSETTFAVITGEADVSVHFSALNWDKFVFTGGSETGKKILAAAAPNLTPVVLELGGKNPAVVLPDANQQLAAEKIARGRSGNSGQICLDVDYAMVPANQLTDYIHLIVEQLEQAFPTYSDNPEYSAIINDAAYKRITGMLAEAQQRGTQLLTINPNHDAVPDATKRLIPLTLAINPDPDLQIAKNEIFGPILSIFTYETLDEAIAFINTHEKSLAMYVFGKNKAQLDRVIRHTSSGGVDINELALHAGSHEMGFGGVGYSGMGRYKGGKVGFETFSNPKSIYKQGILAKYTTRFMVPIHSQRNEKRFKKMLGL
>NZ_LS483405.1|WP_021741892.1|127488_128331_-|aldo/keto-reductase
MEKTFTFDSDLTVNRLGYGTMQLTGDGVWGPVADPDNAVKVIETAIDHGVNFIDTADAYGPFYANLYLRDALKNRPDNHVMVATKVGNTRQGPDVWTPVGVPAYLRQQVEMNLFTLGLDHIDLLQLHRVDPNVPLADQIGVLKDMQDEGKIKHIGLSQVSVDQLKEATAIAPIVSVQNMYNLSNRQDEDVLDYADAHHIAFIPWFPLATGELIKDATLTNIAQKYNASPAQIALAWLLKRSDVILPIPGTKSSDHELQNIQAQDIDLSQADFDALKALAK
>NZ_LS483405.1|WP_021741891.1|128570_129386_+|hypothetical-protein
MKKFMVALTGLVTLATVGATVPATAVTTAHAATKSTYVSPSLKVNAIYTTSTKVAGTATKGSKITVKATKNAKTNLASGTASKTTGKYSIKLSKKLKKNANVYVYATNSKTKAYFYRIIRVQAASTKAATTKSTSTKKTTTKKTTTKKSTTSSKTSAASFSVKTPTGTWTSNTANKYSQKWVFSQKTGLNEYLYKNGKKVKTLVSYAKYSVSAKTPTFWKITYTPKGSKTKQTMYLRFTSAKKFKVVNSKNQVISTKAGVAPAAKWAFTKA
>NZ_LS483405.1|WP_021741890.1|129635_130802_+|MFS-transporter
MWKTKKEVSLVGILSATLLLNAAAACMWPLTTVYMHNQLHQTLALAGVALLGMSLCMIVGNWLGGWLFDNWSPFKSALVGTLCSFIPMLTLIVFHGWPIFGIMLLFIGLGDGIVMTVVNSFAANIKEISSRRVFNWLYIGMNLGVVVGTLMVGMLMDHGVQLVFMVASLSYAALLVIFVVDFRMDIQTKTHQHVKGPAKPAQLQLIWLIAAMVFCLYLSYSLWESVISVHMTNLGISFEKYSLLWTLNGLLIVFGQPLANRIGTYFKMSSQIAVGTLIFILSFLLLVFARDYTMFVVTMVILTVGEMTGFPGIPAWIDGLAGDNDKGKFQGIYNMAISFGRAVGPLYGGLIIEYGSYQLLFWSVTGLMLAALAAVMLRNHHNLTRVKK
>NZ_LS483405.1|WP_024525962.1|130959_132306_+|MFS-transporter
MFSFLKPAPDAKVKVPAEKVVGTYRLRQTGVLLSICIGYIGYYIIRLIFTTEQNDIMKAYGFTTADIGLVMSCFGIGYGISKLFMGALSDKSNPKWYLATGLFISAILNFGLGSTRNLYVMMLLMLVMSVAQGMGAAACQRTVQLWWGKKWRGTVYAVWSSAHNAGAFACVAVVQIATLMFTHSIAAVFYTASVVSIVIAIFIVLAGADRPATVGLPSIGEYTGDEVVLDDGQATRAELTDLSLWQIFVRYILTNKVVWAITLTSMSLYLVRYGIMSWIPSYLTQFKGFDPGTAKWLVGIFELAAVPGVILMGAISDLLKDRRAIVCIGCVIGLLICLTTYFFSTSHLAIIIVLLIMGSLIYAPLTLVGLMVNESVPKFAVGSSTGFMGFFQYIFGETLATALIGILVAKFGWIASNTVLYTAAGLALLLLCYIAIHEHHVAKIAAGE
>NZ_LS483405.1|WP_021742824.1|132396_133011_-|NAD(P)H-binding-protein
MKLAIIGATGKTGNAVLEVARTRKITVTAVVRNAAKLTEPVSVIEKDIFALTPADLQGFDVVICAFASSKKSDYPRVNQHLVEILTGTDTRLIVVGSGATLFTDETRQKTVGDELPLIMRNSSRKHLQARQILQASRLNWTYMAPPMNYVPDGNATGSYQVGHDVLLYDRHGDSTISYADMALALVDEVEHPQNERQLMTVAWK
>NZ_LS483405.1|WP_021742823.1|133114_134584_-|MFS-transporter
MTETRRRIITFGLLLANIMAGFEGTIISTAMPTIVADLHGLSLMNWGFTIYFLFNAIGTPIWGRVADIIGRKRSFLFGTAIFVIGSLLEGLATNMIWLIIARGIMGIGAGGMLAIPFIIFSEIYPVDQRASVFGFTAAFGGISAVCGPLLGGWIIDVLNWHWVFFINIPIGIISILIVYFAFREESKERHAKIDVWGSLSLSIVILAFLLGIQLIGQSHTPVIWAIAFLLVAIVFGFLFVRIERNTHDPLIPLHLFKNKDMLLWDLMAFVGMGFYISFSVYIPMWAQGILLTSALAGGATQIPTAGLWYSGSRFGSYLSKKRNHHLTAVLALSFALIGTLVLLALGMTPNYAFFIIVGALLGIALGMLLTTSQVGVSEAVTSNDLAVATTLNRLFNTLGQTIMTAIYGLVFNIVVNHQATKLGLPSAKISGLTNSAVTSDSKAQLLIMHHVLFAGIKSVLIVAFVLLLVALILEIGNIYLTRIKKQSVQ
>NZ_LS483405.1|WP_021742822.1|134748_135408_+|TetR/AcrR-family-transcriptional-regulator
MATENERRQQMIRRITQTIVQNGFADLKMEKIAKLMGVSRTKMYQYYSSKTAIMTDVVARYLEFMATRSVPQSVDAKTSVTNFPQVILNLANLIASSSQKFRRDLAQADEELSEQFEESYASWCHQVRDFLTNGVTNGAFNSSLQPELFLIQMEATVAALMQPRVLTQHKVVTQNVLREYLQMVITQVVAPKYRAQINLDAVEPDLEHLTLKYQQTLTK
>NZ_LS483405.1|WP_021742821.1|135556_136303_-|nitroreductase-family-protein
MNPTLTTLFNHRSIRQFTPEKLTTDEVATLITAAQHAATSTFSQQYSVISVTDPAKLAVLGDITGHHWLEKAGHYFVMVADQYRNQQLVPPTATTTTNLHSLDKLLAGVFDAAIATEAIVTAGESLNLGSTIMGSILNDAARVIDLLDLPKLTFPVLGLAIGHPTEHPEQKPRLPQDLMHFTNGYQALTADNARLAAYDQVIHDYYQQRGTHQRDETFSHHIVSEMSRDPQQRAGILQALQQQGFLTK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LS483405_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LS483405_2

883821-883915

Orphan

Consensus_repeat	Method
AAGAAAACCAACAACTGAAAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LS483405_2

>merge|NZ_LS483405|2|883821-883915|CRISPRCasFinder
AAGAAAACCAACAACTGAAAAAACAAGTCAGCGAGTTGGCTCAGACTAAAGTACGTGATCAAACACTGGCCAAAGAAAACCAACAGCTGAAAAAA

>NZ_LS483405|2|2|883821-883915|CRISPRCasFinder
AAGAAAACCAACAACTGAAAAAA	CAAGTCAGCGAGTTGGCTCAGACTAAAGTACGTGATCAAACACTGGCCA
AAGAAAACCAACAGCTGAAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LS483405.1\|WP_021742875.1\|888255_889098_+\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270217
NZ_LS483405.1\|WP_011668117.1\|884456_884984_+\|rod-shape-determining-protein-MreD	unknown	unknown	gnl\|CDD\|225444
NZ_LS483405.1\|WP_035465095.1\|872329_874060_+\|septation-ring-formation-regulator-EzrA	unknown	unknown	gnl\|CDD\|179877
NZ_LS483405.1\|WP_011668119.1\|882505_883510_+\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237562
NZ_LS483405.1\|WP_035465099.1\|876735_877245_+\|thiol-peroxidase	unknown	unknown	gnl\|CDD\|239312
NZ_LS483405.1\|WP_021742878.1\|891906_892812_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224343
NZ_LS483405.1\|WP_021742864.1\|870867_871473_-\|30S-ribosomal-protein-S4	unknown	unknown	gnl\|CDD\|235411
NZ_LS483405.1\|WP_011668114.1\|886947_887589_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_LS483405.1\|WP_011668115.1\|885676_886483_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
NZ_LS483405.1\|WP_035465104.1\|885002_885674_+\|cell-division-inhibitor	unknown	unknown	gnl\|CDD\|179052
NZ_LS483405.1\|WP_011668127.1\|871672_872140_-\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|224867
NZ_LS483405.1\|WP_021742877.1\|890503_891793_+\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NZ_LS483405.1\|WP_021742876.1\|889230_890526_+\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NZ_LS483405.1\|WP_021742874.1\|887607_888243_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_LS483405.1\|WP_011668124.1\|875376_876594_+\|tRNA-4-thiouridine(8)-synthase-ThiI	unknown	unknown	gnl\|CDD\|234960
NZ_LS483405.1\|WP_021742870.1\|881690_882353_+\|DNA-repair-protein-RadC	unknown	unknown	gnl\|CDD\|163702
NZ_LS483405.1\|WP_035465097.1\|874210_875356_+\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029
NZ_LS483405.1\|WP_021742869.1\|880328_881651_+\|bifunctional-folylpolyglutamate-synthase/dihydrofolate-synthase	unknown	unknown	gnl\|CDD\|223362
NZ_LS483405.1\|WP_011668109.1\|892877_893465_+\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	unknown	unknown	gnl\|CDD\|273139
NZ_LS483405.1\|WP_035465101.1\|877548_880215_+\|valine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235582

Protein	Function_ID	Function_description	E-value
NZ_LS483405.1\|WP_021742875.1\|888255_889098_+\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270217	cd00996, PBP2_AatB_like, Polar amino acids-binding domain of ATP-binding cassette transporter-like systems that belong to the type 2 periplasmic binding fold protein superfamily. This subfamily includes periplasmic binding domain of ATP-binding cassette transporter-like systems that serve as initial receptors in the ABC transport of amino acids and their derivatives in eubacteria. After binding their ligand with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically-located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The Abp proteins belong to the PBPI superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.7771e-114
NZ_LS483405.1\|WP_011668117.1\|884456_884984_+\|rod-shape-determining-protein-MreD	gnl\|CDD\|225444	COG2891, MreD, Cell shape-determining protein [Cell envelope biogenesis, outer membrane].	1.6366e-06
NZ_LS483405.1\|WP_035465095.1\|872329_874060_+\|septation-ring-formation-regulator-EzrA	gnl\|CDD\|179877	PRK04778, PRK04778, septation ring formation regulator EzrA; Provisional.	0
NZ_LS483405.1\|WP_011668119.1\|882505_883510_+\|rod-shape-determining-protein	gnl\|CDD\|237562	PRK13927, PRK13927, rod shape-determining protein MreB; Provisional.	0
NZ_LS483405.1\|WP_035465099.1\|876735_877245_+\|thiol-peroxidase	gnl\|CDD\|239312	cd03014, PRX_Atyp2cys, Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx). Tpx is a bacterial periplasmic peroxidase which differs from other PRXs in that it shows substrate specificity toward alkyl hydroperoxides over hydrogen peroxide. As with all other PRXs, the peroxidatic cysteine (N-terminal) of Tpx is oxidized into a sulfenic acid intermediate upon reaction with peroxides. Tpx is able to resolve this intermediate by forming an intramolecular disulfide bond with a conserved C-terminal cysteine (the resolving cysteine), which can then be reduced by thioredoxin. This differs from the typical 2-cys PRX which resolves the oxidized cysteine by forming an intermolecular disulfide bond with the resolving cysteine from the other subunit of the homodimer. Atypical 2-cys PRX homodimers have a loop-based interface (A-type for alternate), in contrast with the B-type interface of typical 2-cys and 1-cys PRXs.	3.46604e-58
NZ_LS483405.1\|WP_021742878.1\|891906_892812_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224343	COG1426, COG1426, Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown].	3.17733e-28
NZ_LS483405.1\|WP_021742864.1\|870867_871473_-\|30S-ribosomal-protein-S4	gnl\|CDD\|235411	PRK05327, rpsD, 30S ribosomal protein S4; Validated.	3.36071e-119
NZ_LS483405.1\|WP_011668114.1\|886947_887589_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	8.0876e-68
NZ_LS483405.1\|WP_011668115.1\|885676_886483_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	2.00293e-141
NZ_LS483405.1\|WP_035465104.1\|885002_885674_+\|cell-division-inhibitor	gnl\|CDD\|179052	PRK00513, minC, septum formation inhibitor; Reviewed.	7.40371e-20
NZ_LS483405.1\|WP_011668127.1\|871672_872140_-\|GAF-domain-containing-protein	gnl\|CDD\|224867	COG1956, COG1956, GAF domain-containing protein [Signal transduction mechanisms].	1.29455e-68
NZ_LS483405.1\|WP_021742877.1\|890503_891793_+\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	4.89408e-76
NZ_LS483405.1\|WP_021742876.1\|889230_890526_+\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	1.25304e-43
NZ_LS483405.1\|WP_021742874.1\|887607_888243_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	6.60034e-105
NZ_LS483405.1\|WP_011668124.1\|875376_876594_+\|tRNA-4-thiouridine(8)-synthase-ThiI	gnl\|CDD\|234960	PRK01565, PRK01565, thiamine biosynthesis protein ThiI; Provisional.	0
NZ_LS483405.1\|WP_021742870.1\|881690_882353_+\|DNA-repair-protein-RadC	gnl\|CDD\|163702	cd08071, MPN_DUF2466, Mov34/MPN/PAD-1 family. Mov34 DUF2466 (also known as DNA repair protein RadC) domain of unknown function contains the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity. However, to date, the name RadC has been misleading and no function has been determined.	4.8572e-54
NZ_LS483405.1\|WP_035465097.1\|874210_875356_+\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	3.14993e-167
NZ_LS483405.1\|WP_021742869.1\|880328_881651_+\|bifunctional-folylpolyglutamate-synthase/dihydrofolate-synthase	gnl\|CDD\|223362	COG0285, FolC, Folylpolyglutamate synthase [Coenzyme metabolism].	7.45045e-160
NZ_LS483405.1\|WP_011668109.1\|892877_893465_+\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	gnl\|CDD\|273139	TIGR00560, pgsA, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. Alternate names: phosphatidylglycerophosphate synthase; glycerophosphate phosphatidyltransferase; PGP synthase. A number of related enzymes are quite similar in both sequence and catalytic activity, including Saccharamyces cerevisiae YDL142c, now known to be a cardiolipin synthase. There may be problems with incorrect transitive annotation of near homologs as authentic CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. [Fatty acid and phospholipid metabolism, Biosynthesis].	5.47145e-44
NZ_LS483405.1\|WP_035465101.1\|877548_880215_+\|valine--tRNA-ligase	gnl\|CDD\|235582	PRK05729, valS, valyl-tRNA synthetase; Reviewed.	0

>NZ_LS483405.1|WP_011668119.1|882505_883510_+|rod-shape-determining-protein
MFGLGTKNIGIDLGTANTIVYVDGKGIVLREPSVVAKNTKSGEIVSVGEDARAMIGRTPGSIVAIRPMKDGVIADYDTTVAMMKYFIEKTVGRSSGKPYVMVCVPSGVTEVEKRAVIDATRVAGARDAYVIEEPFAAAIGAGLPVMDPTGSMVVDMGGGTTDVATISLGGIVSSRSIRVAGDKLDDAIATYVRSNFNLLIGERTAEKLKMDIGSASVEAAEKIEGATIRGRDLITGLPKAVEVSAVDVAKAIQEPVQDVITAIKETLEETSPEIAADVIDHGIVLTGGGALLKNLSEVIAEATKVPVSIASDPLDCVAAGTGESLKSIDVMKKK
>NZ_LS483405.1|WP_021742870.1|881690_882353_+|DNA-repair-protein-RadC
MQRVQLTTQTEPQLVGRVLVSLGLAHASERQRFFQYFHSVAAVRYASRRQQRAYVSGNRQRQALLTAIELGRWAEKAPRPILGEVLASSQLGQVLMDDLRYLLQEQLEVLALDAQHRIIERQTVFQGTLNSCPVHPREIFRVAVMSGAATVIVAHNHPSGQPQPSTSDRAFMQRLAACGQLMGIPLLDGFVVGLHSYFSFKEAGILPKTVEKRIEPLKTN
>NZ_LS483405.1|WP_021742869.1|880328_881651_+|bifunctional-folylpolyglutamate-synthase/dihydrofolate-synthase
MITTYAEALQFIHGRDRFKKKPTLDRMREFMRRLGNPQEKLTMIHVAGTNGKGSTVAFLRDLFMAEGQTVGTFTSPFITRFNERISTDGTPISDDDLVAMTQQVQPVVAQLDQELAENGPTEFEIDTALMFCYFAQHPVDMVIVEVGLGGLYDSTNIITPAVSVITTIGLDHMKILGDTIPEIAAQKAGIIKPQVPVICGRLTPEALAVMDQTAAAKSAMIVALGRDFQVNNQPHDQWGERFGFAFKTNRWQHLQIDLLGQYQIDNAATALTAFLVYHQQRQLPVSVTTIRQGLSHTAWPGRFERVNEQPLMVIDGAHNEPAMVEMAQLLRQHFGDREVYVILAILADKQYQQMVKTLLQVPNVHVVVTQFQGPGKRQAASPDALEQAATTHERLSSAPDWPSALKQILATMSAEDVVLLTGSLYFISEVRHYFKETDAS
>NZ_LS483405.1|WP_035465101.1|877548_880215_+|valine--tRNA-ligase
MADKQIDMPTKYDPTAVEAGRYQTWLDEDVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDMLIRQKRMQGYDTLWLPGMDHAGIATQAKVEAKLREQGISRYDLGREKFVEKVWEWKDEYADTIHKQWAKMGLSLDYSRERFTLDDGLSDAVKKVFVTLYKKGLIYRGEYIINWDPQARTALSDIEVIHKDDKGAFYHVKYPFANPDDTFNGQHYIEIATTRPETMMGDTAVAVNPGDERYKELVGKKVILPLADREIPIITDQYVDPEFGTGMVKITPAHDPNDFLVGNRHNLERINTMNDDASMNEKAGKYAGMDRFDARKAMVADLDEQGLLLKVDPIVHSVGHSERTGVQVEARLSTQWFVKMKPLADEAIKNQQGDDAVNFVPERFENTFTQWMDNVHDWVISRQLWWGHRIPAWYNKQTGEVYVDTKAPKDIENWEQDPDVLDTWFSSALWPFSTMGWPDEDSADFKRYFPTSTLVTGYDIIFFWVSRMMFQSLEFTGKRPFKNVLLHGLIRDEEGRKMSKSLGNGIDPMEVIDKYGADALRWFLSTGSTAGQDVRFSYTKMDAAWNFINKIWNASRFVIMNLGDKTQPVVPAAETWDLTDKWILSRLNDTVKHVTEMFDKFEFGEAGRALYNFIWNDFCDWYIEMSKEVLTGDDETAKANKQDLLAYVLDQTLRLLQPIMPFVTEAIWQAMPHDGQSLVTAAYPVDHPEFTNPTAESDMTSLIDLIKAVRNIRAEANAPMSTPIDLQIKTSDAKLQAVFEANKDYIDRFVHPKALEIGADLVAPKLAMTSVITDAEVSVPLAELVDLNDEAARLEKEVAKFTAEVQRAEKKLGNERFVANAPEAVVAGEREKQADNQKKLEATQQRLAEIKRQL
>NZ_LS483405.1|WP_035465099.1|876735_877245_+|thiol-peroxidase
MEVSVRGDKMSLSGDLPEVGTQLPKFKLFDQNDTKVKTANLIGKVALISVVPDLETPVCTMQTRKFIQQADHYPAAKFYTVSNNTIAQQTGWCAAEGVENIDMLSDTELSFGYEMGLYIPNAGNLARSIWIIDDTGKIVYRQVVNEQTDEPNYLAAIEALEKLVPRVDV
>NZ_LS483405.1|WP_011668124.1|875376_876594_+|tRNA-4-thiouridine(8)-synthase-ThiI
MEYSEIMVRYGELSTKGKNKKDFIKQLGQNTRKALHQFDGIEVKAQHDRLHVTLNGADSTAVMDRLKGVFGIENFSPSVKVEKDIAAIKATALAMVQEIFTPGMTFKINTRRQDKQFEYDTNHLNDLLGGYILENVPGIQVKMKQPDLTLRVEVRLNGVFLSGQTIQGAGGLPVGTGGKAVMMLSGGIDSPVAAYYGMRRGVKLDMVHFFSPPYTSEQALAKAKELTARLAGYSGSIQFIQVPFTKIQETIKEKVPEGYLMTIQRRLMLRLAAAVAERRHAKGIFNGESLGQVASQTLESMAAINDVTSMPILRPLLSMDKTEIIKVAENIDTYDLSILPYEDCCTIFTPPAPKTHPDLEKSRKYEKYIDVDGLMQEALDGMIITDIHPDDNYLNQNEDVFAELL
>NZ_LS483405.1|WP_035465097.1|874210_875356_+|cysteine-desulfurase
MIYFDNSATTKAAPAVVDTYAKVSERYWGNPSSLHNFGEQAFNLLEQSRQQIADLLGVSLSEILFTSGGTEGDNWAIKGTAIAKREFGNHLITTEVEHPAVHNSMEQLKQLGFEVTYLPVDENGRVSASDLRSAIRPTTILVSTMAVNNEIGAVQPLAEIADVMRDFPKIHWHIDAVQGIGKGLHDLIFNDRVDFITFSGHKFHAPRGIGFMYKRQGRTIAPLMTGGGQERDLRSGTENLPAIAAMAKALRLLLDDEATKVQQQQEVRLAILNHIKTFSHVTIFSKDLPVFAPHILCFAIEGVRGETIVHAFEEHGIYISTTSACSSKKHVESSTLQAMKIDDGIATSAVRVSLDEHNTLAEAEQFNQVFDELYRGFAKLR
>NZ_LS483405.1|WP_035465095.1|872329_874060_+|septation-ring-formation-regulator-EzrA
MIGVLIGIVILAIVIYVGVLVYQQRIRRQVAALTTKKESMVAIPLKDELALVEQLSLTGQSLEQYQSLQTDYADITTNRFPRIDEQLSQLLADARGVNVLQLKKNLDKVTLLVNQTDELVQSVQEKLASLQEVDKQHREAVQQLEHKYQDLRKTLLAKNFAFGPSIDGLEERLGQLEGNFDTFTQLTQEGDHERAADVLSQLQDDTKQLDDLIDTIPPLYKDLTVVFPDQLKELKAGYQQLSAEHFHFGDQDIVAQVTAIEQHIQENLATLSDLRPADAQVVNERIAKQIDQIYDLMQTEIDAKQPVEKNLDGIAKFIAHAQNQSHMLLNELDRLGQNYTLDHHELETARELNEQLRHIDGIYQQDVQTLTGKTATYSQILAHQQQQEKDLEQIEKQQADILKSVAGLADEERQARDTLQQFDFDLHSLRRQVENLNLPGIPQSYLDYFFVVRDEVAQLATDMDQPQIDMERITKQLLIIQTDLDTLREKTEDLVDSSQLAEQLLQYANRYQTSHANVAEASQKASDLFEHQYQYAQALETIATVLDEVEPGSYKRLEDAYYQRKGTDKPHRTTKD
>NZ_LS483405.1|WP_011668127.1|871672_872140_-|GAF-domain-containing-protein
MSESLNPIITKQLDALLYGETNLVANLSNAAALLNQTLSDINWAGFYLYQPETDDLILGPFQGNVACVHIENNHGVCGTALATQTTQRIADVHQFPGHIACDSASNAEIVVPLTIGETKFGVLDIDSPTKDRFTAADQQVLEEFARVLLSHIDKA
>NZ_LS483405.1|WP_021742864.1|870867_871473_-|30S-ribosomal-protein-S4
MSRYTGPSWRISRRLGVSLSGTGKELNRRPYAPGDHGQGRRQKLSEYGTQLREKQKLRFTYGMTERQFYNLFKRAGKIKEGTHGTNFMILLERRLDNMVYRLGLATTRRQARQLVNHGHITVDGQRVDIPSYEVKIGQVISVREKSKDMAIIKGAVEAVVGRPQYVEFDADKLEGSLTRFPQREELDAELDDSLIVEYYNR
>NZ_LS483405.1|WP_011668117.1|884456_884984_+|rod-shape-determining-protein-MreD
MYRLSKLRFGFPIGLFFWLLIDGTVSQVFSVQLFRTPSTMVSHLVVLWLVCGAIFEADSALSMPLARWAAVAGAVFDLYYTGIFGLYVFIFPLVIYMTRRLVSWIRPNFLSGLLVYFIDITVVEALGYLASRAMHLNDASGNAFLVNTLGPTLAFNLAMFVILYFPIRWVYNWLK
>NZ_LS483405.1|WP_035465104.1|885002_885674_+|cell-division-inhibitor
MQAAVLRGTQNGYDLVLKQSASLDQILVDLKVLLENLKVDPQALAASKVSLDVLTEDRILTADEKARIEQLIAQYPRFEIHKIAANVMTIADAVQLRERENVHLLSKVIRNGQEVAMTGDVLFLGKIHEGGKLRTTGNIFSMGDVAGILQAGYPDDESKLIMGNLQNAQQVRIAEQFEIVEPGQLSDSQQTIAHVNDLHVLTFGKLANLKKINPKLYNQIGGI
>NZ_LS483405.1|WP_011668115.1|885676_886483_+|septum-site-determining-protein-MinD
MGKAIVITSGKGGVGKTTTSANIGTALALMGKRVCLMDLDIGLRNLDVVLGLDNRIIYDIVDVAEGRAKLPQALVKDKRFDDKLYLLPAAQNTDKTALEPEQVKEIVDELKPEYDYVLIDCPAGIEQGFMNAVAGADAAIVVTTPEISAVRDADRVVGLLEQHPLTEAPRLLINRIRRNMMQDGSMMDIDEITHHLGIELLGIIFDDDAVITTSNQGEPVVMETENPAGQGYRNVARRLEGETVPLMKIEEQEDTGFWHRVSSWFHRG
>NZ_LS483405.1|WP_011668114.1|886947_887589_+|amino-acid-ABC-transporter-permease
MHYVNEILPSLVSGTGMTLSIFFWTIIVAIPLGILVGLGMTTRFKPLTWLINIYVWLMRGTPLLLQLIFVFYGLPIIGVVFQRYDAALFAFILNYTAYFAEIFRGGLQAIPVGQYESARVLRLTRWQTLRRIVIPQVVKIVLPSIGNEVINLIKDSSLVYVIGLGDLLRAGNVAMSRDVTLVPLVLVGVIYLLLTAVCTIVLKRLEKHYSYWR
>NZ_LS483405.1|WP_021742874.1|887607_888243_+|amino-acid-ABC-transporter-ATP-binding-protein
MLELKGITKKFGGKTILDNLNLTVTDGKILTIVGPSGAGKTTLLRCISGLETVDSGQFLLDGQPFDPATNRDNDAVIGVVFQDYQLFPNLTVRQNVTLAPTMVLKQSAAEANETAQTLLAQLNLADQADLYPYELSGGQKQRVAIVRALAMRPKLLCYDEPTSALDPDLRREVQQIIVQLRDEGITQIVVTHDIPFAEAIADQMLRVEAKS
>NZ_LS483405.1|WP_021742875.1|888255_889098_+|amino-acid-ABC-transporter-substrate-binding-protein
MKKGLRIWALLAVCIGLSGLLAGCRTVTQRANTADTWSKVKQQKKVVVGLDDSFVPMGFRQKSGKLVGYDIDLARAVFKLYGIKVDFQTIDWNMNVTELHNGTIDLIWNGFSITPQRQKQAAFSDTYLYNDQVLVTLKKNKINSFADMQGKVLGAQTGSSGANDIDTYPKLLKNRIKNHEAVTYDSFTNAFIDLNVGRIQGLLIDSTYANYYIKHQAHPENYRVTTGALPKEKFAVGMRKGDVTMRHKINAGLKQLAANGTLKKINEKWFGSNVDTPLLK
>NZ_LS483405.1|WP_021742876.1|889230_890526_+|insulinase-family-protein
MHVRIRDGVTLDLLPTKKFKTIGIKVDFVAPLQATAITARALLAQVLETSTAEYPTQTALARQLSRLYGASFGISVVKLGTKHVIRLTCSVVDEQYLAQYQDTMPLFERGMALLQAVLFAPLLPNGNFDPTTFTQQRQNLLTAIKSLDDDKQYLANRRLQELLFTGQPAQAMSALGDVTTLGELTANDILATYHEMLAHDAVHVAVIGDVSEKRVTTALAAWPLAERLEPTTEPYYRWTARSQVQAGDDEAPVVQAKLNLAYQLPIYRSDADFLPAVVFNAAFGGTPLSLLFTNVREKASLAYYASSDYNPFTGALTVQTGIQAQNQERVIAIVTEQLQALQAGKLSTELLAEVKASLLNARLASLDSPQRQLTGALNSGLTHLQEPLTHWQEKLAQVTVADVQRVAQQVSLQATYCLHGKETGDANETRV
>NZ_LS483405.1|WP_021742877.1|890503_891793_+|insulinase-family-protein
MLTKHAYSRLGETVYQTTLENGLKVILIPKADFHKTFAVMTTNYGAIDNEFVPRGQQQAVRFPDGIAHFLEHKLFEKEDHDAFDLFGQYGASANAFTSFTQTSYLFSTTNHVRENLDILLDFVQEPYFTAATVNKEKGIIGQEIQMYDDDPGWQSYFGMIGQLYPREPLHIDIAGTVESIAQITADDLYAAYQTFYHPSNMSLVIVGQLEPETVLAWITANQARKTFGPNEPIQRVASPQTPAAEIVPQTTRHLTVTRPKVSIGLRGYDEVPAGRAGLRYSAAVSLALDLLFNDTGDHYLRLYDANIIDDSFGYDFQVQRGAHFAQLAGDTDHPETFVSELTAILDDAAAQLVAAQEQFDLVKREAIGRLIGAINSVEAIANQYDGPLFGGTTIFDELTILEQLTFADVQQALAAFLAASQRTVYTILP
>NZ_LS483405.1|WP_021742878.1|891906_892812_+|helix-turn-helix-domain-containing-protein
MSDNSKVTLGKTLRDARIAKGFTLDDLQQATKIQKRYLIAIEDQNFDELPGDFYVRAFIKQYADMVDLDGAELLKQFDSTLPSTQTQEYVDKVNESNPETRSQQRKVDDRYVQLRRTIPVIGIVIVVLAVLVGIWVAAAHNGNSGTKDNVDSSSVSVSGSSTKTSSSSSQSSSSKSSSKKKAAKTATFKKLSSTTSGSTWELKNASSKPKVSLSATSSAWMSVTISGATTWQGTLSTSTSHSLTIPSSATSVTFKFGNAPATKVKIDGKSFNFNSSTSTSSASSSSTTTSSQVQTVTLELK
>NZ_LS483405.1|WP_011668109.1|892877_893465_+|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase
MNLPNRLTIVRIILIPIFILLLVLPLNWGTVTWLGTAIPVAQIWGAVVFAAASITDFLDGQIARRQHLVTNFGKFADPLADKMIVMTAFILLVSMNAVPAWGVAIIVCRELAVTGLRLIVVETGGQVLAAAWPGKIKTTTQMVGIILLLLNNIGFSTLHFPMALTFFYICLFFTIYSGIDYFVQNRQVFAESSAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LS483405_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LS483405_3

1127841-1127932

Orphan

I-E,II-B

Consensus_repeat	Method
TGTATTCCCCACGGGTGTGGGGGTGATCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LS483405_3

>merge|NZ_LS483405|3|1127841-1127932|CRISPRCasFinder
TGTATTCCCCACGGGTGTGGGGGTGATCCTCGTAATGAGCAAAAGGTCATGCTGAACCTGTTGTATTCCCCACGGGTGTGGGGGTGACCTCA

>NZ_LS483405|3|3|1127841-1127932|CRISPRCasFinder
TGTATTCCCCACGGGTGTGGGGGTGATCCTC	GTAATGAGCAAAAGGTCATGCTGAACCTGT
TGTATTCCCCACGGGTGTGGGGGTGACCTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LS483405.1\|WP_021742593.1\|1122051_1123485_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_LS483405.1\|WP_021742591.1\|1120963_1121368_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_LS483405.1\|WP_021742604.1\|1131164_1131395_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LS483405.1\|WP_021742592.1\|1121457_1121943_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_LS483405.1\|WP_021742590.1\|1120118_1120955_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181334
NZ_LS483405.1\|WP_021742598.1\|1125750_1127190_+\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_LS483405.1\|WP_035464977.1\|1133098_1134187_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176239
NZ_LS483405.1\|WP_139961388.1\|1131507_1131582_-\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|237756
NZ_LS483405.1\|WP_052471877.1\|1124568_1125015_-\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_LS483405.1\|WP_021742611.1\|1136900_1137551_+\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_LS483405.1\|WP_021742594.1\|1123471_1124065_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_LS483405.1\|WP_021742610.1\|1135759_1136767_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_LS483405.1\|WP_021742599.1\|1127319_1127631_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|374224
NZ_LS483405.1\|WP_021742605.1\|1132042_1132633_+\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153234
NZ_LS483405.1\|WP_021742597.1\|1125176_1125629_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133380
NZ_LS483405.1\|WP_021742602.1\|1129824_1130820_-\|CAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|365934
NZ_LS483405.1\|WP_021742608.1\|1134305_1135202_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_LS483405.1\|WP_035464978.1\|1135284_1135632_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_LS483405.1\|WP_021742595.1\|1124125_1124572_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_LS483405.1\|WP_021742606.1\|1132645_1132999_+\|MmcQ/YjbR-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|225197

Protein	Function_ID	Function_description	E-value
NZ_LS483405.1\|WP_021742593.1\|1122051_1123485_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.96679e-46
NZ_LS483405.1\|WP_021742591.1\|1120963_1121368_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	3.12944e-44
NZ_LS483405.1\|WP_035464977.1\|1133098_1134187_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176239	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_LS483405.1\|WP_021742592.1\|1121457_1121943_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	9.4244e-09
NZ_LS483405.1\|WP_021742590.1\|1120118_1120955_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|181334	PRK08263, PRK08263, short chain dehydrogenase; Provisional.	5.92329e-88
NZ_LS483405.1\|WP_021742598.1\|1125750_1127190_+\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.20799e-89
NZ_LS483405.1\|WP_139961388.1\|1131507_1131582_-\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|237756	PRK14559, PRK14559, serine/threonine phosphatase.	0.00849408
NZ_LS483405.1\|WP_052471877.1\|1124568_1125015_-\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	3.13323e-18
NZ_LS483405.1\|WP_021742611.1\|1136900_1137551_+\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	2.95681e-44
NZ_LS483405.1\|WP_021742594.1\|1123471_1124065_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	2.66358e-24
NZ_LS483405.1\|WP_021742610.1\|1135759_1136767_+\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	6.0695e-163
NZ_LS483405.1\|WP_021742599.1\|1127319_1127631_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	1.83833e-05
NZ_LS483405.1\|WP_021742605.1\|1132042_1132633_+\|DJ-1/PfpI-family-protein	gnl\|CDD\|153234	cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	5.92809e-62
NZ_LS483405.1\|WP_021742597.1\|1125176_1125629_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	3.35261e-20
NZ_LS483405.1\|WP_021742602.1\|1129824_1130820_-\|CAP-domain-containing-protein	gnl\|CDD\|365934	pfam00188, CAP, Cysteine-rich secretory protein family. This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.	3.39137e-13
NZ_LS483405.1\|WP_021742608.1\|1134305_1135202_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.05575e-22
NZ_LS483405.1\|WP_035464978.1\|1135284_1135632_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.92072e-38
NZ_LS483405.1\|WP_021742595.1\|1124125_1124572_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	3.62874e-27
NZ_LS483405.1\|WP_021742606.1\|1132645_1132999_+\|MmcQ/YjbR-family-DNA-binding-protein	gnl\|CDD\|225197	COG2315, MmcQ, Uncharacterized protein conserved in bacteria [Function unknown].	1.47301e-18

>NZ_LS483405.1|WP_021742599.1|1127319_1127631_+|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MTKANIVTYPAVFHDNEAGGYIVTFPDIEEAMTSGQTLGESLVNATTVLGQTLHHHPMVLPTATTITELMHQYPMAFIQFVAVDLDQVIEHAVPTDQADLQLT
>NZ_LS483405.1|WP_021742598.1|1125750_1127190_+|multidrug-efflux-MFS-transporter
MTTDITDKPYNRAMMVTILLIGTFLNVLNQTVLATAFPDLMKAFSINATTVQWLTTGFLLVNGIMIPLSAWLSTQFNSKWLWISAMTIFAGGTILCWAAPSFAMLLSGRLIQAVGVGVAMPLLQTIMFSIFPPEQRGSAMGLVGIAVGVGPAIGPTLAGFVVDNGSWRNIFGIMIPIAFVIILLSFFFMRPVIENRRTHLDVLSLILSSIGFGSVLYGFSTVGQNGWTDSTVITALAVGVIFVALFAVRQLTISEPFLELRVFAKGQFTVATILGAIANTAMTGAELVLPMYLQIVRGQSALISGLTLLPGAIVIALMNPITGRIVDRIGGRELSIIGLACLTLGTLPLCFLQSDTALWWIILVYAVRMLGVSMVLMPITTVGMNALDRSLIAHGTAVNNTVKQIFSSIGTALVVSIMANVTKGNMPNVRLYIKQPTLLHHLIMNANLDGYTAAFIVTAAMSFLGFLMAFLVKRSTKKA
>NZ_LS483405.1|WP_021742597.1|1125176_1125629_-|MerR-family-transcriptional-regulator
MTVTDNFSNWLNLIQQVSQPEGITLGTSDLVKATGVPASQLRYWVEQGYIKPIDVPNERSRKFSYRVVFRVRAIKYFLDHGYTLSAAMDNVNQFRNLDIQLQRILTDHLTDLQLHEDGQIDISLGTVQDGQELLGLTIKDGSSQFWTKKV
>NZ_LS483405.1|WP_052471877.1|1124568_1125015_-|LytTR-family-transcriptional-regulator
MHVTFNLKASFIPPFITINAPAETPELQHLAANISQLTNSQLIAGISPRGTRELVPVNQIIRIHTDAKHVVMETKITTYTLPQRIYQLKQLLPSDLFLQLSSGELVNRQHIRHFSLTPSGLYQVLLSTGATTFVSRRCMQQIRKEFLK
>NZ_LS483405.1|WP_021742595.1|1124125_1124572_-|DUF3021-domain-containing-protein
MKRLGILTSGAFLGLSIGFLCALFFSLTNHATTFMPSSPDFVAHFSSNTMATLAAAGLWATIGLLFGLTSLIFFNEHWSIARQTIWHFGLSYLGFTPLAILAGWFPLNVTWLLLYTLIFIGIYLVIWTYSMLRARKTVQHLNDTLSHH
>NZ_LS483405.1|WP_021742594.1|1123471_1124065_+|NAD(P)H-dependent-oxidoreductase
MMQINLVLGSSREKSLGRRVFNYLKNQQNDFEQQNAVHLNFIAVGDYQLPFFYEDVAPMNNQDRHLPAQQQAWLDDMEQASGYIFITPEYNHSFPAVLKNGLDYLAFQTAKKPALIMSYSDNARAGQFGGVDLTRLGMTVLPPLVGIGNVQKNFNEAGEFLVNAPSKDFYHQKLQQTVEKIAFYSRLFADNPFTPQS
>NZ_LS483405.1|WP_021742593.1|1122051_1123485_+|MFS-transporter
MKTQAIRWWVLACIGIMTFMDDLDASIVNVALPVINRALAINMGVAELIVSVYLITICVFLLPFGRLGDTFSKVRVFKWGMWLFVLGSLGCGLSPNIISLLLCRLIQGLGAAMTMSTNNGIITESFPINERGRALGWIGSFVALGMIAGPGIGGLLLSFLPWESIFWINVPIGLLLMGLGHAVLTTETGSDDRPVFDWLGSGLIGIGISGFFGYLYAGQQLGYGQPLLMGLLAVAMIATLVFILYEIKCQQPLLDLKIFRKTDFTVGVGTALLVFVANNFYMVLTPFYLENAKVIGASVAGLIMMILPVVQVLMAPIAGRIADNQGPFKLCLTGLLIILSAQIGFVLINQQTPLTLVGGLIGLLGLGNALFQSPNNALIMGAVEQTQLGVAGSVNALSRNIGMVLGNALATSLLFVIMSALTRSKVTNFDGHFKRAFITGQSWVYLLGSLLVLLAIGLVSFNTWKNKKMEALSDDAN
>NZ_LS483405.1|WP_021742592.1|1121457_1121943_-|MarR-family-transcriptional-regulator
MISSANAKNLMACISQLLTQDTTVDQEKKWMLSQVATDTTLTATIKALRTADFHTIATISTLTPAYLKSLPEKTGLSQPTISRMMTRLSHHDLVEKYRTVTNSKDILVRLTPKGTQIAEIHAQLDQRILNNVAQVLEPYSQTEVTTTIQILQEIAKIDVNR
>NZ_LS483405.1|WP_021742591.1|1120963_1121368_-|MerR-family-transcriptional-regulator
MEYTMSDVCQKFNLSEYTLRYYDKINLIPGVYRNEQNRRVFTEDAVGWLQFVIALRSTGMPIADVKKYIALTTTTDDSTIQARLTMLQKQAAKVDSQIADMHKQRQIIADKINHYQQAMKTAPDPTKKSYQRWV
>NZ_LS483405.1|WP_021742590.1|1120118_1120955_+|SDR-family-NAD(P)-dependent-oxidoreductase
MTKTWFVTGSSRGLGRAIVENSLSNGDNVVATARNTASLADLATEYGEHIYPLSLDVTDVDAVDAAIQMAIQHFGTIDVLVNNAGFADMDSVEEMPLATFKAQMDTDFYGTLYTIRAVLPTMREAKSGRIINISSIGGRIGGAGLSAYQSAKFAVNGLSEVLAHEVQSFGIQVTTVEPGGMRTEWGGDSMKAASSDLYKDSVGQAISMIHDQWHHAGDRYVSEPDKVAAAIHTLSEMPQAPVHLLIGKDAEQAAQQNAETLAKNDMANRSLTESTGNR
>NZ_LS483405.1|WP_021742602.1|1129824_1130820_-|CAP-domain-containing-protein
MYKTIRKGEFKLSTKAQKLLCIAFSALVGLSITAAVPTTSQAAKRKPGKVVRTMKYKTMKVKAKKGYVYTSTKLTKRGVHLTKYKNKTMTTKKAYLIKVPGKPAVWYDRVSSKNKKLNGYVYNNYLKVIKKTSTKGKTSTKSTNKVPVDPDANVPLKDLYSYGTNSKNNTTQKLGLDGDQSYFDTDVFSKYPANLDEFKSIFVELLNQERLSRGLSPVSVDSDLSKIADKRALDSQKINDLVHLDSAGNSIAAVYAKKAGLNVPPFSECLGFVENAPARMVARESLRDYIYQDAASDWGHRNILLNPSYTRIGVGITTAKNKMTVNAIEMY
>NZ_LS483405.1|WP_021742604.1|1131164_1131395_-|hypothetical-protein
MNIEAAHNSVVLWENKTADLQEHIDGFCTILESHDDPEIKEMVQQAINEKARYNKELQKAQSDLDAAIGSILSSVH
>NZ_LS483405.1|WP_139961388.1|1131507_1131582_-|zinc-ribbon-domain-containing-protein
MECPYCGQPVSASDTQCPYCHRDL
>NZ_LS483405.1|WP_021742605.1|1132042_1132633_+|DJ-1/PfpI-family-protein
MKQAIFIMMDHYADWEGAYLSSQLNQMADWVVKTASNQSEVTSIGGWTTLVDYQISELKPEMTLLVLIGGNAWQHDDPRLTALVQQCLQRKVIVGAICGAVDYLARNGLLTGYNHTGNAQFLWQSFPRYQNPTDFEPQQVVVDRQLVTANGTAALAFTSAVLKASGQLTTAAKQALDLQQLGYYEYTRQYGDPFKP
>NZ_LS483405.1|WP_021742606.1|1132645_1132999_+|MmcQ/YjbR-family-DNA-binding-protein
MERTVIFQHVEDQYGIQPEYLWSKYPSYAILRQPQNHKWFAILMDVSADKLGLLTEQSVPIMVIKLEPEAVESLQADPAFLPAYHMNKSHWVSARLDQISTEESYRLLEHSYTLVSG
>NZ_LS483405.1|WP_035464977.1|1133098_1134187_-|NAD(P)-dependent-alcohol-dehydrogenase
MQIKTAFSDGTSGQLKIIDATLDEPKANEVLIKMVATGVCHTDTAGRDGLTTPLPVSLGHEGAGIVEQVGSSVMDLQPGDHVVLSFAYCGRCQHCLTGHPGMCEHFNELNFAGHNFDGSHRIHTLDGQPISTFFGQSSFSTHAVVDQHNVIKVDPTVDLRLLGPLGCGIQTGAGTVLNYLQPKFGESLVIFGTGAVGLSAIMAAKITGANHIIAIDIFDNRLALAKELGATEVINSHQADVEATLKEILPTGADYTIDTTGVSPVVMNALHALKPGGECAVVGMGRDLTFNLMNDLMAEGKKISGVIEGDAIPQLFIPKLVDYYKKGRFPFDKLIKFYDFDQINDGFAASKDGSVLKPVVTF
>NZ_LS483405.1|WP_021742608.1|1134305_1135202_+|LysR-family-transcriptional-regulator
MEERQLILFVETVQLGSFQKTAELNLMSQRAVSKRISALETEIGATLFDRQKNKINLTAAGKHFLTRATELLNTMRMTTYEVQQITQQAKEQFSVGYFSPFEGALLRMALLDLPTTTNFLIEEAGIEHLISDVLLKKIDCAVIIDNPLFNAKIDQTNLDSVTLVTDHMTLGISPDLITDQTDSPADYLAKFPVIYYSSEESTYLEEVFKSSIGQFADTFSARRVNSYEQMQLLVGMGKAISFYPTELIKYMATPYDHITYLSLDGVTTAHSEFKLIYHHNNHQPLIKQIQRYFDNHQF
>NZ_LS483405.1|WP_035464978.1|1135284_1135632_-|MerR-family-transcriptional-regulator
METVAQRYHISTSAIRYYEQQGLIGPINRINGIRDFNTTDLERMDFILCVKQCGMTIKQMKQFIATYEQGDSTLRERLAILQAQLSTSEEQRTTLTRSINHLKQKIGDIRIRLAE
>NZ_LS483405.1|WP_021742610.1|1135759_1136767_+|aldo/keto-reductase
MQYTKLGHTEIMASKICVGAMSFGQPGTMHDWTLDYPASERVIGHALSLGINFFDTANGYSAGTSETYLGRALKAQRVARDQVVLASKVYFNPGRLSAKAIHHEIDGTLKRLGTDYLDLYIIHRFDYDTPIEETMAALNELVTAGKVRAIGASAMYGYQFNNMQQVAKDRGWAQFQTMENHYNLLYREDERELIPICQQQGVSLMPYSPLAAGHLSHSAWQVDTLRSQTDRVAMGKYDRTETEDQRIVARVAELAHKYQVSMTQIALAWQWAKGVAAPIVGSTKTSHLDEAVAALSVKLTTADIDYLEDLYRPHPIVGALDHNPAAGTILIDQKK
>NZ_LS483405.1|WP_021742611.1|1136900_1137551_+|nitroreductase
MDVLEAIKDRHATRAFDDKAIDDQNLTAIVTDAQRTPSWGNSQPWEVYIATGKSLEQIKSRYAAAAQAGVTEAADLAKAHRGDFSTMANQNMGHWVGTFRPIIEADQTTYWDSRENLYRAPAIAYLVLGQNPNSWSIYDLGAFSQTLSLAATARGVQSLSSYELVKYPDILRQELAVPTDRTIAMGIALGYEKPDKVLNQFRTDRVATQQILHIQH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	MN830254	Lactobacillus phage JNU_P2, complete genome	42714-42743	4	0.867
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	MN830255	Lactobacillus phage JNU_P4, complete genome	29237-29266	4	0.867
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	NZ_CP036260	Sporomusa termitida strain DSM 4440 plasmid pSPTER, complete sequence	59572-59601	7	0.767
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	136721-136750	7	0.767
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	116474-116503	7	0.767
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	NC_015963	UNVERIFIED_ORG: Enterobacter soli plasmid pENTAS01, complete sequence	39067-39096	7	0.767
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	MG945601	UNVERIFIED: Microviridae sp. isolate 4418-1801, complete genome	4149-4178	7	0.767
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	MG945777	UNVERIFIED: Microviridae sp. isolate 3995-1801, complete genome	4165-4194	7	0.767
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	NZ_CP030091	Lactobacillus reuteri strain YSJL-12 plasmid unnamed2, complete sequence	9293-9322	8	0.733
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1642761-1642790	8	0.733
NZ_LS483405_3	3.1\|1127872\|30\|NZ_LS483405\|CRISPRCasFinder	1127872-1127901	30	MH319722	Marine virus AG-345-D19 Ga0172267_103 genomic sequence	11330-11359	8	0.733

1. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 4, identity: 0.867

gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
gcaatgagcaaaaggtcatgctgaacttaa	Protospacer
*.************************.*.

2. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 4, identity: 0.867

gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
gcaatgagcaaaaggtcatgctgaacttaa	Protospacer
*.************************.*.

3. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to NZ_CP036260 (Sporomusa termitida strain DSM 4440 plasmid pSPTER, complete sequence) position: , mismatch: 7, identity: 0.767

gtaatga-gcaaaaggtcatgctgaacctgt	CRISPR spacer
-cagcgatccaaaaggccatgctgaacctga	Protospacer
 .*..**  *******.*************

4. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 7, identity: 0.767

gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
gaaaggagcaaaaagtcatgctgaaatact	Protospacer
* ** ********.*********** .  *

5. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 7, identity: 0.767

gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
gaaaggagcaaaaagtcatgctgaaatact	Protospacer
* ** ********.*********** .  *

6. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to NC_015963 (UNVERIFIED_ORG: Enterobacter soli plasmid pENTAS01, complete sequence) position: , mismatch: 7, identity: 0.767

gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
aagaagaaaaaaaggtcatgctgagcctgt	Protospacer
. .* **. ***************.*****

7. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to MG945601 (UNVERIFIED: Microviridae sp. isolate 4418-1801, complete genome) position: , mismatch: 7, identity: 0.767

--gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
cgctagt--gcaaaaggtcatgctgaagctaa	Protospacer
   **.*  ****************** **.

8. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to MG945777 (UNVERIFIED: Microviridae sp. isolate 3995-1801, complete genome) position: , mismatch: 7, identity: 0.767

--gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
tgctagt--gcaaaaggtcatgctgaagctaa	Protospacer
   **.*  ****************** **.

9. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to NZ_CP030091 (Lactobacillus reuteri strain YSJL-12 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
tcaacgagaaaaaggtcatgctgaacgaca	Protospacer
 .**.*** *****************

10. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 8, identity: 0.733

gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
accgggagcaaacggtcattctgaacctga	Protospacer
.. . ******* ****** *********

11. spacer 3.1|1127872|30|NZ_LS483405|CRISPRCasFinder matches to MH319722 (Marine virus AG-345-D19 Ga0172267_103 genomic sequence) position: , mismatch: 8, identity: 0.733

gtaatgagcaaaaggtcatgctgaacctgt	CRISPR spacer
aaacttcacaaaaggtcttgctgaacctga	Protospacer
. * *  .********* ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1276959 : 1286214

Staphylococcus_phage(42.86%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021741848.1\|1276959_1277811_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	5.8e-15	33.6
WP_011667560.1\|1277979_1278621_+	hemolysin III family protein	NA	NA	NA	NA
WP_021741847.1\|1278800_1279292_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	9.7e-23	37.2
WP_021741846.1\|1279307_1280258_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	2.0e-117	62.1
WP_021741845.1\|1280269_1282162_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.2e-49	29.5
WP_021741844.1\|1282190_1283384_-\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	2.1e-34	39.3
WP_042254316.1\|1283559_1284456_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.6e-52	38.8
WP_021741843.1\|1284573_1285833_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011667553.1\|1285938_1286214_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.1e-26	68.5

DBSCAN-SWA_2

1555257 : 1591796

Lactobacillus_phage(50.0%)

plate,tail,protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_111705396.1\|1555257_1555986_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_035464831.1\|1556246_1556492_-	hypothetical protein	NA	NA	NA	NA
WP_021742214.1\|1556641_1557604_+	NAD(P)-binding domain-containing protein	A0A1B1IVB5	uncultured_Mediterranean_phage	5.3e-25	28.7
WP_035464833.1\|1557823_1560538_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_021742217.1\|1560550_1561222_+	beta-phosphoglucomutase	NA	NA	NA	NA
WP_021742218.1\|1561277_1562048_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_021742219.1\|1562201_1562849_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.8e-45	46.4
WP_011668242.1\|1562897_1563224_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_021742220.1\|1563297_1564773_-	MFS transporter	NA	NA	NA	NA
WP_015473935.1\|1564978_1566166_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.5e-149	69.4
WP_021742221.1\|1566409_1567117_+	hypothetical protein	NA	NA	NA	NA
WP_021742222.1\|1567222_1567564_+	hypothetical protein	NA	NA	NA	NA
WP_021742223.1\|1567611_1568181_-	hypothetical protein	NA	NA	NA	NA
WP_024526645.1\|1568386_1568710_+	heavy metal-binding domain-containing protein	M4STD1	Rhodobacter_phage	9.2e-06	35.6
WP_021742225.1\|1569083_1569653_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_021742226.1\|1569906_1570374_+	universal stress protein	NA	NA	NA	NA
WP_021742228.1\|1571812_1572217_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_021742229.1\|1572234_1572654_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_021742230.1\|1572669_1572852_-	hypothetical protein	NA	NA	NA	NA
WP_021742231.1\|1572870_1573416_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_021742232.1\|1573428_1573686_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_021742233.1\|1573922_1574975_-	glycosyl hydrolase family 25	D6PSS2	Lactobacillus_phage	1.5e-153	82.4
WP_021742234.1\|1574974_1575490_-\|holin	phage holin, LL-H family	D6PSS1	Lactobacillus_phage	1.9e-45	62.1
WP_035464871.1\|1575486_1575861_-\|holin	phage holin family protein	A0A097BY69	Enterococcus_phage	1.6e-17	41.4
WP_011667838.1\|1575947_1576118_-	hypothetical protein	D6PSR8	Lactobacillus_phage	2.5e-18	83.9
WP_035464873.1\|1576276_1576735_-	hypothetical protein	NA	NA	NA	NA
WP_021742238.1\|1576759_1577242_-	hypothetical protein	NA	NA	NA	NA
WP_035464836.1\|1577351_1577831_-	hypothetical protein	NA	NA	NA	NA
WP_021742240.1\|1577942_1578386_-	hypothetical protein	NA	NA	NA	NA
WP_021742241.1\|1578485_1578980_-	hypothetical protein	NA	NA	NA	NA
WP_035464838.1\|1578990_1580523_-	hypothetical protein	A0A1S5RCQ5	Lactobacillus_phage	7.0e-11	29.5
WP_021742243.1\|1580539_1581253_-	hypothetical protein	NA	NA	NA	NA
WP_021742244.1\|1581245_1582394_-\|plate	baseplate J/gp47 family protein	A0A2H4J8D2	uncultured_Caudovirales_phage	5.5e-45	32.6
WP_021742245.1\|1582377_1582764_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_021742246.1\|1582753_1583167_-	hypothetical protein	NA	NA	NA	NA
WP_021742247.1\|1583175_1584429_-	hypothetical protein	NA	NA	NA	NA
WP_021742248.1\|1584428_1584893_-	hypothetical protein	D6PSZ5	Lactobacillus_phage	8.0e-11	35.1
WP_021742249.1\|1584908_1585886_-	hypothetical protein	NA	NA	NA	NA
WP_021742250.1\|1585946_1591796_-\|tail	phage tail tape measure protein	D6PSZ2	Lactobacillus_phage	7.9e-55	60.3

DBSCAN-SWA_3

1608744 : 1619325

Lactobacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035464885.1\|1608744_1609182_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	5.5e-78	98.6
WP_021742278.1\|1609305_1609494_-	helix-turn-helix transcriptional regulator	D7RWH5	Brochothrix_phage	4.8e-07	43.5
WP_035464849.1\|1609624_1610242_+	hypothetical protein	NA	NA	NA	NA
WP_021742280.1\|1610446_1610638_-	hypothetical protein	D6PSV7	Lactobacillus_phage	3.9e-28	96.8
WP_035464850.1\|1610618_1611068_-	hypothetical protein	D6PSV5	Lactobacillus_phage	2.6e-35	57.8
WP_021742283.1\|1611139_1611364_-	hypothetical protein	NA	NA	NA	NA
WP_021742285.1\|1611579_1611780_-	hypothetical protein	NA	NA	NA	NA
WP_021742286.1\|1611792_1611972_-	hypothetical protein	NA	NA	NA	NA
WP_021742288.1\|1612141_1612405_-	hypothetical protein	NA	NA	NA	NA
WP_021742289.1\|1612392_1612812_-	RusA family crossover junction endodeoxyribonuclease	D6PSU4	Lactobacillus_phage	1.4e-43	60.4
WP_052538417.1\|1613502_1614414_-	DnaD domain protein	D6PSU3	Lactobacillus_phage	6.6e-17	62.7
WP_162251063.1\|1614425_1615340_-	PD-(D/E)XK nuclease-like domain-containing protein	E9LUM4	Lactobacillus_phage	4.1e-43	35.3
WP_021742294.1\|1615263_1616133_-	recombinase RecT	A0A1B0YA63	Lactobacillus_phage	8.1e-65	51.7
WP_021742295.1\|1616133_1616349_-	hypothetical protein	NA	NA	NA	NA
WP_021742296.1\|1616339_1616633_-	hypothetical protein	NA	NA	NA	NA
WP_021742297.1\|1616742_1616901_-	hypothetical protein	D6PST6	Lactobacillus_phage	1.6e-16	76.9
WP_035464852.1\|1616906_1617182_-	hypothetical protein	D6PST5	Lactobacillus_phage	7.5e-25	60.9
WP_021742299.1\|1617186_1617696_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	5.7e-42	53.8
WP_021742300.1\|1617756_1617921_-	hypothetical protein	NA	NA	NA	NA
WP_035464854.1\|1618053_1618431_+	hypothetical protein	NA	NA	NA	NA
WP_021742303.1\|1618541_1618790_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021742304.1\|1618956_1619325_+	helix-turn-helix transcriptional regulator	A8ATX5	Listeria_phage	5.9e-09	39.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LS483405

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection