CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_LR594662	Variovorax sp. RA8 chromosome 1	7 crisprs	csa3,DEDDh,DinG,cas3,WYL	1	1	2
NZ_LR594665	Variovorax sp. RA8 plasmid 4	0 crisprs	NA	0	0	0
NZ_LR594664	Variovorax sp. RA8 plasmid 3	2 crisprs	cas14i,c2c9_V-U4	0	2	1
NZ_LR594663	Variovorax sp. RA8 plasmid 2	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LR594662_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594662_1

766212-766397

Orphan

Consensus_repeat	Method
GCGATCGGCGGCCCCGGGTCGTCGCGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_LR594662_1

>merge|NZ_LR594662|1|766212-766397|CRISPRCasFinder
GCGATCGGCGGCCCCGGGTCGTCGCGGGCCACGACCGGCGAAGGGCTCCTGGATGGAGTGACCAGCGGCCCTGCTCCTGGAGCGACCGGCGGCCCCGGGTCGTCGCGGCCCCAGGACATGGTGCTGCGTGTCGAGCTGTACACCGGACCCGGGCCCGGGACGATCGGCGGGCCAGGATCGTCACGG

>NZ_LR594662|1|1|766212-766397|CRISPRCasFinder
GCGATCGGCGGCCCCGGGTCGTCGCGG	GCCACGACCGGCGAAGGGCTCCTGGATGGAGTGACCAGCGGCCCTGCTCCTGGA
GCGACCGGCGGCCCCGGGTCGTCGCGG	CCCCAGGACATGGTGCTGCGTGTCGAGCTGTACACCGGACCCGGGCCCGGG
ACGATCGGCGGGCCAGGATCGTCACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594662.1\|WP_162584730.1\|770626_771439_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223487
NZ_LR594662.1\|WP_162584727.1\|767274_768612_-\|cytosine-deaminase	unknown	unknown	gnl\|CDD\|236062
NZ_LR594662.1\|WP_162584719.1\|757710_758013_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162584720.1\|758176_758380_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162584729.1\|769382_770630_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341239
NZ_LR594662.1\|WP_162584728.1\|768753_769311_+\|DJ-1/PfpI/YhbO-family-deglycase/protease	unknown	unknown	gnl\|CDD\|153228
NZ_LR594662.1\|WP_162584735.1\|775758_777717_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341296
NZ_LR594662.1\|WP_162584724.1\|762837_764028_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226669
NZ_LR594662.1\|WP_162584723.1\|761798_762824_+\|D-xylose-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380648
NZ_LR594662.1\|WP_162584716.1\|754182_755202_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
NZ_LR594662.1\|WP_162584718.1\|757358_757685_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162584736.1\|777801_778524_+\|cyclic-nucleotide-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|223736
NZ_LR594662.1\|WP_162584731.1\|771575_772892_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380557
NZ_LR594662.1\|WP_162584733.1\|773999_774929_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_LR594662.1\|WP_162584722.1\|759265_760645_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162584732.1\|772932_773997_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_LR594662.1\|WP_162584734.1\|774928_775762_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213186
NZ_LR594662.1\|WP_162584725.1\|764888_765866_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	unknown	unknown	gnl\|CDD\|270294
NZ_LR594662.1\|WP_162589523.1\|764084_764864_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224053
NZ_LR594662.1\|WP_162584721.1\|758435_759269_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_LR594662.1\|WP_162584727.1\|767274_768612_-\|cytosine-deaminase	gnl\|CDD\|236062	PRK07583, PRK07583, cytosine deaminase.	0
NZ_LR594662.1\|WP_162584733.1\|773999_774929_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	4.94754e-53
NZ_LR594662.1\|WP_162584729.1\|769382_770630_-\|AMP-binding-protein	gnl\|CDD\|341239	cd05913, PaaK, Phenylacetate-CoA ligase (also known as PaaK). PaaK catalyzes the first step in the aromatic degradation pathway, by converting phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Phenylacetate-CoA ligase has been found in proteobacteria as well as gram positive prokaryotes. The enzyme is specifically induced after aerobic growth in a chemically defined medium containing PA or phenylalanine (Phe) as the sole carbon source. PaaKs are members of the adenylate-forming enzyme (AFE) family. However, sequence comparison reveals divergent features of PaaK with respect to the superfamily, including a novel N-terminal sequence.	7.99405e-102
NZ_LR594662.1\|WP_162584728.1\|768753_769311_+\|DJ-1/PfpI/YhbO-family-deglycase/protease	gnl\|CDD\|153228	cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. This group includes proteins similar to PfpI from P. furiosus. and PH1704 from Pyrococcus horikoshii. These enzymes are ATP-independent intracellular proteases and may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For PH1704, it is believed that this Cys together with a different His in one monomer and Glu (from an adjacent monomer) forms a different catalytic triad from the typical GATase1domain. PfpI is homooligomeric. Protease activity is only found for oligomeric forms of PH1704.	3.477e-84
NZ_LR594662.1\|WP_162584735.1\|775758_777717_-\|AMP-binding-protein	gnl\|CDD\|341296	cd17641, LC_FACS_bac1, bacterial long-chain fatty acid CoA synthetase. The members of this family are bacterial long-chain fatty acid CoA synthetase, most of which are as yet uncharacterized. LC-FACS catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, and the formation of a fatty acyl-CoA. Free fatty acids must be "activated" to their CoA thioesters before participating in most catabolic and anabolic reactions.	0
NZ_LR594662.1\|WP_162584724.1\|762837_764028_+\|ABC-transporter-permease	gnl\|CDD\|226669	COG4214, XylH, ABC-type xylose transport system, permease component [Carbohydrate transport and metabolism].	1.07708e-106
NZ_LR594662.1\|WP_162584730.1\|770626_771439_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	3.29814e-104
NZ_LR594662.1\|WP_162584716.1\|754182_755202_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	8.01803e-117
NZ_LR594662.1\|WP_162584723.1\|761798_762824_+\|D-xylose-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380648	cd19993, PBP1_ABC_xylose_binding-like, periplasmic xylose-like sugar-binding component of the ABC-type transport systems. Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, the periplasmic xylose-binding protein is homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR.	9.0495e-157
NZ_LR594662.1\|WP_162584736.1\|777801_778524_+\|cyclic-nucleotide-binding-domain-containing-protein	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	1.58157e-25
NZ_LR594662.1\|WP_162584731.1\|771575_772892_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380557	cd06334, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine binding protein (LIVBP); however their ligand specificity has not been determined experimentally.	1.02772e-132
NZ_LR594662.1\|WP_162584734.1\|774928_775762_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	8.80429e-113
NZ_LR594662.1\|WP_162584732.1\|772932_773997_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.76196e-63
NZ_LR594662.1\|WP_162584725.1\|764888_765866_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	gnl\|CDD\|270294	cd13576, PBP2_BugD_Asp, Aspartic acid transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	3.35912e-127
NZ_LR594662.1\|WP_162589523.1\|764084_764864_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	2.25032e-107

>NZ_LR594662.1|WP_162584725.1|764888_765866_-|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD
MKKLLALTAIAAVVTGVHAQEFPGGKPISIVVPFAAGGPTDRVARDLAEALRKPLGGASIVVDNVPGAGSSIGAAKVARAAPDGHTLLLNHIGMATVPTLVRNVPFKVETDFEYLGIVNDVPMTLIAKPSMKANNYKELTAWLAENKGKINLGNAGVGSASHLCGLLFQSATKTEMTPVPYKGTAPAITDLIGGQIDLLCDQTTNTSPQIEAKKVKAYAVTTSKRLATPLLKDLPTLQESGLKGFEITIWHGLYAPKGTPPAVTKKLNDALKVALKDPDFIKKQEGLGAVVASDNRVEPAEHKKFVAAEIAKWSPIIKAAGVYAD
>NZ_LR594662.1|WP_162589523.1|764084_764864_+|ATP-binding-cassette-domain-containing-protein
MPASAAPPLVELRDIRKSFGGVKAVDGVSVNLYPGEVVALLGHNGAGKSTLMKMLAGAYPVDSGETRIAGEAVHIRTPSEAQAQGIETIYQTLALADNLDSVANLFLGREKLTPWRTLDDHFMENEARKVFRRLNKNFTNIRVPVRRLSGGQRQVVAISRALYFNARILIMDEPCAALGPEETAMVGALVKQLKADGVGIFLITHDMPDVFALSDRLAVMKNGRLVGTYRTADVNEDEVLGMIIAGKRPHGKPQAEHAT
>NZ_LR594662.1|WP_162584724.1|762837_764028_+|ABC-transporter-permease
MSDSQSLWKRSGIDLRLLLMCALLAVMAIVFHWLSGGVFLSPENLYNIAQQTAVVGIVSTVMVLVIVARHIDLSVGSVMGFVGVLVAYLQYTSGWSWPAACLAGLAVALLVSLYQGGLTAMLGVPSFVVTLGGLMSFRGAAFLVADGKTQPVNDEFFQRLGGGYDGGIGTTASWALAALVALVLFARMLQQRRARQRHEMPVEPLWLDVLLTAVPVVVVFAFAATMNSYQISSKTEPQGIPIPVLIWAVVAVVLSFIVHRTRFGRYVFAMGGNPDAAALVGIPVKRVTLLLFALLAVLVTVAAIVSIARLNAGTNSLGSGMELYVIAAAVIGGAALAGGSGSIFGSVLGALIMQSLDSGMLLLDVAIGKRMVIIGQVLIVAVVFDVLYRKHFGEGR
>NZ_LR594662.1|WP_162584723.1|761798_762824_+|D-xylose-ABC-transporter-substrate-binding-protein
MNKPLRALGALAFGLSAIAASAQTVVGVSWSNFQEERWKTDEAAIKAQLEKLGAKYISADAGGSPEKQLGDIEGLMSKGAKALIVLAMDKDAILPAVNKAMRQKVPVVAYDRLIETPGVFYITFDNVEVGRMQARAVYKVQPKGNYVFIKGSPTDPNANFLRAGQQEIVAEAVKKGDIKIVGDEYTDGWKPEVAQKNMEQILTKAGNKVDAVVAANDGTAGGAVAALTAKGIRGIPVSGQDADFAALNRVALGTQTVTVWKDSRELGREAASAAIALTQGKTPEKAANWSGGEKKVAISSRLLTPVPITRDNLDVVVKEGWIKKDELCRGVSGDKAPAACK
>NZ_LR594662.1|WP_162584722.1|759265_760645_+|hypothetical-protein
MTNGFLRAALLALSTALLLSCGGGGSGGGGSVALVGVGGTASVTGSSLGDGSNSPVGGAADGQGGSASGTGGGSAGTGGGSAGTGGTSTAASGDDGSGVGSGGTGVSTADASGVGGVDGVGSIIVNGVRYNTDTAVLNVEDASALQLGMSAKVTGPFNADLTSGVARRVDSAADLRGTLSSVDLVQGSFVILGTTVTTDDATVWADSTGLAAIPPGSTLQVWGLPGAPGVLRATRVEQRGPSAPVLTGTVQNLDPLRRAFTIGAFTVDYSTAVLSGSLDGSPLANGTLVCVRAATVLLPGRLTATQVQWWYPVPRANATPVQLAGIVTDYGGLGSLRVLNVPVNAASAQITGGPAGSVGNGVKVEVGGTMSNGVLQATKLKIRHVPGTGGPSSFTLIGTVGNFSSAASFRVRGQPVDASGPGVVFVNGTAANLGNGVSVNIEGARVVNGVLIATRVSFQ
>NZ_LR594662.1|WP_162584721.1|758435_759269_+|hypothetical-protein
MGWALQACARVMRPIVRLALALGLKHAHLELMLRELLIDEARRAWLDKGVEPNLSQLSVTTGLNRKAVTAKVREAEEPLPHTEMSAAAKTLTLWLQMSTDDPALQALPLVAEGGAPSFEAVARHASRGNVHHRTILDELVRLNLVTEDAGRVALNAAGFVPSKDLKGMLAFLGDNARDHLLASVANTLGEAPPMLERAVFATGIAVEDCERIHQLARQRWNALHHELTSEMTRAYEAAESTAAARIRVGIYTYYEDAADVAHNGPVTPPKKSKGKEA
>NZ_LR594662.1|WP_162584720.1|758176_758380_+|hypothetical-protein
MSRKTLRALFEIRLRWSDKVIQEEPRPYVGGLWVPDTPRNRDRLDKAVALGNTLYGDQTHWIEKRQA
>NZ_LR594662.1|WP_162584719.1|757710_758013_-|hypothetical-protein
MSKPVTHKKSAAAWRSSRSIGAARYARSSSRTWREPREKKARGAWIAAMRVRKAMQARIVEAFGTYVNGSGPGPTDEDLLVFARLAIAEQRLARRLRQSP
>NZ_LR594662.1|WP_162584718.1|757358_757685_-|hypothetical-protein
MTSVAIANSSSPSDVAFGNLIDLAMLRTGAVSVEVCEACNTINLGAARFCKGCSHKLPAFYGATPADEPTAPPAGWGGTPRRGWTWDLAAFWLVINSLAGATALGSVW
>NZ_LR594662.1|WP_162584716.1|754182_755202_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MNTEISETERLALYRMMRRIRAFENAAEVASQGGVSAYGQEAAGAARVRGPLHLSTGQEAVAAGVCAHLAKADYLTSTHRGHGHTLAKGADLTRMMCELFGKASGFNGGKGGSMHIADFSVGMLGANGVVAAGLPIAVGAAHAQKLQRKDAITVCFFGDGAINRGPFLESLNWARVYALPVLFVCEDNQWSATTASGPMTAGDGASARADALDIAATRVDGNDVFAVHAAARTLVGEVRSGLGPRLLHALTYRVKGHVSVDPAGYRDPAELAAALETDPIERARMRLLAGGAEAAVLDAIEHEAQAEVEAALAVADAAPWPEAAAAFTDVQSTGAGQWT
>NZ_LR594662.1|WP_162584727.1|767274_768612_-|cytosine-deaminase
MTHAFFEPPATSRYALRKLSAPRCLLPGDFAGSGADSELAAIDLLVDQGRVAAIEPAGTLPAELGPDLDASMVLPGLLDCHTHLDKGHIWPRQANPTGDGAGASMATQRDRQARWHAEDVRRRMEFGLATAYAKGVVAIRTHLDSLAPQAAISFPVFREVRERWAGRIALQVSSIAPLDIFLAEEGRHLADIVAESGGRLGCVTRSTRHPGDPMPPDLDEALARVFQLAAERGLDLDLHVDESTDPRARALIRVARTAAAQDFAGRILCGHCTALALQTDEFIEETIAACKDAGIDIVSLPTVNMYLQDRSPAGRTPRWRGVTVLHEMKAHGLRVAVAGDNCRDPFYAYGDHDMLDTFTQAVKILHLDHPLSDWIRAASETPAAIMGLDLGLLKPGMAADLLVLKARNYSEMLSRTQFDRTVLRAGRAIDTTPPDYRLLDDLMDA
>NZ_LR594662.1|WP_162584728.1|768753_769311_+|DJ-1/PfpI/YhbO-family-deglycase/protease
MIKRQLEGMKVAILVADGFEQSEMIEPRRVLDAAGADTSLVSPSKGGVRGWKHHTPADRFEVDVPLQQAAAHEYDALVLPGGVMNPDALRMDEQAVTFVRDFVKAGKPIAAICHGPWTLIEADAVKGRTMTSWPSLRTDLKNAGARWVDLEVVADGPLITSRKPADLPAFNRVMLETFAGVHAHA
>NZ_LR594662.1|WP_162584729.1|769382_770630_-|AMP-binding-protein
MTEFYDKLEVRDPAEREQDLLAALPKQIAQAQTAAPAFAKILDGVKPGDIASREALASLPVTRKSELLERQKAERARDPFGGFSAIRFGPRMLRVFASPGTIYEPEGEARDYWRTARALHAAGFRGGDLVHNAFSYHMTPAGAIMESGARALGCTVFAGGTGQTEQQVDAIAELKPAGYAGTPSFLKILLEKAAERAVALPSLTKALVSGEAFPPSLRDWIAERGVAGMQCYATADLGLIAYETAAREGLVLDEGVIVEIVRPGTGDPVPEGEVGEIVVTTLNPDYPLIRFGTGDLSAVLPGPCPTGRTNIRIRGWLGRADQTTKVRGMFVHPGQVAEIARRFPEVRRARLVVEGEMGEDRMTLRLECASEPEGLVERVAEAVRDVTKLRGEVELMEPGSLPNDGKVIEDARSYR
>NZ_LR594662.1|WP_162584730.1|770626_771439_-|ATP-binding-cassette-domain-containing-protein
MSQADILLDVNGIEVIYNHVILVLKGVSLKVPERGIVALLGGNGAGKTTTLRAVSNLLAGERGAVTKGTIELRGERIEALSPAELVKRGLIQVMEGRHCFAHLTIEDNLMTGAYTRTDGKAAVAQTLEKVYAYFPRLKTRRGSQAAYTSGGEQQMCAIGRALMANPSMVLLDEPSMGLAPQIVDEVFGIVKDLNQKEHVTFLLAEQNTNMALRYADYGYILENGRIVMDGEAQSLRENEDVKEFYLGVGGADRKSFRDVKSYKRRKRWLA
>NZ_LR594662.1|WP_162584731.1|771575_772892_-|ABC-transporter-substrate-binding-protein
MKLKSLALAIAAISALAGTAPAFAQAKEQFFPLLVYRTGPYAPNGTPWANGKQDYIKLINATGGINGVKISYEECETGYATDKGVECYERLKDKGATLIDPQATGITFALTDKAPVDKIPLITLGYGLSASQDGSVFKWNFPLMGSYWTAADILIQHIAKKEGGLDKLKGKKITLVYHDSPFGKEPIPLLQERAKMNGFELSLIPVAAPGIEQKSAWLQVRQQRPDYVLLWGWGVMNSTALKEAVATGYPREKMYGVWWAGAEPDVKDVGASAKGYNALALNTSGTQPKVIQDILKTVHDKGQGTGPRDEVGSVLYTRGLIIQMLGVEAVRRAQERFGKGKVMTGEQVRWGLENLALDQKKLDALGFSGVLRPISTSCQDHMGSTWARIHTWDGSKWGGMSDWYQADEQIIKPMVKAAGDKYATEKKLPKREASDCQA
>NZ_LR594662.1|WP_162584732.1|772932_773997_-|branched-chain-amino-acid-ABC-transporter-permease
MLYRENGQFKSSYRADQQVFPILQDRIFMLALLAIAFAVVPLVASEYFFRAILIPFLILSLAALGLNILVGYCGQISLGTGAFMAVGAYAAYNFHVRIEGMPLIASLLLGGLCATVVGVLFGVPSLRIKGLYLAVATLAAQFFLDWAFLRINWLTNNSASGSVSVAGLSVFGLPVESAVQKYLLCLTLLVLFAVLAKNLVRSAIGREWMAIRDMDVAAAVIGIRPVYAKLTAFAVSSFIVGVAGALWGFVHLSTWEPAAFNIDRSFQLLFMVIIGGLGSIMGSFFGAAFIVLLPIVLNQIPGWFGISMSTALASHLEFMIFGALIVFFLIVEPHGLARLWSTAKEKLRLWPFPH
>NZ_LR594662.1|WP_162584733.1|773999_774929_-|branched-chain-amino-acid-ABC-transporter-permease
MGFFLETLFGGLMVGMLYSLIAIGFVLIYKASGVFNFAQGAMVLFAALAMARFAEWFPRWLGFESQVLANVLAFVAAMAVMIVVAWLIERLALSRLVNQEGITLLMATLGIAYFLDGLGQTLFGNDIYKIDVGMPKEPLMVLEGTFQGGLLLSQEDLIAAGVAAALVAVLALFFQKTATGRALRAVADDHQAAQSIGIPLNRIWVIVWSVAGFAALVAGIIWGSKLGVQFSLSLVALKALPVVILGGLTSVPGAIIGGLLIGVGEKLSEIYLGPMLGGGIEIWFAYVLALVFLLVRPQGLFGEKIIDRV
>NZ_LR594662.1|WP_162584734.1|774928_775762_-|ATP-binding-cassette-domain-containing-protein
MNAQNIAEAAMLAGATQGGRRIGEVILDVQNISLSFGGVKALTDISFDVREHEVRAIIGPNGAGKSSMLNCINGVYQPQQGSITFRGRTFHHMNSRQVAEMGVARTFQNLALFKGMSVLDNIMTGRNLKMKSGLLAQALRWGPAEREEIAHREFVEHIIDFLEIQPHRKTPVGRLPYGLQKRVDLGRALAMEPQVLLLDEPMAGMNVEEKQDMSRFILDVNDEFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPDDVRNNEDVIRAYLGTEH
>NZ_LR594662.1|WP_162584735.1|775758_777717_-|AMP-binding-protein
MQTTANTFPRLLLAHAQRQPDAPAVREKDLGIWQTWSWSAVAREVREIACGLASLGFKPGDNLAIVGANRPHLYMAVLAAQSLRGVPVPLYQDAVAGEMVFMLEDAAIDFVIAEDQEQVDKLLECRELMAAQGKQGLRHIVYDDPRGLRHYAQPGLLGYERLRELGRAFDSAQPAFFEQSLNGVEPGDVAVILYTSGTTGRPKGVCQTHASFIAAGRGGVETDRLGPGDNIMSYLPMAWVGDHLFSVAQWMVGGFTLNCPESSATVMNDMREIGPSYYFGPPRTFEGLLTAVSIRMEDAAAPKRWLYAKFMALAQRVGADILNGAKVGLGDRLLYGLGDVLVYGPLRNVLGMSRIRVAYTAGAAIGPDLFRFYRSIGVNLKQFYGQTETCAYVCLQQDGKVKLQTVGSAAPGIELRIAPDGEVLVRGVSVLKEYYKRPDATAEVLDAEGYFHTGDAGVIDAEGHLRIIDRAKDVGKLSRGAIFAPNYIENKLKFFPQIKEAVCFGNGREEVCAAINIDYEAVGNWAERRGLPYGGYVDLAGKPEVLQLIAECVEKVNADLASEEGMGETQIARFLVLHKELDPDDDELTRTRKVRRGFIADKYRVLVDALYGGKAEQYIETQVKFEDGRTGVVSATLKIVEAKRFPPLKAAA
>NZ_LR594662.1|WP_162584736.1|777801_778524_+|cyclic-nucleotide-binding-domain-containing-protein
MTRGSSNGASSLRERVRPATAEELQNIPWLHTLTPAERRRAEAAVVVGDAESGDLVCRIGRPPTFWFGVVEGLLKMSNDNADGTSMTYSGLPPGGWFGEGTALKREPYRYNIQALRRSVVAGLPVDDFHWLLDHSIGFNRFVMNQLNERLGQFIAAREADRLNNPDARVARNLAALFNPVLFPGVGELLRITQQELAYLIGLSRQRVNEALRTLQAKGAIRVEYGGVRVLDLAALRAGGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594662_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594662_2

780111-780225

Orphan

Consensus_repeat	Method
AGGGGGTGGGCGGCTACACGCAGTGAGCCAACCTGGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594662_2

>merge|NZ_LR594662|2|780111-780225|CRISPRCasFinder
AGGGGGTGGGCGGCTACACGCAGTGAGCCAACCTGGGGGAGAGCAACATCCCCGGGCCGCTGGTGTTGCCCCCGGTAGGGGGTGGGCGGCTACACGAAGTGAGCCAACCTGGGGG

>NZ_LR594662|2|2|780111-780225|CRISPRCasFinder
AGGGGGTGGGCGGCTACACGCAGTGAGCCAACCTGGGGG	AGAGCAACATCCCCGGGCCGCTGGTGTTGCCCCCGGT
AGGGGGTGGGCGGCTACACGAAGTGAGCCAACCTGGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594662.1\|WP_162584741.1\|782339_784145_+\|potassium-transporting-ATPase-subunit-KdpA	unknown	unknown	gnl\|CDD\|235494
NZ_LR594662.1\|WP_162584733.1\|773999_774929_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_LR594662.1\|WP_162584745.1\|789776_790469_+\|two-component-system-response-regulator-KdpE	unknown	unknown	gnl\|CDD\|182522
NZ_LR594662.1\|WP_162584735.1\|775758_777717_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341296
NZ_LR594662.1\|WP_162584738.1\|779275_780040_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180796
NZ_LR594662.1\|WP_162584740.1\|781570_781783_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162584730.1\|770626_771439_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223487
NZ_LR594662.1\|WP_162584729.1\|769382_770630_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341239
NZ_LR594662.1\|WP_162584737.1\|778524_779175_-\|SOS-response-associated-peptidase-family-protein	unknown	unknown	gnl\|CDD\|376837
NZ_LR594662.1\|WP_162578354.1\|782117_782216_+\|potassium-transporting-ATPase-subunit-F	unknown	unknown	unknown
NZ_LR594662.1\|WP_162584736.1\|777801_778524_+\|cyclic-nucleotide-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|223736
NZ_LR594662.1\|WP_162584744.1\|787020_789762_+\|DUF4118-domain-containing-protein	unknown	unknown	gnl\|CDD\|236701
NZ_LR594662.1\|WP_162584743.1\|786392_786965_+\|potassium-transporting-ATPase-subunit-KdpC	unknown	unknown	gnl\|CDD\|376890
NZ_LR594662.1\|WP_162584742.1\|784286_786380_+\|potassium-transporting-ATPase-subunit-KdpB	unknown	unknown	gnl\|CDD\|234905
NZ_LR594662.1\|WP_162584731.1\|771575_772892_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380557
NZ_LR594662.1\|WP_162584747.1\|790917_791685_+\|pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
NZ_LR594662.1\|WP_162584739.1\|780233_781196_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_LR594662.1\|WP_162584734.1\|774928_775762_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213186
NZ_LR594662.1\|WP_162584732.1\|772932_773997_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_LR594662.1\|WP_162584746.1\|790496_790769_-\|DUF4242-domain-containing-protein	unknown	unknown	gnl\|CDD\|379428

Protein	Function_ID	Function_description	E-value
NZ_LR594662.1\|WP_162584733.1\|773999_774929_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	4.94754e-53
NZ_LR594662.1\|WP_162584745.1\|789776_790469_+\|two-component-system-response-regulator-KdpE	gnl\|CDD\|182522	PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional.	7.99999e-117
NZ_LR594662.1\|WP_162584735.1\|775758_777717_-\|AMP-binding-protein	gnl\|CDD\|341296	cd17641, LC_FACS_bac1, bacterial long-chain fatty acid CoA synthetase. The members of this family are bacterial long-chain fatty acid CoA synthetase, most of which are as yet uncharacterized. LC-FACS catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, and the formation of a fatty acyl-CoA. Free fatty acids must be "activated" to their CoA thioesters before participating in most catabolic and anabolic reactions.	0
NZ_LR594662.1\|WP_162584738.1\|779275_780040_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|180796	PRK07023, PRK07023, SDR family oxidoreductase.	5.12881e-77
NZ_LR594662.1\|WP_162584741.1\|782339_784145_+\|potassium-transporting-ATPase-subunit-KdpA	gnl\|CDD\|235494	PRK05482, PRK05482, potassium-transporting ATPase subunit A; Provisional.	0
NZ_LR594662.1\|WP_162584730.1\|770626_771439_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	3.29814e-104
NZ_LR594662.1\|WP_162584729.1\|769382_770630_-\|AMP-binding-protein	gnl\|CDD\|341239	cd05913, PaaK, Phenylacetate-CoA ligase (also known as PaaK). PaaK catalyzes the first step in the aromatic degradation pathway, by converting phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Phenylacetate-CoA ligase has been found in proteobacteria as well as gram positive prokaryotes. The enzyme is specifically induced after aerobic growth in a chemically defined medium containing PA or phenylalanine (Phe) as the sole carbon source. PaaKs are members of the adenylate-forming enzyme (AFE) family. However, sequence comparison reveals divergent features of PaaK with respect to the superfamily, including a novel N-terminal sequence.	7.99405e-102
NZ_LR594662.1\|WP_162584737.1\|778524_779175_-\|SOS-response-associated-peptidase-family-protein	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	1.10563e-26
NZ_LR594662.1\|WP_162584736.1\|777801_778524_+\|cyclic-nucleotide-binding-domain-containing-protein	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	1.58157e-25
NZ_LR594662.1\|WP_162584744.1\|787020_789762_+\|DUF4118-domain-containing-protein	gnl\|CDD\|236701	PRK10490, PRK10490, sensor protein KdpD; Provisional.	0
NZ_LR594662.1\|WP_162584743.1\|786392_786965_+\|potassium-transporting-ATPase-subunit-KdpC	gnl\|CDD\|376890	pfam02669, KdpC, K+-transporting ATPase, c chain. This family consists of K+-transporting ATPase, c chain, KdpC. KdpC forms strong interactions with the KdpA subunit, serving to assemble and stabilize the Kdp complex. It has been suggested that KdpC could be one of the connecting links between the energy providing subunit KdpB and the K+-transporting subunit KdpA. The K+ transport system actively transports K+ ions via ATP hydrolysis.	2.32363e-103
NZ_LR594662.1\|WP_162584742.1\|784286_786380_+\|potassium-transporting-ATPase-subunit-KdpB	gnl\|CDD\|234905	PRK01122, PRK01122, potassium-transporting ATPase subunit KdpB.	0
NZ_LR594662.1\|WP_162584731.1\|771575_772892_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380557	cd06334, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine binding protein (LIVBP); however their ligand specificity has not been determined experimentally.	1.02772e-132
NZ_LR594662.1\|WP_162584747.1\|790917_791685_+\|pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	1.07142e-75
NZ_LR594662.1\|WP_162584739.1\|780233_781196_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	3.64813e-138
NZ_LR594662.1\|WP_162584734.1\|774928_775762_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	8.80429e-113
NZ_LR594662.1\|WP_162584732.1\|772932_773997_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.76196e-63
NZ_LR594662.1\|WP_162584746.1\|790496_790769_-\|DUF4242-domain-containing-protein	gnl\|CDD\|379428	pfam14026, DUF4242, Protein of unknown function (DUF4242). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 90 and 170 amino acids in length. There is a single completely conserved residue C that may be functionally important.	2.6066e-25

>NZ_LR594662.1|WP_162584738.1|779275_780040_+|SDR-family-NAD(P)-dependent-oxidoreductase
MNSPQLTIITGASRGLGRAMAEQLLAVPGQRLLCISRRADDALAARAREAGVELEQWQQDLADPVPAAARLAAWLQGLDGQAFDGVVLINNAGTVGRTRPLSQAVAAELSQALRVGLEAPLLLTSAFLAATRGWRGERKVLNISSGLGRNAMASQAPYCAAKAGMDHFSRAVALEEEALGGGAKIVSLAPGVIDTDMQVQLRGAEADMFPDRARFERLKAQGQLDTPESAAAKVLAYLARPDFGNNPVADVRDA
>NZ_LR594662.1|WP_162584737.1|778524_779175_-|SOS-response-associated-peptidase-family-protein
MPIQYEPTRDARHFLEGFGLSSPAQPPVIRPGGQGTFIRRPRGDREGSAVTARFEAAQGRWGLIPLFAKERDYPFTFEARGETAASERNFYQPWKRGHRCVVLADALYRRGDSEDSMVRVTRADGQPLALAGLWNGWRAPDGECVESFALLTLPAVEQPAQRRVVFLREAWLDDWLHCPVEETAAYLRPYALDRLVRRTIVHDPSIPLPERAPAAS
>NZ_LR594662.1|WP_162584736.1|777801_778524_+|cyclic-nucleotide-binding-domain-containing-protein
MTRGSSNGASSLRERVRPATAEELQNIPWLHTLTPAERRRAEAAVVVGDAESGDLVCRIGRPPTFWFGVVEGLLKMSNDNADGTSMTYSGLPPGGWFGEGTALKREPYRYNIQALRRSVVAGLPVDDFHWLLDHSIGFNRFVMNQLNERLGQFIAAREADRLNNPDARVARNLAALFNPVLFPGVGELLRITQQELAYLIGLSRQRVNEALRTLQAKGAIRVEYGGVRVLDLAALRAGGA
>NZ_LR594662.1|WP_162584735.1|775758_777717_-|AMP-binding-protein
MQTTANTFPRLLLAHAQRQPDAPAVREKDLGIWQTWSWSAVAREVREIACGLASLGFKPGDNLAIVGANRPHLYMAVLAAQSLRGVPVPLYQDAVAGEMVFMLEDAAIDFVIAEDQEQVDKLLECRELMAAQGKQGLRHIVYDDPRGLRHYAQPGLLGYERLRELGRAFDSAQPAFFEQSLNGVEPGDVAVILYTSGTTGRPKGVCQTHASFIAAGRGGVETDRLGPGDNIMSYLPMAWVGDHLFSVAQWMVGGFTLNCPESSATVMNDMREIGPSYYFGPPRTFEGLLTAVSIRMEDAAAPKRWLYAKFMALAQRVGADILNGAKVGLGDRLLYGLGDVLVYGPLRNVLGMSRIRVAYTAGAAIGPDLFRFYRSIGVNLKQFYGQTETCAYVCLQQDGKVKLQTVGSAAPGIELRIAPDGEVLVRGVSVLKEYYKRPDATAEVLDAEGYFHTGDAGVIDAEGHLRIIDRAKDVGKLSRGAIFAPNYIENKLKFFPQIKEAVCFGNGREEVCAAINIDYEAVGNWAERRGLPYGGYVDLAGKPEVLQLIAECVEKVNADLASEEGMGETQIARFLVLHKELDPDDDELTRTRKVRRGFIADKYRVLVDALYGGKAEQYIETQVKFEDGRTGVVSATLKIVEAKRFPPLKAAA
>NZ_LR594662.1|WP_162584734.1|774928_775762_-|ATP-binding-cassette-domain-containing-protein
MNAQNIAEAAMLAGATQGGRRIGEVILDVQNISLSFGGVKALTDISFDVREHEVRAIIGPNGAGKSSMLNCINGVYQPQQGSITFRGRTFHHMNSRQVAEMGVARTFQNLALFKGMSVLDNIMTGRNLKMKSGLLAQALRWGPAEREEIAHREFVEHIIDFLEIQPHRKTPVGRLPYGLQKRVDLGRALAMEPQVLLLDEPMAGMNVEEKQDMSRFILDVNDEFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPDDVRNNEDVIRAYLGTEH
>NZ_LR594662.1|WP_162584733.1|773999_774929_-|branched-chain-amino-acid-ABC-transporter-permease
MGFFLETLFGGLMVGMLYSLIAIGFVLIYKASGVFNFAQGAMVLFAALAMARFAEWFPRWLGFESQVLANVLAFVAAMAVMIVVAWLIERLALSRLVNQEGITLLMATLGIAYFLDGLGQTLFGNDIYKIDVGMPKEPLMVLEGTFQGGLLLSQEDLIAAGVAAALVAVLALFFQKTATGRALRAVADDHQAAQSIGIPLNRIWVIVWSVAGFAALVAGIIWGSKLGVQFSLSLVALKALPVVILGGLTSVPGAIIGGLLIGVGEKLSEIYLGPMLGGGIEIWFAYVLALVFLLVRPQGLFGEKIIDRV
>NZ_LR594662.1|WP_162584732.1|772932_773997_-|branched-chain-amino-acid-ABC-transporter-permease
MLYRENGQFKSSYRADQQVFPILQDRIFMLALLAIAFAVVPLVASEYFFRAILIPFLILSLAALGLNILVGYCGQISLGTGAFMAVGAYAAYNFHVRIEGMPLIASLLLGGLCATVVGVLFGVPSLRIKGLYLAVATLAAQFFLDWAFLRINWLTNNSASGSVSVAGLSVFGLPVESAVQKYLLCLTLLVLFAVLAKNLVRSAIGREWMAIRDMDVAAAVIGIRPVYAKLTAFAVSSFIVGVAGALWGFVHLSTWEPAAFNIDRSFQLLFMVIIGGLGSIMGSFFGAAFIVLLPIVLNQIPGWFGISMSTALASHLEFMIFGALIVFFLIVEPHGLARLWSTAKEKLRLWPFPH
>NZ_LR594662.1|WP_162584731.1|771575_772892_-|ABC-transporter-substrate-binding-protein
MKLKSLALAIAAISALAGTAPAFAQAKEQFFPLLVYRTGPYAPNGTPWANGKQDYIKLINATGGINGVKISYEECETGYATDKGVECYERLKDKGATLIDPQATGITFALTDKAPVDKIPLITLGYGLSASQDGSVFKWNFPLMGSYWTAADILIQHIAKKEGGLDKLKGKKITLVYHDSPFGKEPIPLLQERAKMNGFELSLIPVAAPGIEQKSAWLQVRQQRPDYVLLWGWGVMNSTALKEAVATGYPREKMYGVWWAGAEPDVKDVGASAKGYNALALNTSGTQPKVIQDILKTVHDKGQGTGPRDEVGSVLYTRGLIIQMLGVEAVRRAQERFGKGKVMTGEQVRWGLENLALDQKKLDALGFSGVLRPISTSCQDHMGSTWARIHTWDGSKWGGMSDWYQADEQIIKPMVKAAGDKYATEKKLPKREASDCQA
>NZ_LR594662.1|WP_162584730.1|770626_771439_-|ATP-binding-cassette-domain-containing-protein
MSQADILLDVNGIEVIYNHVILVLKGVSLKVPERGIVALLGGNGAGKTTTLRAVSNLLAGERGAVTKGTIELRGERIEALSPAELVKRGLIQVMEGRHCFAHLTIEDNLMTGAYTRTDGKAAVAQTLEKVYAYFPRLKTRRGSQAAYTSGGEQQMCAIGRALMANPSMVLLDEPSMGLAPQIVDEVFGIVKDLNQKEHVTFLLAEQNTNMALRYADYGYILENGRIVMDGEAQSLRENEDVKEFYLGVGGADRKSFRDVKSYKRRKRWLA
>NZ_LR594662.1|WP_162584729.1|769382_770630_-|AMP-binding-protein
MTEFYDKLEVRDPAEREQDLLAALPKQIAQAQTAAPAFAKILDGVKPGDIASREALASLPVTRKSELLERQKAERARDPFGGFSAIRFGPRMLRVFASPGTIYEPEGEARDYWRTARALHAAGFRGGDLVHNAFSYHMTPAGAIMESGARALGCTVFAGGTGQTEQQVDAIAELKPAGYAGTPSFLKILLEKAAERAVALPSLTKALVSGEAFPPSLRDWIAERGVAGMQCYATADLGLIAYETAAREGLVLDEGVIVEIVRPGTGDPVPEGEVGEIVVTTLNPDYPLIRFGTGDLSAVLPGPCPTGRTNIRIRGWLGRADQTTKVRGMFVHPGQVAEIARRFPEVRRARLVVEGEMGEDRMTLRLECASEPEGLVERVAEAVRDVTKLRGEVELMEPGSLPNDGKVIEDARSYR
>NZ_LR594662.1|WP_162584739.1|780233_781196_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MIRKLLTSAALALAFAAVQAQPYPAKPVRLIVPFPPGGGTDILSRLVATKLTEVSKWTVVPDNRAGAGGTIGIAEAVRAQPTGYDIVMGQKDNMVVAPWLYKNLSYEPTKDLMAVAHVAYTPVVIVTRTESKFKTLKDVVDAARAVPDSVTYGSPGNGTTIHLAGEIFKSAAGIKMRHVPYKGSNPAMMDVLAGNVDLMVSSLPSAMGQIKSGKLRALAVTSAKRSSSLPDVPTVAELGYKDFDVSTWYGLFAPAGTPKEIVTTLNAEVNKLLATPEMKAAIIAQGAEPQGMTPEQFGTLLKTDYLKWRDIVKASGATIE
>NZ_LR594662.1|WP_162584740.1|781570_781783_-|hypothetical-protein
METEAIALIVDEPIAGHFYWVLQKQDGNDCRPIDAAEGPMPTYGAAMMAGIAALQRRADARGSNGAQTMH
>NZ_LR594662.1|WP_162578354.1|782117_782216_+|potassium-transporting-ATPase-subunit-F
MISLDVLYGFAGLLAVVLFAYLVFALICAEEF
>NZ_LR594662.1|WP_162584741.1|782339_784145_+|potassium-transporting-ATPase-subunit-KdpA
MNSAAWMLLGLFLAVLGVLAWPLGRWLAALCEGRVPAWMQRAEAPLYKLAGVDVGQAMHWRGYALALLAFNAVGALAVYGLQRLQHVLPLNPAGMGAVSPDSAFNTAVSFVSNTNWQGYAGESTMSYLTQMLGLAEQNFFSAATGIAVAFALARGFAARNKDGKGLVGNFWVDVTRITAWLLLPISFAIAVVLAGQGVIQNFEAYKTVTTLEATAHQQPKLDARGQTLKDASGDPVTEDASTTTQTLAMGPVASQEAIKLLGTNGGGFFNANSAHPYENPTALANFVQMIAIFLIPAALCFAFGRVVGDTRQGWALLAAMTVMFVLAVIAVIPAEHAGNPRLAQLGVDQASSALQAGGNMEGKEVRFGVDASALFAAITTAASCGAVISMHDSFTPLGGTVPLVLMQLGEVVFGGVGTGLYGMLIFAVLAVFISGLMIGRTPEYLGKKIEIREMKLTSIAILVAPILVLAGTAVAVIADPGKAGIANPGAHGFSEILYAFTSAGNNNGSAFAGLSANTPFYNAMLAVAMWFGRFGVIVPVLAIAGSLAAKKRLPVTAGTMPTHGPLFVTLLIGTVMLVGLLNYVPALALGPVVEHLMLWRP
>NZ_LR594662.1|WP_162584742.1|784286_786380_+|potassium-transporting-ATPase-subunit-KdpB
MQMKSSLPLFDASLVRSALWAAFAKLDPRVQWRNPVMFIVYIGSILTTLLWAHALSFPGDTGMAPAFVLAISIWLWFTALFANFAEALAEGRSKAQAASLRGLRKNTWAKKMVEPFHGGKWLPLQAPELRRGDVVLVEAHDVIPLDGEVIEGVASIDESAITGESAPVVRESGGDFSAVTGGTRVLSDWLVVRVTVSPGESFLDRMIGMVEAAKRQKTPNEIALTILLVALTLVFLMVTVTLLPYSIFSVGAMHAGTVVPLTALVALLVCLIPTTIGGLLSAVGVAGMSRMMQANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRRANTFLPAPGVTQQRLGRAALLASLADETPEGRSIVELARRGGIDEPAAEGTRFVPFTAQTRMSGVDLPAAPGAVDTDHLPLRKGAVDAVRRHVETLGGAVPAELLRAADEVARRGSTPLAVAEGQRVLGIVELKDIVKTDIRERFAELRRMGIRTVMITGDNQLTAAAIAAEAGVDDFLAEAAPEDKLALIRKYQSEGRLVAMTGDGTNDAPALAQADVAVAMGTGTQAAKEAGNMVDLDSNPTKLLEVVETGKALLMTRGSLTTFSIANDIAKYFAIIPAIFVSTYPQLAALNVMRLASPSSAILSAVIFNALIIVFLIPLALKGVRYRPVGAAALLRRNLAIYGLGGLVAPFVGIKLIDGLLVAIGLV
>NZ_LR594662.1|WP_162584743.1|786392_786965_+|potassium-transporting-ATPase-subunit-KdpC
MFKILRPTLVVFALLSALTGLLYPLAVTGAAQALFPAQAGGSLVLRGGKPVGSLLIGQNFSDPAQFWGRPSATAPMPYNAAASGGSNQGPLNPALADAVKRRVEALRAADPGNAKPVPVDLVTASASGLDPHISPAAARYQAGRVARLRKLPADRVEALIEDHTEGPLLGLLGEPRVNVLALNLALDAAR
>NZ_LR594662.1|WP_162584744.1|787020_789762_+|DUF4118-domain-containing-protein
MNDAARPDPDALLAELRAQEAQAQRGKLRIYFGASAGVGKTWAMLSAAQRERAGGRDVVIGVVETHGRSETAALLAGLETLPLRDVSYRGRTLAEFDLDGALARKPAVLLVDELAHSNAPGSRHAKRWQDVQELQAAGIEVWSALNVQHLESLNGTVGAITGVRVHETVPDTVLDEADEVVLVDVTADELTARLAAGKVYLPQQAERAAQNFFRKGNLIALREIALRRTAEHVEDDVRGWRIEQSGRGGEAGPPAWNTSGAILACVGPHEGAGQTVRTAARLAGQLNVRWHAAYVETPRLQRLDAPRRDRILAVLQLAEELGAETAVLTGENVARALSAQAQRLNCATLVVGRPEPEQGWRRWWPQRVLTRELARHAPGIDIVEAARADSSRRLAQPRPGGRGDPGVEDSDRPQARWAGYAWAAASSVAVTLLATPLAGVLELANIVMLFLLGVVGVAMRFGRGPAAFAALLNVAAFDFFFVSPRLSFAVSDVQYLVTFAVMLGVGLLVGQLTAGLRFAAGVSTSRERRAQSLFELTRELSAALESSQVLQLGAAAVQGHFGGRALVLMTDAGDRLAMPAELPPGFDPSVADWTFRHGQPAGLATATLAAQPWHYVPLKAPMRVRGVLALEPAQPRWLMIPEQAQQLDTLARQIAIALERVHYVEVAQQAVVEMESERLRNAMLGAISHDVRTPLTALIALAESLQAPPGVAGVDPSAVARAIVAQAHQLHALVNNLLDMARLESGIARGAVQLRREWQSVEEVVGAAIRAARPALGEMAVQTDLPPELPLVEFDAVLIERVLVNLLENAGKYGAAPVVIGARATERSLVLSVRDHGPGLPAALAGREQTLFDKFTRGQAESATPGVGLGLAICKAVVSAHGGEVTAANAVGGGAVFTVTLPRREAPVTEEAG
>NZ_LR594662.1|WP_162584745.1|789776_790469_+|two-component-system-response-regulator-KdpE
MPSPTAIVIEDEPQIRRFVRGALEAEGWRVHEAGTLRDGLAAAGTRHPDLVVLDLGLPDGDGVGLIRDVRGWSGVPIIVLSARTDEADKIAALDAGADDYLTKPFGTGELLARVRANLRRPRAANGSEEPEPVFRFGEVEVDRTARLVRRAGVEVHLTPTEYRLLSVLVANAGRVLTQRQLLREVWGPSHAEQSHYLRIYMGHLRQKLEIDPAQPRYLLTETAVGYRLVP
>NZ_LR594662.1|WP_162584746.1|790496_790769_-|DUF4242-domain-containing-protein
MPRYVIERTLPGAGQLSERDLKALSIKSRGVLYEMGPEINWVESFVTDDKIYCIYVAPNDEMIREHARRGGFPADSVLQVRAIIGPTTAE
>NZ_LR594662.1|WP_162584747.1|790917_791685_+|pseudouridine-synthase
MSDTPEPTRLNKRMAELGLCSRREADDWIAQGWVKVNGRVAEMGLKVAAADRIEVDRKAQNQQQQQVTILLHKPMGYVSGQAEDGHEPAVVLINPRTHWREDPTRLRFSPPQLRGLAPAGRLDIDSVGLLVLTQDGRVARQLIGEDSGMEKEYLVRVSYGEVAQNSQAAFPREQLQRLRHGLSLDGQPLKPALVDWQNPEQLRFVLTEGKKRQIRRMCEQVGLKVVGLKRIRIGRVVLGHLPVGQWRYLGPHERF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594662_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594662_3

888075-888214

Orphan

Consensus_repeat	Method
AGGGGGTGGGCGGCTACACGAAGTGAGCCAACCTGGGGGCGAGC	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_LR594662_3

>merge|NZ_LR594662|3|888075-888214|CRISPRCasFinder
AGGGGGTGGGCGGCTACACGAAGTGAGCCAACCTGGGGGCGAGCAACATGCCCACCGCGGAACCGGCTTTGCCGGGCCGCTGGTGTGCCCCCGGTGAGGGGGTGGGCGGCTACACCAAGTGAGCCAACCTGGGGGCGAGC

>NZ_LR594662|3|3|888075-888214|CRISPRCasFinder
AGGGGGTGGGCGGCTACACGAAGTGAGCCAACCTGGGGGCGAGC	AACATGCCCACCGCGGAACCGGCTTTGCCGGGCCGCTGGTGTGCCCCCGGTG
AGGGGGTGGGCGGCTACACCAAGTGAGCCAACCTGGGGGCGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594662.1\|WP_162584828.1\|882403_883288_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176160
NZ_LR594662.1\|WP_162584838.1\|895391_895649_-\|acyl-CoA-binding-protein	unknown	unknown	gnl\|CDD\|376410
NZ_LR594662.1\|WP_162584829.1\|883514_884492_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237420
NZ_LR594662.1\|WP_162589528.1\|879528_880686_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_LR594662.1\|WP_162584840.1\|897347_897842_-\|phasin-family-protein	unknown	unknown	gnl\|CDD\|377530
NZ_LR594662.1\|WP_162584836.1\|893890_895033_+\|aminopeptidase	unknown	unknown	gnl\|CDD\|378359
NZ_LR594662.1\|WP_162584826.1\|880702_881656_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|226105
NZ_LR594662.1\|WP_162584834.1\|890594_891719_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380633
NZ_LR594662.1\|WP_162584835.1\|891790_893821_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239167
NZ_LR594662.1\|WP_162589529.1\|885545_886772_-\|DUF445-family-protein	unknown	unknown	gnl\|CDD\|377281
NZ_LR594662.1\|WP_162584832.1\|888255_889470_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|349916
NZ_LR594662.1\|WP_162584839.1\|896559_897234_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379407
NZ_LR594662.1\|WP_162584824.1\|877757_878750_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|225722
NZ_LR594662.1\|WP_162584837.1\|895025_895364_+\|polyhydroxyalkanoic-acid-system-family-protein	unknown	unknown	gnl\|CDD\|378230
NZ_LR594662.1\|WP_162584825.1\|878784_879477_-\|helix-turn-helix-domain-containing-protein	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|223713
NZ_LR594662.1\|WP_162584833.1\|889466_890591_+\|DUF2817-domain-containing-protein	unknown	unknown	gnl\|CDD\|378533
NZ_LR594662.1\|WP_174263034.1\|895721_896552_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162584827.1\|881652_882297_-\|glutathione-S-transferase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|198315
NZ_LR594662.1\|WP_162584831.1\|886768_887980_-\|acetylornithine-deacetylase	unknown	unknown	gnl\|CDD\|236039
NZ_LR594662.1\|WP_162584830.1\|884595_885435_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|130358

Protein	Function_ID	Function_description	E-value
NZ_LR594662.1\|WP_162584828.1\|882403_883288_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176160	cd08471, PBP2_CrgA_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 2. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.5618e-88
NZ_LR594662.1\|WP_162584838.1\|895391_895649_-\|acyl-CoA-binding-protein	gnl\|CDD\|376410	pfam00887, ACBP, Acyl CoA binding protein.	6.12869e-32
NZ_LR594662.1\|WP_162584829.1\|883514_884492_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237420	PRK13537, PRK13537, nodulation factor ABC transporter ATP-binding protein NodI.	1.87428e-144
NZ_LR594662.1\|WP_162589528.1\|879528_880686_+\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	2.97601e-41
NZ_LR594662.1\|WP_162584836.1\|893890_895033_+\|aminopeptidase	gnl\|CDD\|378359	pfam10023, Aminopep, Putative aminopeptidase. This family of bacterial proteins has a conserved HEXXH motif, suggesting that members are putative peptidases of zincin fold.	1.79291e-160
NZ_LR594662.1\|WP_162584826.1\|880702_881656_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|226105	COG3576, COG3576, Predicted flavin-nucleotide-binding protein structurally related to pyridoxine 5'-phosphate oxidase [General function prediction only].	4.87393e-17
NZ_LR594662.1\|WP_162584834.1\|890594_891719_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380633	cd19978, PBP1_ABC_ligand_binding-like, periplasmic ligand-binding domain of uncharacterized ABC-type transport systems predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This group includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); its ligand specificity has not been determined experimentally, however.	5.5964e-142
NZ_LR594662.1\|WP_162584835.1\|891790_893821_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239167	cd02766, MopB_3, The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
NZ_LR594662.1\|WP_162589529.1\|885545_886772_-\|DUF445-family-protein	gnl\|CDD\|377281	pfam04286, DUF445, Protein of unknown function (DUF445). Predicted to be a membrane protein.	2.24582e-120
NZ_LR594662.1\|WP_162584832.1\|888255_889470_+\|amidohydrolase	gnl\|CDD\|349916	cd05666, M20_Acy1-like, M20 Peptidase aminoacylase 1 subfamily. Peptidase M20 family, uncharacterized subfamily of bacterial proteins predicted as putative amidohydrolases or hippurate hydrolases. These are a class of zinc binding homodimeric enzymes involved in hydrolysis of N-acetylated proteins. N-terminal acetylation of proteins is a widespread and highly conserved process that is involved in protection and stability of proteins. Several types of aminoacylases can be distinguished on the basis of substrate specificity. Aminoacylase 1 (ACY1) breaks down cytosolic aliphatic N-acyl-alpha-amino acids (except L-aspartate), especially N-acetyl-methionine and acetyl-glutamate into L-amino acids and an acyl group. However, ACY1 can also catalyze the reverse reaction, the synthesis of acetylated amino acids. ACY1 may also play a role in xenobiotic bioactivation as well as the inter-organ processing of amino acid-conjugated xenobiotic derivatives (S-substituted-N-acetyl-L-cysteine).	0
NZ_LR594662.1\|WP_162584839.1\|896559_897234_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|379407	pfam13972, TetR, Bacterial transcriptional repressor. This family of bacterial transcriptional repressors is characterized by the short approximately 50 amino acid stretch of residues constituting the helix-turn-helix DNA binding motif, around the YRFhY motif. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The regulatory network in which TetR itself is involved is in being released in the presence of tetracycline, binding to the target operator, and repressing tetA transcription.	1.80729e-45
NZ_LR594662.1\|WP_162584824.1\|877757_878750_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|225722	COG3181, COG3181, Uncharacterized protein conserved in bacteria [Function unknown].	1.04075e-52
NZ_LR594662.1\|WP_162584837.1\|895025_895364_+\|polyhydroxyalkanoic-acid-system-family-protein	gnl\|CDD\|378230	pfam09650, PHA_gran_rgn, Putative polyhydroxyalkanoic acid system protein (PHA_gran_rgn). Proteins in this entry are encoded by genes involved in either polyhydroxyalkanoic acid (PHA) biosynthesis or utilisation, including proteins found at the surface of PHA granules. These proteins have so far been found in the Pseudomonadales, Xanthomonadales, and Vibrionales, all of which belong to the Gammaproteobacteria.	1.85133e-21
NZ_LR594662.1\|WP_162584825.1\|878784_879477_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	6.2881e-11
NZ_LR594662.1\|WP_162584833.1\|889466_890591_+\|DUF2817-domain-containing-protein	gnl\|CDD\|378533	pfam10994, DUF2817, Protein of unknown function (DUF2817). This family of proteins has no known function.	3.59306e-171
NZ_LR594662.1\|WP_162584840.1\|897347_897842_-\|phasin-family-protein	gnl\|CDD\|377530	pfam05597, Phasin, Poly(hydroxyalcanoate) granule associated protein (phasin). Polyhydroxyalkanoates (PHAs) are storage polyesters synthesized by various bacteria as intracellular carbon and energy reserve material. PHAs are accumulated as water-insoluble inclusions within the cells. This family consists of the phasins PhaF and PhaI which act as a transcriptional regulator of PHA biosynthesis genes. PhaF has been proposed to repress expression of the phaC1 gene and the phaIF operon.	1.2299e-42
NZ_LR594662.1\|WP_162584827.1\|881652_882297_-\|glutathione-S-transferase-N-terminal-domain-containing-protein	gnl\|CDD\|198315	cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	1.5044e-44
NZ_LR594662.1\|WP_162584831.1\|886768_887980_-\|acetylornithine-deacetylase	gnl\|CDD\|236039	PRK07522, PRK07522, acetylornithine deacetylase; Provisional.	0
NZ_LR594662.1\|WP_162584830.1\|884595_885435_+\|ABC-transporter-permease	gnl\|CDD\|130358	TIGR01291, Nodulation_protein_J, ABC-2 type transporter, NodJ family. Nearly all members of this subfamily are NodJ which, together with NodI (TIGR01288), acts to export a variety of modified carbohydrate molecules as signals to plant hosts to establish root nodules. The seed alignment includes a highly divergent member from Azorhizobium caulinodans that is, nonetheless, associated with nodulation. This model is designated as subfamily in part because not all sequences derived from the last common ancestral sequence of Rhizobium sp. and Azorhizobium caulinodans NodJ are necessarily nodulation proteins. [Cellular processes, Other, Transport and binding proteins, Other].	3.10342e-56

>NZ_LR594662.1|WP_162584831.1|886768_887980_-|acetylornithine-deacetylase
MPTPLLSSRSLDFAQTLVRMNTVSTRSNLALIEFAREHLAGLGVRSRLTYNADRTKANLFATLGAGKPAGVIVSGHTDTVPWDGQAWSVDPLSALVQDWPQDEHDGEAMQVEPRLYGRGSADMKSFIAIALANAQRFIESDSPFAVHFAFSYDEEVGCFGVRELIADMKEQGIRPLACIVGEPTMMVPAIAHKGVYRYRCCVRGKEAHSSLTPRSVNAIEMAARLVGKLRDMAEGFERDEPRYAGFDVPYSTASVGQFHGGIADNVVPRDAEFRYEFRDLPTADAQKMQKEMRLHANRLEAGMKKIAPEAGFSFETICEIPSFLTTAEDPVTRLAQRLAGEAGTTLVAFGTEAGLFKQAGIPTVVCGPGSITQAHQPDEYVTLAQLARCEQFLQGLAQTREIR
>NZ_LR594662.1|WP_162589529.1|885545_886772_-|DUF445-family-protein
MKRVALALLGAAALLYAAATALAARHPDPAWGYVAAFAEAAMVGAIADWFAVVALFRHPLGLPIPHTAIIPSNKDRIGARLAGFICNNFLSTQQVLAKLEQLDPAARLAHWLSQPAHAATLGDHLVSAARYGLAAFDDARVREFLGRAAAAGLAQVDIARLSGQALDALTAHGRHQALLDDLLAQVAAAVEGEEVQVQITEAIAREIRALRYVGLDQVTARLATRKVVAAAARTVAEMAGDPAHPVRQRFDAFMHEFVHKLKTDPEFKRRGEAIRAELQAHPAIGEYLHGLWSELLAWLHEDLAKSDSEIRRRIVAMAGTLGARLEADEAMRRWINEQIVDAAPRAIERYREDIRRYIVERVGQWNAEEMSVELEKHIGRDLQFIRVNGTLVGGLVGLLIHWVTQALA
>NZ_LR594662.1|WP_162584830.1|884595_885435_+|ABC-transporter-permease
MEKYVSALINDALPPPPSVWRPPELSMRWWPVFLRNLLVWRKLAIPSLIGNIAEPLIWLVAFGYGMGALVGQVSVDGVQVPYILFLASGSICMSSMNAASFEALYSAFSRMHVQKTWDGIMNAPVGLDDVVLAEMLWAGFKAIFTTTAILFVMLGLGISHSPKLLVAWLVLAGVGVTFSCIALIFNALAKGYDFFTYYFTLFMTPMMFLSGVFFPLEQLPEMVRGVASWLPLANAVALVRPLFMDQWPKDWWWPAVVLVVYTVAAFWVALALTRKRFRA
>NZ_LR594662.1|WP_162584829.1|883514_884492_+|ATP-binding-cassette-domain-containing-protein
MEPGEFGPLRHNAPVPSPSAPLFQANHLHKRYGATTVVDDLSFTIAPGECLGVIGPNGAGKTTTIRMCLGLTAPDGGSIEALGGLSMPRDARAIKAQLGVVSQFDTLDPDFSCAENLMVYARYFGMSRRQITPRIPQLLEFAALSHKADAKPGELSGGMRRRLSLARSLVNDPKLLMLDEPTTGLDPQARHLMWERLQLLLQQGKSILLTTHFMDEAERLCSRLIVIDHGRKIAEGRPRDLIAEHLEPDVVEVYGNGALALAQSPLKDYAARVEVSGETVFFYTQDARGLLNALDGHKGLRTFHRPANLEDLFLKLTGRQIREDG
>NZ_LR594662.1|WP_162584828.1|882403_883288_+|LysR-family-transcriptional-regulator
MDRLKAMQTFVQIAEQGSLTKAADALESSLPAVVRSLAALEAHLGVRLFHRTTRRISLTEEGRQYLQSAREVLAAADAADRALSLEAAEPAGQLTVTAPVLFGHMYVAPAIVRFLKRYDKMRCSVLLHDRTVNLLEEGIDVGIRISPLEDSSLVAQQLGTIRRVAVASPDYLRAHGTPRHPRELLEANCVRIQPGAPVHFRENGRNFAVAARGNLEFNHIAPAVEACAAGMGFGFFFSYQVLPLVRAGRLRIVLEDFEQAPRPVSVIYPHARLLPARTRAFIDWMKNEFEGLHI
>NZ_LR594662.1|WP_162584827.1|881652_882297_-|glutathione-S-transferase-N-terminal-domain-containing-protein
MTAIRPARPIKVYSSSISGHSHRVRLFLSLLDLPFETVEVDLRAGEQRRPEFLRRNAFGQVPVIEDGDVTLADSNAILHYLNERYAPDPARWMPRDALGAARVQRWLSVAAGPLAQGPSMARVIVLFGLATDPSDVIARSHNLLRVMESELGNRPFLAGESETLADIANYSYVAHAPEGNVSLQDYPKVRQWLQRIEAFPGFVPMAASRIGLAA
>NZ_LR594662.1|WP_162584826.1|880702_881656_-|pyridoxamine-5'-phosphate-oxidase-family-protein
MTAAWHEGERVLQARAGIAERMAEIGPRVLRDHMPEQHRSFFAQLPFLIAGSLDGEGRPWASVLAAPPGFAHSPDPRHLRIDALPQTNDPLAAALTVGAPVGLLGIEPHTRRRNRMNGAVDALDARGFSVEVGQSFGNCPKYIQAREPVFVGGASAAGFGPRVHGLDAEARRMVRAADTFFIATAHPSAGDARSPAEGVDVSHRGGRPGFVRVEGEGTLTVPDFTGNTFFNTLGNIALNPVAGLLFVDFETGDLLQLSVRAEILWDGPEVDAFAGAERLLRMEVLAAQHARAALPLRFGSAHLSPFLEATGRWPQEP
>NZ_LR594662.1|WP_162589528.1|879528_880686_+|cytochrome-P450
MQQPHIDPPAGAIAAVTHPDPYPWYARLREGPALARDERLGLWVASRAEVLREGFANPALRVRPPGEPVPRAIAGAPAGELFGQLVRMNDGATHAAHKPVLQKALCSLDLGGVRAAMPRIAAQVPASTVAEACFAWPVAGVAHLLGFAYEELPVLADWTRDFVACLSPLSTEAQLGTASEAAAALMARFEALVTKRPAHEGSLLAAVRAQGPGDVSRALLANLVGLLSQTCEATAGLAGNSLVALAREPGLGDAIAVRPEWLPALVEETARHDPSVQNTRRFVAEPTTVAGTRLEAGDAVLLVMGAANRDPLLNAQPERFLLERDGRRMLGFGRGPHGCPGQALACALAAAGVEALLARGLDLAALRERGWHYRPSANARIPVFH
>NZ_LR594662.1|WP_162584825.1|878784_879477_-|helix-turn-helix-domain-containing-protein
MDASNADTHLARLAGAIAEPARARMLCCLLDGHARTATELAAVGEVAASTASAHLARLKEQRLVESVAQGKHRYFRLAGSEVAAVLEGLLVVAGAPRSKFQPGTPSRLRAARTCYDHMAGTAGVALHDRLHAQGWLRATAEGDDYELTAEGAVALESLGIDIDGARRSRRRFACACLDWSERRPHLGGALGAACLQLSLRRGWVRQALDGRALALTPKAQREMPELFGLD
>NZ_LR594662.1|WP_162584824.1|877757_878750_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MVDSTRRIFTSWLAATAAGIAPASVLAQASKPAAAAVAIPRLRIIIPANEGGGWDQTGRALGAAMMAAGAVAQVEYENIGGKGGTIGLARYVEKYDADPDAVLMSGMVMVGAIALQKPAVDMSRIAPLARLTSDYEVVVVKGDSPIVTAKDLIAKMRADPANTAIAGGSAGGVDHMFAGILSRAAGNTSALVYLPFPGGAQVVSAVESGKAIAGISGYSEFSEHIASGKLRAIGVSSRSAFMGVPSVRQQGVDADLANWRGVFTGKAVPTSRQAVLLDAVRRAVATDVWQKALKRSNWDSYWMEGSDFQGFLDLDQSMAGVLTYILKLKS
>NZ_LR594662.1|WP_162584832.1|888255_889470_+|amidohydrolase
MKLIDSLVTQAAGIATVRRDLHAHPELCFQEQRTADVVAAKLTEWGIPVHRGLATTGVIGIVKNGSSPRAVGLRADMDALPVTELNTFAHASKHPGKMHACGHDGHTAMLLAAAQHLAKHRNFDGTVYLIFQPAEEGGGGAREMVKEGLFEQFPMEAVFGMHNWPGMKAGQFAVSPGPAMASSNEFTITIRGKGGHAALPHTGIDPVPIACEMVQAFQTIITRNKKPTEAGVISVTMIHGGEASNVIPDCCELKGTVRTFTLEVLDLIEARMKKIAEHVSAAHEAECDFHFHRNYPPTINTAAEANFARRVMAGIVGEENVLVQEPAMTAEDFAFMLQARPGAYAFIGNGDGSHRDLHHGGGPCMLHNASYDFNDDLIPLGATCWVRLAEEFLGGPALPGERAA
>NZ_LR594662.1|WP_162584833.1|889466_890591_+|DUF2817-domain-containing-protein
MIGVGEAFAPRYALARQKFLQGCAAAGLAVRSHVHPLLGRDGEELAIDVALDGDAQAESLLIVSSGCHGVEGHCGSGVQVFALHDAEWREKARDQGVAVLYVHALNPYGFSHSRRVTHENVDLNRNFLDFSQPLPVNEAYASLHALLLPEQWPPSAANQAEIDALIAREGLGFYQAAVTRGQYQFPDGLFYGGNAPTWSNRAVREVLRTHAGRARRVGWIDLHTGLGSNGIGERIFAGRDDKVAYARANAWWGTAAAPVTSMYDGSSTSAYLTGLMCYALDDECPQAEHTSIALEYGTEPMLEVTAALRGDHWLHRHPRAPAELAEAIRTRMLAAFYSDTDAWRGQVISQARQAMFQAVDGLAGVAPSPAERGS
>NZ_LR594662.1|WP_162584834.1|890594_891719_-|ABC-transporter-substrate-binding-protein
MIHRRHFSIAAGAAALGGFGIARAQSEAPVMLGQSAPFSGPAAQLGIQFHQGAKLYLDQYNAQPGHRDVQIKFLDDGYEPERCAANTKKLIDEEAFALFGYIGTPTSLAALPLAVNARVPFIAPFTGAMALREPFHRNVFHLRASYNDETALIVKQLTHLGLKKIAVFYQNDAYGKAGLDGVTLALSQLDLKPAALATVERNTVDVAAAVKTIVAAKPDAVVQVSAYKSCAAFIREARKAGYGGTFYNVSFVGTQALADELGKDGAGVVVTQVVPSPYYAANGITREFNEAVKKSSGTVQSNFSSMEGYLAAKVLAEGLRRAPGKLTREGLIAGLESIDRQQFGGFEVSFSPRNHVASKFVELSMITGDGRIRT
>NZ_LR594662.1|WP_162584835.1|891790_893821_+|molybdopterin-dependent-oxidoreductase
MNSPTQVLGACPHDCPDTCSLVTTVQDGRAVRLQGNPAHPHTAGVLCTKVSRYIERNDHPERLLQPLKRVGPKGGGRFEPVSWDAALSDIAERLNLLWRNNSSESILPYSYAGTMGLVQGESMDRRFFHKLGASLLDRTICSTAGGEALSFTLGGKVGMRVQFFAEAKLILIWGSNSIASNLHFWRHAQAAKRAGARLVCIDPRRTETADKCDEHIALLPGTDAALAFALMHELIVNDWLDHDYIERHTLGWEQLRERALQWSPARAAAVCGVPEAQIVALARAYGTTRPAAIRLNYGMQRVRGGGNAARAIACLPALVGAWRERAGGLLLSSSGQFPVDRAALQRPDLLAGRRPRTINMSAIGDALLDTANPIRALVVYNSNPVAVAPDSARVVAGFAREDLFTVVLEQFQTDTADYADYLLPATTQLEHWDIHTSYGHTDVLLNRPALAPRGEARSNAWVFRELARRMGFDEPCFSDDDETLCRTAFAPGAIDVEELQAQGFTSLKLPEAPFAEGGFPTPSGRCEFFSASLAAQGQDGLPDHVPNYEPAGSSTEFPLAMISPPARNFLNSSFVNVKSLRAIEGEPLLEIHQDDAAARGIVDGAMVRVFNRRGEHRCRAEVSRRARPGVVHGLGIWWRKLGADGTNVNQLTSQRLTDIGRGPTFYDCLVEVMPDA
>NZ_LR594662.1|WP_162584836.1|893890_895033_+|aminopeptidase
MSKGRAAFAAVAVLALAGCADLGYYWQSASGHLALMRAARPVPEWLQDPATTDALKAKLQLAERIRRFAVAELGLPDNPSYKAYADLHRPAAIWNVVASPAHSLTLKTWCFPVAGCVGYRGYYDEAAARAEAATLVAQGLEAAAYPVPAYSTLGWMNWAGGDPLLSTFIGYPEGELARIVFHELAHQVLYVPGDTMFNESFATAVERIGGARWLQTQAGDAARVEYAQFDRRRQQFRALTADTRRVLADIYASKAAQAGDWATVDAQKKAVMEDFRQRYAALRAGWSGPRQGAYDGWVARANNALFGAQAAYDELVPGFEALFEREGRDWPRFYAAVKRLSALPKDERMLALRTGDATAPAARRPTEEPGQHGRQGGPGA
>NZ_LR594662.1|WP_162584837.1|895025_895364_+|polyhydroxyalkanoic-acid-system-family-protein
MPDIHIERSHQLGIEAARAIARKWVSQVEQDYGLACSYEEGQARDVGRFSRAGIDGSVEVSGGSFTLRATLSGLFAGFSGQIEERLRRKLDDLLGRPDDDDDDDAYNDKDWR
>NZ_LR594662.1|WP_162584838.1|895391_895649_-|acyl-CoA-binding-protein
MSDLNALFEAAQANSKLLAERPDNPTLLKIYGLFKQATLGDNTEKKPSFSDIVARAKWDAWTARKGLSADEAKQKYIDLIESLRG
>NZ_LR594662.1|WP_174263034.1|895721_896552_-|hypothetical-protein
MAHPDLQPLSLLATGTVPASEPWVPMPYRDAPRFDAAEVLQEWGRLHGGHGLPPPAPGPLAEGWALYHSGDFERAAKLGLRHGAEGLMLANQATAIYANYLEPREAMRQALFKQVAERAASQAAEEPDNCHALYWQAYALGRYSQGISVARALAQGLGTKVKGALERVIALEPRHAAAHVALAAFHAEVIDKVGALVGRMTYGVRAETAIELFERGLELHPRSPGAMMEYARGMLMLEGDARLAEATSLYERAAATEPADARERLDVELARAGLSD
>NZ_LR594662.1|WP_162584839.1|896559_897234_-|TetR-family-transcriptional-regulator
MAKKAPRRTAQRILEAALDLFNRFGEPNVSTTLVAGELNISPGNLYYHYPAKDELINRLYENYETELNELLHASEGVRDVEDAWFFMHSLFELIWRYRFLYRDLNDLLSKNRHLETQFQLVLQNKARAIRTLLAGMSRSGHLDIDAPEVDPLAQSMVVVLTYWLSYEYVRNPREALEPGHAQSALLRGAHHTLHLLAPYLAAEQRQHLLTLSNAYAGEDQPTTV
>NZ_LR594662.1|WP_162584840.1|897347_897842_-|phasin-family-protein
MASTDDDKPDDKTDRIKDSAQQIWLAGLGAFAKMQQEGSKAFEALVKDGLGVQKKTQHAAEETLAQAQARMAGFASEFGTKAAGGWGKLESIFEDRVARALEKLGMPSAQEVAALQARVEALEAQLRRKDSTDRPARTPRKTAARHPAEAAAKPSRRRKPGSDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594662_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594662_4

1269490-1269575

Orphan

Consensus_repeat	Method
GGGCAAGGCGGCCAGGGCAACCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594662_4

>merge|NZ_LR594662|4|1269490-1269575|CRISPRCasFinder
GGGCAAGGCGGCCAGGGCAACCCCGGCCAGCAACAGCAGGACCCCGGCAAGCAACAACAGCCAGGGCAAGGCGGCCAGAGCAACCC

>NZ_LR594662|4|4|1269490-1269575|CRISPRCasFinder
GGGCAAGGCGGCCAGGGCAACCC	CGGCCAGCAACAGCAGGACCCCGGCAAGCAACAACAGCCA
GGGCAAGGCGGCCAGAGCAACCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594662.1\|WP_162585158.1\|1272201_1272369_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162585155.1\|1270413_1270698_-\|exopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226442
NZ_LR594662.1\|WP_162585161.1\|1273866_1274340_-\|TerB-family-tellurite-resistance-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162585149.1\|1265633_1266797_+\|PrpF-protein	unknown	unknown	gnl\|CDD\|225384
NZ_LR594662.1\|WP_162585151.1\|1267558_1268029_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187670
NZ_LR594662.1\|WP_162585159.1\|1272617_1273085_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240602
NZ_LR594662.1\|WP_162585160.1\|1273484_1273886_-\|TerB-family-tellurite-resistance-protein	unknown	unknown	gnl\|CDD\|143580
NZ_LR594662.1\|WP_162585147.1\|1263988_1264609_+\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314
NZ_LR594662.1\|WP_162585146.1\|1262594_1263992_+\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|183543
NZ_LR594662.1\|WP_162585163.1\|1274854_1275028_-\|zf-TFIIB-domain-containing-protein	unknown	unknown	gnl\|CDD\|226331
NZ_LR594662.1\|WP_162585143.1\|1258365_1259349_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_LR594662.1\|WP_162585156.1\|1270801_1271803_-\|TerC/Alx-family-metal-homeostasis-membrane-protein	unknown	unknown	gnl\|CDD\|274743
NZ_LR594662.1\|WP_162585148.1\|1264646_1265615_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_LR594662.1\|WP_162585144.1\|1259381_1261541_-\|acetate--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|223972
NZ_LR594662.1\|WP_162585157.1\|1271898_1272195_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162585150.1\|1267133_1267352_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162585145.1\|1261711_1262593_+\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	unknown	unknown	gnl\|CDD\|119340
NZ_LR594662.1\|WP_162585152.1\|1268171_1269233_-\|DUF4942-domain-containing-protein	unknown	unknown	gnl\|CDD\|372683
NZ_LR594662.1\|WP_162585164.1\|1275051_1275753_-\|Bax-inhibitor-1-family-protein	unknown	unknown	gnl\|CDD\|198415
NZ_LR594662.1\|WP_162585162.1\|1274336_1274732_-\|TerB-family-tellurite-resistance-protein	unknown	unknown	gnl\|CDD\|143581

Protein	Function_ID	Function_description	E-value
NZ_LR594662.1\|WP_162585155.1\|1270413_1270698_-\|exopolysaccharide-biosynthesis-protein	gnl\|CDD\|226442	COG3932, COG3932, Uncharacterized ABC-type transport system, permease components [General function prediction only].	8.18933e-05
NZ_LR594662.1\|WP_162585163.1\|1274854_1275028_-\|zf-TFIIB-domain-containing-protein	gnl\|CDD\|226331	COG3809, COG3809, Uncharacterized protein conserved in bacteria [Function unknown].	2.0801e-19
NZ_LR594662.1\|WP_162585149.1\|1265633_1266797_+\|PrpF-protein	gnl\|CDD\|225384	COG2828, COG2828, Uncharacterized protein conserved in bacteria [Function unknown].	1.48421e-116
NZ_LR594662.1\|WP_162585151.1\|1267558_1268029_-\|hypothetical-protein	gnl\|CDD\|187670	cd09810, LPOR_like_SDR_c_like, light-dependent protochlorophyllide reductase (LPOR)-like, classical (c)-like SDRs. Classical SDR-like subgroup containing LPOR and related proteins. Protochlorophyllide (Pchlide) reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.67577e-07
NZ_LR594662.1\|WP_162585159.1\|1272617_1273085_-\|hypothetical-protein	gnl\|CDD\|240602	cd12919, VKOR_2, Vitamin K epoxide reductase family in bacteria. This family includes vitamin K epoxide reductase (VKOR) present only in bacteria. VKOR (also named VKORC1) is an integral membrane protein that catalyzes the reduction of vitamin K 2,3-epoxide and vitamin K to vitamin K hydroquinone, an essential co-factor subsequently used in the gamma-carboxylation of glutamic acid residues in blood coagulation enzymes. All homologs of VKOR contain an active site CXXC motif, which is switched between reduced and disulfide-bonded states during the reaction cycle. In some bacterial homologs, the VKOR domain is fused with domains of the thioredoxin family of oxidoreductases which may function as redox partners in initiating the reduction cascade.	5.46222e-28
NZ_LR594662.1\|WP_162585160.1\|1273484_1273886_-\|TerB-family-tellurite-resistance-protein	gnl\|CDD\|143580	cd07176, terB, tellurite resistance protein terB. This family contains uncharacterized bacterial proteins involved in tellurium resistance. The prototype of this CD is the Kp-terB protein from Klebsiella pneumoniae, whose 3D structure was recently determined. The biological function of terB and the mechanism responsible for tellurium resistance are unknown.	8.65357e-05
NZ_LR594662.1\|WP_162585147.1\|1263988_1264609_+\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	2.36708e-88
NZ_LR594662.1\|WP_162585146.1\|1262594_1263992_+\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|183543	PRK12466, PRK12466, 3-isopropylmalate dehydratase large subunit.	0
NZ_LR594662.1\|WP_162585164.1\|1275051_1275753_-\|Bax-inhibitor-1-family-protein	gnl\|CDD\|198415	cd10433, YccA_like, YccA-like proteins. A prokaryotic member of the BAX inhibitor (BI)-1 like family of small transmembrane proteins, Escherichia coli YccA, has been shown to interact with ATP-dependent protease FtsH, which degrades abnormal membrane proteins as part of a quality control mechanism to keep the integrity of biological membranes.	4.81599e-85
NZ_LR594662.1\|WP_162585143.1\|1258365_1259349_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	3.20013e-124
NZ_LR594662.1\|WP_162585156.1\|1270801_1271803_-\|TerC/Alx-family-metal-homeostasis-membrane-protein	gnl\|CDD\|274743	TIGR03718, R_switched_Alx, integral membrane protein, TerC family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family often are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains TerC itself from Alcaligenes sp. plasmid IncHI2 pMER610 and from Proteus mirabilis. It also contains the alkaline-inducible E. coli protein Alx, which unlike the two TerC examples is preceded by a yybP-ykoY leader.	4.87275e-149
NZ_LR594662.1\|WP_162585148.1\|1264646_1265615_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	9.02873e-134
NZ_LR594662.1\|WP_162585144.1\|1259381_1261541_-\|acetate--CoA-ligase-family-protein	gnl\|CDD\|223972	COG1042, COG1042, Acyl-CoA synthetase (NDP forming) [Energy production and conversion].	6.80819e-111
NZ_LR594662.1\|WP_162585145.1\|1261711_1262593_+\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	gnl\|CDD\|119340	cd00377, ICL_PEPM, Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage. Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate lyase (ICL), and 2-methylisocitrate lyase (MICL). Isocitrate lyase (ICL) catalyzes the conversion of isocitrate to succinate and glyoxylate, the first committed step in the glyoxylate pathway. This carbon-conserving pathway is present in most prokaryotes, lower eukaryotes and plants, but has not been observed in vertebrates. PEP mutase (PEPM) turns phosphoenolpyruvate (PEP) into phosphonopyruvate (P-pyr), an important intermediate in the formation of organophosphonates, which function as antibiotics or play a role in pathogenesis or signaling. P-pyr can be hydrolyzed by phosphonopyruvate hydrolase (PPH) to from pyruvate and phosphate. Oxaloacetate acetylhydrolase (OAH) catalyzes the hydrolytic cleavage of oxaloacetate to form acetate and oxalate, an important pathway to produce oxalate in filamentous fungi. 2-methylisocitrate lyase (MICL) cleaves 2-methylisocitrate to pyruvate and succinate, part of the methylcitrate cycle for the alpha-oxidation of propionate.	2.33001e-89
NZ_LR594662.1\|WP_162585152.1\|1268171_1269233_-\|DUF4942-domain-containing-protein	gnl\|CDD\|372683	pfam13708, DUF4942, Domain of unknown function (DUF4942). The function of this family is not known.	4.74206e-22
NZ_LR594662.1\|WP_162585162.1\|1274336_1274732_-\|TerB-family-tellurite-resistance-protein	gnl\|CDD\|143581	cd07177, terB_like, tellurium resistance terB-like protein. This family consists of tellurium resistance terB proteins, N-terminal domain of heat shock DnaJ-like proteins, N-terminal domain of Mo-dependent nitrogenase-like proteins, C-terminal domain of ABC transporter ATP-binding proteins, C-terminal domain of serine/threonine protein kinase, and many hypothetical bacterial proteins. The function of this family is unknown.	0.000210735

>NZ_LR594662.1|WP_162585152.1|1268171_1269233_-|DUF4942-domain-containing-protein
MNLNAQELQAVEHAKAELVNESATFFAPVSSDVLDELLGQYQARKRSIEQLAEALLGEEFRTAMSYFLEASEIRGGHYLSLSSLANVDAALAVLDASYWSKALALTDVLDCMPQSRRDEWNKAIADRKTVPFTEDAVRPTIADLLASRHKYFCERVDGIFRGLSGTHATNEPQGFSKRMILNYVLSDGYPNHSRAGLINDLRSVIATFMGRPGLKHYETGNLLRRLAEGREWGEWHDVDGGAVRIRIYRGFGTAHLEINPEVAYRLNNVLASLYPMAIPAKFRSRPKRCSVLIGRKTSTCSRAPASAAWLACCLSTGPRASRSRAWGAMFCARAAPRAQGGLYRMGGRSARSR
>NZ_LR594662.1|WP_162585151.1|1267558_1268029_-|hypothetical-protein
MRATSKRCNIVTARAFARTGSVTRTYFAFDPGLMPGTGLAREQVPLMQWIWKTVLPRLASLLPGTSSTERSSAVLTDLLLGISHNGAYFNYTGKQLEPAHPAQEKRVEEDLLSTSNQLDARFVSLRPIRCDGVPPRRAHGATGREAACRPWRAERH
>NZ_LR594662.1|WP_162585150.1|1267133_1267352_-|hypothetical-protein
MSASPSVPVELTAVLKAPAHLAGALLQGDLARLFQRGGALLRDLELLRLHRLARLQREQLVGGLRRLQRTDG
>NZ_LR594662.1|WP_162585149.1|1265633_1266797_+|PrpF-protein
MDHSPDQIAVRCVLMRGGTSKALFFHEQDVPPPGVRRDRFLLRAMGTPDVLQIDGLGGSRLVTSKVAIISKSPRADADVDYTFAQLDVERALVSYDANCGNISSAVGPFAIDEGLVDAVEPVTAVRIFNTNTQKMMIAKVQVAGGKARVLGDCAIAGVPGTGAEILMDYAGTVGAKTGKLLPTGNVIDVITLEDGRRVEVTIGDAANPCVFIAAKDLGLGGSELPIPITNDRALIETIGEIQGKAGAMIGLYRQWNDQHLPGLPLAIMVAPPENYVDVNGVVQKEREMDACERLVFLGKCHDSMAGAGAMCSGAISRVAGSVLHKVLDPAVARTPWLRIGHPLGVMYVKVEPHAGAVQPQLHFETLSFPRTARRLMQGEVLMPNDFG
>NZ_LR594662.1|WP_162585148.1|1264646_1265615_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MTFTRCIALALGAAALATSAMSQQFPDHTLRFVVGYPPGQNVDMMARAFADAMGKELGQNIIVDNKPGANGILGAQTVKTAKADGYTLLFGTSGQLAINQSLYKKLPYDTLKDFLAVGIAGTAPLVLVANPGFAPKNVQELLAYVKAHPGKVDFGSGGSGITAHLAMELFQEASGVKLNHIPYKGSPAAMNDLMGGQIPLMMEPLPSVLPYVRAGKLKALAITSPRRNPSLPDVPTVAEQLQKDFDVAAWSGIVVPAGTPAPVVARLSEAFRKAGHSPAVQQMLASSGLEFPTMSTPQFQAFMEAEVKKWARAVQQSGAQVD
>NZ_LR594662.1|WP_162585147.1|1263988_1264609_+|3-isopropylmalate-dehydratase-small-subunit
MSFQPFTVVRGAAIPLMRSNVDTDVIIRIERMTALPKEAWGRWALEPLRYREDGSEDSESILNQHRFRDAPILLAGSNFGCGSSREPAVTALQGLGLRCIVAPSFGDIFFANCFQNGVLPIRLALPQVEALAAQAGSGAALTVDLESRVVVAPDGTRFPFEVDALRREALLQGLDDIGLTLRDEVLITAWQQADRARRPWAWPQQR
>NZ_LR594662.1|WP_162585146.1|1262594_1263992_+|3-isopropylmalate-dehydratase-large-subunit
MARTLFDKVWDMHVVRDLGDGWALLHIDRQLMHDLGGGPAFADLTQRRMKLRNPELDFAVPDHAVSSQPGRSATTFPLGGRLHAALRRGAEEAGVRFFELGQPGQGIVHVMGPELGLVLPGLTVVCTDSHTCTNGGLGALAFGVGSSESVHALATQTLRQRRPKRMRIVCDGVLAQGVSAKDLALHIVAALGADGGVGYAVEYAGAAVEALEVEGRLTLCNLSVELGARFALIAPDAKTYAYLRGRSYAPQGDAFDAAVRDWEQLPSDPDAAYDREVRIDAAAVVPTISWGISPDHAIRIDALVPDPAAVDGPRREAYAAALDYMGLRAGDALAGMPVDWVFIGSCANSRLSDLRAAADVARGRHVAAGVTAWVVPGSEIVKREAEAEGLREVFEAAGFQWREPGCSMCVAANGEQVPPQARCVSTSNRNFVGRQGPGARTHLASPAMAAAAAVTGRITDVRTLQ
>NZ_LR594662.1|WP_162585145.1|1261711_1262593_+|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein
MTASTLRQLLGRPGMLVAPGAHDAIGARQIEQAGFDAVYMTGGVTSMAHGFPDFGLVDFSEMAGNALRITRATRLPVIADADTGYGNELNVIRTVREYELRGVAGLHIEDQVSPKRCGHLEGKEVIPRAEFVSKIRAAAEARRNADTVIIARTDARAVLGMDEAVARMNEALAAGADIAFVEAMQTMEEIAAVPRLVRGPCFLNLVPGGKTPLNDLREAEAMGYKVCILPGLLVTAQIEAGDAALSQVKATRQVPVANTPIGDIFRRFGAEEWDALRARYGAGAVATHTKDGR
>NZ_LR594662.1|WP_162585144.1|1259381_1261541_-|acetate--CoA-ligase-family-protein
MNSPSREAALANSLSLDRFFAPRSVAFIGATEDTTKFGGKCFASLLKFGYSGRVMPVNPKREKLFDVPCFAGVDKLPEVPDHVGIALSGNGALDALEQCGRLGVPFATVFSAGFAETGTLEGLRQQARLRQIASETGIRVMGPNCNGVVSFVDRFALSSTFAISEGHSPHGDIAIASQSGGAGQINVMWRAMQSGLGISYQVSSGNDADLDLLDYMHFMVEAESTRVVLVVAERISSGERLRKLALKAAALDKPIVMLKVGRSAAGSAAAASHTGSITGADDITDAALAQWGILRVHDTEELYEFGRLLRRTNRPRGRNVAAASVSGGSLVIAVDTASDCGLQWPALSESCDERLQQQLPDFGKTSNPLDLTAAAVGRDDALVLAGQAILQDENIDAFVPVVTMTKRVEFEALAMMATTGSKPTVLLWTGSCVDDPALKLADLVRQGVPVFDDTRRCFRAIAASAWLATARERVLADALAVGARQRPVDAAMARRLAQGALTERESKALLATYGVPVTVEALATSPEEAAGIARRITAKVALKVESPDIPHKTEAGAIRLGVSGADAVRQAFDEVMQAARRHAPQADIRGVLVQEMVPPGFELLLGLVHDPVFGPVITVGHGGIHVEVMKDVARRVAPVDARAAGDMLRSLRIWPILAGTRGQAGYDTEAVIAGIVALSRLGVDYGAAIQEIDINPFVVQHANGGARAVDALVVGRCAR
>NZ_LR594662.1|WP_162585143.1|1258365_1259349_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MQRISSVRRALLGAFGASLVPRAFAQRVDTYPDRVIKLINPWTPGGPGETVGRPIADILTKAWKQPVILDHRPGANAVIGSAIVARSAPDGYTLLLGQTGPNTISPSIGKGTPYDPIKDFAPITQVTSAALVLAVRADLPIHNIADLITYAKAHPTALSFGSVGAGSTTHLAGEMLKAAGSFQMTHVPYKGAGPVMNDLLGGQISMTFLNIAGIVPHMSSGRIRPIAVTTLKRSPQMSDVPAIAETLPGVEMVSWYALLAPGGTPPAIVDKIYRAVVEGLRQPEVAAIYRAAGQELELSTPAQFEQRIKSEIAKFAKLVKDNNITTE
>NZ_LR594662.1|WP_162585155.1|1270413_1270698_-|exopolysaccharide-biosynthesis-protein
MYGLAQRFARLGGEFRINRAMAALLATMAALIVLPIPLGNLLPATSIAALGLAVVFGDQGLAALRALALAFTGGVTVLAAHGGWCAVASTCSLL
>NZ_LR594662.1|WP_162585156.1|1270801_1271803_-|TerC/Alx-family-metal-homeostasis-membrane-protein
MEPLLSLIQQSFLGTPVWLWLSFMAVVVALLAFDLGVLHKDDREVGVRESLMLSAGYISVALLFGGWVWWLMGAQSATEYYTGFLIEKSLSMDNVFVIALIFTYLAIPRQFQHRVLFWGILGVIVLRAIMIGLGAALVSQFSWTLYLFGAFLVFTGVKMWLMADHEPDIANNALLKFLRRHMRVTPQIEGNAFFVQRPDPAAGGRVVRWATPLFLALCMVEFIDLVFAVDSVPAIFAITSDPFIVYTSNIFAILGLRALYFALAAMIHRFKYLKYALALVLVFIGSKIFLVGIIGKTPPVISLSVTFGLIAGGVLVSLWKTRSGRAQPQLGSS
>NZ_LR594662.1|WP_162585157.1|1271898_1272195_-|hypothetical-protein
MLTIALASLDLADTVIEEELKREANMSAPARTRRVLSRFLVVVVSLSIESLVAVFQLVHDDPSKLPHAASIALGAAALLAAWGYFNRVTCTQGKGEAA
>NZ_LR594662.1|WP_162585158.1|1272201_1272369_-|hypothetical-protein
MFAIKKVFAFGYIGIVVLFGIGAFGLIGFGAFELWEALDPRRTLAMTERLNSVLK
>NZ_LR594662.1|WP_162585159.1|1272617_1273085_-|hypothetical-protein
MLEAFRRTMPWRVILFDLTIVPLGVTSIFFIIIQPVVLGTWSVVALIGAAAILLQVPYSLDEIIATVQFLRRRARAGRPWLRVLFVGDLDEPAGPPGATRVDEFARRPGAVVRDMLAGGVNLPWTLALGAGIGLSLLFSRVTLGAEGSLANVHTT
>NZ_LR594662.1|WP_162585160.1|1273484_1273886_-|TerB-family-tellurite-resistance-protein
MRNYSTDSPQAAARIVSLVALSDGHLCSRELDRMHALGATAALGLTREQLLRVMQDYYEDMQLYGEYGWADASRLDPASLDGMLAEVRDPRLRQEVLRLCTAVAEADAHWSDSELRVIDTARARWLDATATAG
>NZ_LR594662.1|WP_162585161.1|1273866_1274340_-|TerB-family-tellurite-resistance-protein
MRRYERDSAEAATRVVVMAMLADGHLSRCEIEAFAHADAHRQLGLDSAQLRDLISDFCDDILQAAPGDWAQACRSGTESLSAMLREIECPTLRRKVLRICKKVIEADAHLADGEATVLAEMFAQWGIDARAKHAATPAAQNLSMPARKENRHAQLQH
>NZ_LR594662.1|WP_162585162.1|1274336_1274732_-|TerB-family-tellurite-resistance-protein
MRSYPLNSPQAAARIVATMALSDGKLCSRELNLIDRFGKAGVLSLSREQLHTVLRDHCQDMALYTSYEWAERGECLPESLHRLLAEVQDPLRRAHVLQLCGAIADADAHWSAAERRMIDTVRRCWAQEART
>NZ_LR594662.1|WP_162585163.1|1274854_1275028_-|zf-TFIIB-domain-containing-protein
MQCPTCIDAVLAMTSRQGVEIDYCPNCRGVWLDRGELDKLIERAGNEPPPRPQASSA
>NZ_LR594662.1|WP_162585164.1|1275051_1275753_-|Bax-inhibitor-1-family-protein
MELKPIPIDSHPTQPPARGEVLSSHVPEVARVLRNTYALLSLTLLFSAAVATTGMVLKLPAPGLLLTLGGYFGLLFVVYRFKDSGWAIPAVFALTGFMGYTLGPLLAKMAGLPGGAQVIAMALGATGATFLALSAWVLATKRDFSFMGGFLFAGMVIALLGGLGAIFFQVPALGLAVSAMVALLSAALILYETSRIVNGGESNYVLATVGLYVSIFNLFTSLLSLFGLGGGDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594662_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594662_5

4710041-4710123

Orphan

Consensus_repeat	Method
GCCGCACGGCCGTTCCGAAGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594662_5

>merge|NZ_LR594662|5|4710041-4710123|CRISPRCasFinder
GCCGCACGGCCGTTCCGAAGGCGAATAACACCGCAGCCGAAGGCGAAGGTACTCCAGTGCGCCGCACGGCCGTTCCGAAGGCG

>NZ_LR594662|5|5|4710041-4710123|CRISPRCasFinder
GCCGCACGGCCGTTCCGAAGGCG	AATAACACCGCAGCCGAAGGCGAAGGTACTCCAGTGC
GCCGCACGGCCGTTCCGAAGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594662.1\|WP_162587928.1\|4711997_4712909_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_LR594662.1\|WP_174263153.1\|4715303_4717583_-\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	unknown	unknown	gnl\|CDD\|227111
NZ_LR594662.1\|WP_162587933.1\|4719553_4722769_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_LR594662.1\|WP_162587930.1\|4713786_4714161_+\|TfoX/Sxy-family-protein	unknown	unknown	gnl\|CDD\|377438
NZ_LR594662.1\|WP_162587931.1\|4714264_4715017_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380205
NZ_LR594662.1\|WP_162587926.1\|4710177_4710822_+\|glutathione-S-transferase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|198315
NZ_LR594662.1\|WP_162587917.1\|4699438_4700599_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173847
NZ_LR594662.1\|WP_162589797.1\|4718940_4719438_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|225804
NZ_LR594662.1\|WP_162587922.1\|4704496_4704745_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226145
NZ_LR594662.1\|WP_162587927.1\|4710877_4711984_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_LR594662.1\|WP_162587934.1\|4722773_4723982_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_LR594662.1\|WP_162587920.1\|4702471_4702921_-\|type-II-3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|235443
NZ_LR594662.1\|WP_162587923.1\|4705639_4706320_-\|FCD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224715
NZ_LR594662.1\|WP_162587929.1\|4712905_4713763_+\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_LR594662.1\|WP_162589796.1\|4709182_4710040_+\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|99782
NZ_LR594662.1\|WP_162587925.1\|4707522_4708197_+\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239551
NZ_LR594662.1\|WP_162587918.1\|4700608_4701772_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|224871
NZ_LR594662.1\|WP_162587924.1\|4706428_4707511_+\|BMP-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380618
NZ_LR594662.1\|WP_162587919.1\|4701818_4702475_-\|DNA-3-methyladenine-glycosylase-I	unknown	unknown	gnl\|CDD\|377025
NZ_LR594662.1\|WP_162587921.1\|4703185_4704247_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224525

Protein	Function_ID	Function_description	E-value
NZ_LR594662.1\|WP_162587928.1\|4711997_4712909_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.95827e-24
NZ_LR594662.1\|WP_174263153.1\|4715303_4717583_-\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	gnl\|CDD\|227111	COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism].	0
NZ_LR594662.1\|WP_162587933.1\|4719553_4722769_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_LR594662.1\|WP_162587930.1\|4713786_4714161_+\|TfoX/Sxy-family-protein	gnl\|CDD\|377438	pfam04993, TfoX_N, TfoX N-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the N-terminal presumed domain of TfoX. The domain is found as an isolated domain in some proteins suggesting this is an autonomous domain.	1.91161e-35
NZ_LR594662.1\|WP_162587931.1\|4714264_4715017_-\|hypothetical-protein	gnl\|CDD\|380205	NF033203, entero_EhxA, enterohemolysin EhxA. Members of this family are the RTX toxin called enterohemolysin or EhxA, because it is found in enterohemorrhagic Escherichia coli (EHEC) strains such as O157:H7.	3.62414e-11
NZ_LR594662.1\|WP_162587926.1\|4710177_4710822_+\|glutathione-S-transferase-N-terminal-domain-containing-protein	gnl\|CDD\|198315	cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	2.45413e-37
NZ_LR594662.1\|WP_162587917.1\|4699438_4700599_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	1.63416e-135
NZ_LR594662.1\|WP_162589797.1\|4718940_4719438_-\|AAA-family-ATPase	gnl\|CDD\|225804	COG3265, GntK, Gluconate kinase [Carbohydrate transport and metabolism].	3.43079e-67
NZ_LR594662.1\|WP_162587922.1\|4704496_4704745_+\|hypothetical-protein	gnl\|CDD\|226145	COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	0.000379919
NZ_LR594662.1\|WP_162587927.1\|4710877_4711984_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_LR594662.1\|WP_162587934.1\|4722773_4723982_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	4.42833e-57
NZ_LR594662.1\|WP_162587920.1\|4702471_4702921_-\|type-II-3-dehydroquinate-dehydratase	gnl\|CDD\|235443	PRK05395, PRK05395, type II 3-dehydroquinate dehydratase.	4.41649e-92
NZ_LR594662.1\|WP_162587923.1\|4705639_4706320_-\|FCD-domain-containing-protein	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.85774e-39
NZ_LR594662.1\|WP_162587929.1\|4712905_4713763_+\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	4.82833e-149
NZ_LR594662.1\|WP_162589796.1\|4709182_4710040_+\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	gnl\|CDD\|99782	cd06185, PDR_like, Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.	1.63665e-93
NZ_LR594662.1\|WP_162587925.1\|4707522_4708197_+\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239551	cd03469, Rieske_RO_Alpha_N, Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The oxygenase component may contain alpha and beta subunits, with the beta subunit having a purely structural function. Some oxygenase components contain only an alpha subunit. The oxygenase alpha subunit has two domains, an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from the reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Reduced pyridine nucleotide is used as the initial source of two electrons for dioxygen activation.	2.97466e-27
NZ_LR594662.1\|WP_162587918.1\|4700608_4701772_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	2.62073e-85
NZ_LR594662.1\|WP_162587924.1\|4706428_4707511_+\|BMP-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380618	cd19963, PBP1_BMP-like, periplasmic binding component of a basic membrane lipoprotein (BMP) from Brucella abortus and its close homologs in other bacteria. Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria. These outer membrane proteins include Med, a cell-surface localized protein regulating the competence transcription factor gene comK in Bacillus subtilis, and PnrA, a periplasmic purine nucleoside binding protein of an ATP-binding cassette (ABC) transport system in Treponema pallidum. All contain the type 1 periplasmic sugar-binding protein-like fold.	7.30977e-125
NZ_LR594662.1\|WP_162587919.1\|4701818_4702475_-\|DNA-3-methyladenine-glycosylase-I	gnl\|CDD\|377025	pfam03352, Adenine_glyco, Methyladenine glycosylase. The DNA-3-methyladenine glycosylase I is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.	4.91029e-114
NZ_LR594662.1\|WP_162587921.1\|4703185_4704247_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	6.51255e-118

>NZ_LR594662.1|WP_162589796.1|4709182_4710040_+|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein
MTPGAHLDVHLPGGLIRQYSLCNGPDDDGCYTIAVKREEASRGGSAAMHDRVRPGDLLHVGLPKNNFALDSTAGHSLLIAGGIGITPLLAMARHLAARGDDFHLHYFCRSAAHAAFGAEFDREFANRWTLHAALSPEATRKAIERVLGAPDADTHAYTCGPLPLMELVTSVGAALCWPPERMHFEYFKAAGPVATGGTPFELTLARSGRTLQVPAERSIVEVLRSIDVAIETNCEQGVCGTCLCTVIDGVPEHRDQYLSAAEKAGNMQMLPCVSRARSGKLVLDL
>NZ_LR594662.1|WP_162587925.1|4707522_4708197_+|Rieske-2Fe-2S-domain-containing-protein
MHEEAQAGGAFAADGWFAVELSVHVPPGQVVQTLLHGQELALWRPSAGSVQAWENRCPHRSVRLTLGFVHGDQLVCRYHGWRYGRDGRCTGVPSTPALAPPPAACVRTYMCRESDGVIWASLALAPRGYPPRLPGLGACRSFVVDMAADALAQAIEAAGFVPAGHPGVWREPASSGDAATLLLQPMNAASTCAHLFITEGLGAARRLAAAQRMKAVFAKELAHV
>NZ_LR594662.1|WP_162587924.1|4706428_4707511_+|BMP-family-ABC-transporter-substrate-binding-protein
MALHSPIRALLAGVFAACAALPAAAADPLEIGFVYQSPVSDVGWVAVHETARKQLEKEFGSRIKTRVVQDVKVGPDGARVMRELVGGGAGMVVLGSFGYMNDGLKLAAEEPKVNFIHASGFKQAPNFGTYNARWYEGAYVAGMVAGKVTKSNKLGYVGAIPIPDVVSTINAFALGVKRSNPAATVSVVWVNEWFNPGSERDAANSLIQQGADVIGSGFQDNPAIVQAADAKGVWSVGMFSDLRKAAPHKLLTSITHDWTPHFRQVVADTLAGKFKGAAYVGTLQNGGVNLLDWNAAVPPDVVKMAKAAQADIAAGRLIPFAGPLKDNTGKVRAAPGAAVPDAEIAGMNWFVEGIQGAMPR
>NZ_LR594662.1|WP_162587923.1|4705639_4706320_-|FCD-domain-containing-protein
MSSKTDEIVSSIRNAVAAHRLLPGVQLREVALGKLYGVSRTVVRQALQTLAREGLVDLTPGRIASVAKPTPEEARDTFDLRWAIERHATETLAQKLTRKDVTALRAHVKLERAARAARNAEEVRRLGAGFHVLVAQLAGNALLARTLEQLVARIALILLLYRHEYDEHVECLQDEHAEFIDLLESGAAAKALQLLQRHLQTVEVSLNVEKMAVVDDPQLRRALLSG
>NZ_LR594662.1|WP_162587922.1|4704496_4704745_+|hypothetical-protein
MRCSSSRCCSAFGALALLLLAALARIANGAFEPWAAWIARFAAQTQACCKLSGLATEAGPGWDAQWLRPWVERLLTHSALHA
>NZ_LR594662.1|WP_162587921.1|4703185_4704247_-|substrate-binding-domain-containing-protein
MNDNAPPANANIHDVARLAEVSVATVSNVLNESRPVAAATRARVLKAVAALGYTPHAAARSMRGRGSGLIGLIVADITNPFFTSLVHAVERAANDGGYAVLLCNSDEDPAREQQHLQLLRAQRVDGVILAATGHASHERAAALGQLQVPVVLVDRGSAEFGRDAVMLDNRRAGLEAVRHIIGFGHRRIAMLSGPAAVSTAAERLAGYREALLEGGLAYDERWVRDAGYREERAYDAACEMLRARERPTAVFAANDLIAIGLMRAIADLGLRCPEDVSVVSIDDFAWANAFRPRMTTVAQPVAAMGESAVRMLLSRIDRSAAALPPRTEIMAPMLVVRDSCCAPPQRVVAGAMS
>NZ_LR594662.1|WP_162587920.1|4702471_4702921_-|type-II-3-dehydroquinate-dehydratase
MKKILVLNGPNLNLLGTREPAQYGHETLADVERLCADAGTKLGVGIECRQSNHEGQLIDWIHEAGREVAAGRMLGVVMNPGAYTHTSIALHDAIKGASVPLVELHISNVHAREEFRHHSYISPAARGIIVGFGVKGYALAIEALVSVST
>NZ_LR594662.1|WP_162587919.1|4701818_4702475_-|DNA-3-methyladenine-glycosylase-I
MSLDRPGLFAGEDGALRCRWCQSTTAYQHYHDNEWGFPVTDDRRLFEKLCLEGFQAGLSWLTILNKREAFRRAFAEFDAERVARFKSKDVERLLGDAGIVRHRGKIESAINNAQRVLDLREQFGSLSAYAWSFEPDPASRPRRITHEALKAMTTSPESMAMSKDLKKRGWSFVGPTTVYAFMQAMGLVNDHVEDCHARELALAARAKLKPPSPGAKAR
>NZ_LR594662.1|WP_162587918.1|4700608_4701772_+|acyl-CoA-dehydrogenase-family-protein
MFGYSDRLPALRAAVRRFVEEEAIPRESPALAHDLNALEETTHALRAKAKQAGIYGPQLPAAWGGLGLSWRDRSVILEEAGRSFLAPLAMNCAPPDQPNMINLLTDGSPAQQERYLAPLARGETRSCFAMTEPEPGAGSDPSMLQTVAVRRRGGWSISGRKWFISGAVGASFALVLARTCEGATIFIVDADNPGYRVVRNIASIDGFQIGGHGEIELEDCLVGDDAVLGEVGRGFVYAQLRLEPARLSHCMRFIGRASRAMALAQDYANRRSSFGQPLAQLQQVQAMVADSHIDLHAARLMTWHAAAKLDANESIKHESAMVKVFVSEAVGRVADRAAQIMGALGMSEDAPVSLILREMRPFRVYDGASEVHRSTLARRVLKAAMAP
>NZ_LR594662.1|WP_162587917.1|4699438_4700599_+|acyl-CoA-dehydrogenase-family-protein
MQRNPEAFEQFLSGLRSYVRERLVPNEVRVADADEVPPDLVAEMAARGLFGWSIPEAYGGAGMTTEELVLAAMELSQCSVAFRARVGTNTGIGSEALVADGTEDQKRRYLPRLASGELTGAFALTEPEAGSDAVSLRASAQREGEHYVLNGTKCFITNAPIAGLFTVMARTDPADLSARGVTAFLVERGMPGLSTGPAYRKMGQAGSPVSEVHMDNCIVPAHNVIGGREGQGFKTAMKVLNKQRIHLAALCIGPAIRMLEDAVAFVATRRQFGQALSSFQLVQALIADSQTEIHAARALVLDTARKRDEGIDVTMEASICKYFASEMCGRVADRCVQMLGGYGYIADHGMERFYRDVRLFRLYEGTSQIHQLNIARRTLAQAGYGS
>NZ_LR594662.1|WP_162587926.1|4710177_4710822_+|glutathione-S-transferase-N-terminal-domain-containing-protein
MIKLYNDELSGNCYKLRLFMSLLQLPYARVPVNFHPGREHKGEAFLRINPLGQLPAIDDDGYVLRDAQAILVYLASRYDRSERWYPAEAATRGRIALWLAVAEDITRSASAARLHDAFGYPFDIAACRGAAHRLFAHIEDHLSDGEIEGRTWLAAHDATIADIACFPYIALAPEGGVGLERYPALRRWIARLKALPNFVGMPGIFAAGIDPEPS
>NZ_LR594662.1|WP_162587927.1|4710877_4711984_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKTKAAVAWKSAAPLSIETVDLEGPRFGEVLVEIKATGICHTDYYTLSGADPEGIFPAILGHEGAGIVVDVGPGVTSLKKGDHVIPLYTPECRQCKFCLSRKTNLCQLIRGTQGKGLMPDATSRFNLDGKPIFHYMGTSTFSNYTVAPEISMAKIREDAPFDKVCYIGCGVTTGIGAVIFTAKVEAGANVVVFGLGGIGLNVIQGAKMVGADKIIGVDLNPAREAMARKFGMTHFLNPKEHANIVDAIVQLTDGGADYSFECIGNTQVMRQALECTHKGWGRSIIIGVAEAGAEISTRPFQLVTGRKWEGSAFGGARGRTDVPKIVDWYMENKINIDDLITHTMPLEDINKGFDLMKRGESIRGVVLY
>NZ_LR594662.1|WP_162587928.1|4711997_4712909_+|alpha/beta-fold-hydrolase
MAAMTPVRQVRAGVLDIGYHESGPADGPPVLLVHGFPYDIHAYAGVAPLLAAKGCRVIVPFMRGYGSTRFLDAATPRSGQQGAFGADLLALMDALAIPRAVLAGYDWGGRACCVVAALWPERCAGLVSLNSYNIQDIAAASKPAVPENERRHWYQYYFHGERGHAGLEQNRRPLCRLLWSLWSPTWVFDDATFERSAAAFDHPDFVEVVIHSYRHRFGLVPGDPAYDEIEHRLAAQPPITVPAITFDGADDGVMSIGGTAAHARHFTGPHQHRVVPGAGHNLPQEKPQDFADAILELVNASRP
>NZ_LR594662.1|WP_162587929.1|4712905_4713763_+|S-formylglutathione-hydrolase
MNPGIRTLSEHRCFGGTQGFHEHDAREIGLPMRFSVFLPPQAQQAPVPALMYLAGLTCNEETFMVKAGAQRLAAELGLALIAPDTSPRGAHVAGESDNWDFGVGAGFYLDATLAPWATNWRMESWIVHELLPLLGTHFPIDIHRIGVFGHSMGGHGALTLALRHPGRFASLSAFAPICAPSECPWGEKAFGGYLGPDREQWLAHDASALMQSQTAAPYPEGILVDQGLADKFLADQLHPHRLETACRAVGQPLTLRRHEGYDHGYYFVQSFVADHLAHHARFLRG
>NZ_LR594662.1|WP_162587930.1|4713786_4714161_+|TfoX/Sxy-family-protein
MSQFVESLHEVFERMGPIEARRMFGGHGIYHDGRMFALVANDTLYLKADADTMAEFEKRGLPAFGYEREGRRTEMSYRLAPEEIFEDREEAIRWGRSAWEAALRAAAPKRARRPAAKRTKGPAR
>NZ_LR594662.1|WP_162587931.1|4714264_4715017_-|hypothetical-protein
MLNTTAAIDGTGNALSNVLYAGAGDNVLDGLGGNDWVSYAYAGSAVNVSLATTGAQATGGSGTDTLRNVEYLFGSNYNDILTGSSRADVLSGGLGNDTLDGAAGADTLNGGAGHDTYRYRSGDGNDTVLDTGGDDTVELLDLNPGDVRIIEGLNGNPDHIVDALTGYTITLDLQMVSPGWSADGKQVEHLRFADGTVWNSEQMRAAAEMERSVSLLVQAMATFAVPAPGQTTWPQDHQNSLAPLLAVDWR
>NZ_LR594662.1|WP_174263153.1|4715303_4717583_-|acetyl-CoA-carboxylase-biotin-carboxylase-subunit
MAQRQDGGDGRRAGGAHHGHRHRGRDAAQGRGGPRKARGAAAPDRRALRAPDECVQHQRAAARRWRDRSARHPRAAGPADVDLPRCRGEDAAAHAVLGGPAVTALPTPFHKILIANRGEIALRVMRTARSLGYRTVAVYSTADAGSLHVERADQAVCIGEPLPAQSYLCIPAIIEAARRTGADAVHPGYGFLAENEAFARACREAGLVFIGPSPEAMAAMGDKAGAKRRMSEAGVPCIPGYHGGDQGEERLRAEAGRIGYPVMIKASAGGGGRGMRLASSDTGFAELLRSAKSEARGAFGDDAVILECAIAAPRHIEIQVFADRYGNAIHLGERDCSVQRRHQKLIEEAPSPAVTPELRERMGTTAVAAVNAIGYEGAGTLEFLLDAEGRFYFMEMNTRLQVEHPVTEAITGLDLVELQLRIAAGEPLPLTQAQVRFEGHAIELRLCAEDADQGCMPQSGTLALWQPPEGVRTEHALRAGAEVTPWYDSMIAKLIGQGRTREEARRRLLHGLEELVALGVRTNQVFLGRCLAHPVFVAGEATTAFIAQHADALLAPDEEMNLHAAAVAAVLLHESADGRARRPAGRALRHSLAVPLRFEVDGRRHEGELQLRNHQRFEVELDGRSIALALLRLDGDRARLVCDGVMDSAVFHREGTRLLLHYRGRPFVIDDLARAAGVRAGEGSGDGKLRASMNGRVVAVLVAVGDRVEEGQPMVTLEAMKMEHIHAAPAAGTVGALHVAVGEQVAAHQVVAEFEAAAS
>NZ_LR594662.1|WP_162589797.1|4718940_4719438_-|AAA-family-ATPase
MGVSGCGKSSLGAALARELGLPLIEGDDFHPPGNVSKMRAGIALTDADRAGWLDTLAGTLAAHPQGAVLACSALKRGYRDRLRAAVPRLRFVFMDLSREEAERRVAGRGAGHFFSASLVADQFATLESPVGEPGVLAVDATAPLSELVDRTRAWLRDEAAGGPTA
>NZ_LR594662.1|WP_162587933.1|4719553_4722769_+|efflux-RND-transporter-permease-subunit
MSMVSLALRRPYTFIVMAMLIVLATPFVLARMATDIFPDINIPVLSIIWNYGGLPAQEMGQRIAGQTERGLTTTVSDIEHIESQSLAGVSVIKIFFQPTANIETAIAQTVASVQTQVRQLPPGITPPLVIKYSASSIPVIQLALSSSERPENSLFDSAINQLRPQLITIPGVAIPFPYGGKNRVISVDLDTQALQARGLSPADVVNAVNAQNLILPSGTAKFGATEYSVKMNGSPEVLAGLNDLPVRTANGATTYLRDVAYVRDGFQPQTNIVRQDGVRGVLLSVIKNGSASTLDIVANLRALLPVAQQGMPADIKVTPLFDQSLFVKAAVQGVVLEAIIAALLTAAMVLIFLGNWRSTLIIAATIPLSILVSILALYALGETLNLMTLGGLALSVGILVDQAIVTIENIERHLHMGTPLNEAIMVGAGEIGPAAFVSTLCICIVFVPMFFLSGVARFLFVPLAEAVVFAMLASYILSRTLVPTLVMLMMGRAHAQHAHGGAAGNAKPSLLQRVYRSFDRRFERVRRAYTLVLSALLSKRGSFIALFLGFCLLSCLLYPVLGRDFFPGVDAGQIRLHMRAPTGTRIEETARLADEVEAAIRELVPKDQLETILDNLGVPNSGINLSYSNAGTIGTLDGEILLSLRDGHRPTEEFISLLRAELPRRFPGIEFFFQPADIVTQILNFGLPAAIDVQFSGSDLAGNAQHAAALVKAIRKIPGAVDAHVHQRLDGPSLSLQMDRTRLQQVGLTAQNVGQNVLIALSGSSQTAPAFWLNPQNGVVYNVAVQTPQYKVDSLDALLNIPVGGQGAAAGPPQLLGNLVEAQPARQPSVVSRYNISPVIDVYVSVQGTDLASVAGEVRKLVDEVRPRLSRGSQVAIRGQVETMQSSFLGLGVGLAMAIVLVYLLIVVTFQSWLDAAIIITALPAALAGIAWMLFLTGTTLSVPALTGAIMTMGVATANSILLVSFARDRLAAGVPPLSAALEAGATRIRPVLMTALAMIIGMVPMALGVGEGAEQNAPLGRAVIGGLLFATVSTLFFVPAVYAGIHSRMAHRKARQAESSAPPQGVPQES
>NZ_LR594662.1|WP_162587934.1|4722773_4723982_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MTEQRHAALAIHPIAADEQGEHHELLRRRQIVRRMRIAVLIVLVLLAIGAARTMFVRMANARALEASSTELAKQYVKTVLPQTAAAGQTLALPGTLQGFVQAPISARASGYLKRWTKDIGSQVQKGELLAEIETPEIDQQLSQAIAARQQAASSLELAKSTVARWENLRKKDVVSQQDLDERRSGLAQATANVAAADANVQRLRQTEGFKRIVAPFAGVVTRRNVDVGDLIDAGGSRPLFLLAQTDPLRVYINVPQAYAQLVKAGQPVVVTQAELRGQRFKGEVARTSGAIDTATRMMQVEVALPNREGLLLPGAYVQVSLPLAASRALSIPANTLLFRPEGTRVATVDAEGRVRLRSVNLGRNYGETVEVLDGIAANDRLILNPADSLAEGDVVAVAKEPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594662_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594662_6

4852463-4852567

Orphan

Consensus_repeat	Method
GGCTACACGGAGTGAGCCAACCTGGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594662_6

>merge|NZ_LR594662|6|4852463-4852567|CRISPRCasFinder
GGCTACACGGAGTGAGCCAACCTGGGGGAGAGCAATATCCCCCGGGCCGCTGGTGTTGCCCCCGGTAGGGGGTGTGCGGCTACACGAAGTGAGCCAACCTGGGGG

>NZ_LR594662|6|6|4852463-4852567|CRISPRCasFinder
GGCTACACGGAGTGAGCCAACCTGGGGG	AGAGCAATATCCCCCGGGCCGCTGGTGTTGCCCCCGGTAGGGGGTGTGC
GGCTACACGAAGTGAGCCAACCTGGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594662.1\|WP_162588038.1\|4843727_4844477_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|227008
NZ_LR594662.1\|WP_162589808.1\|4856256_4856580_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	unknown	unknown	gnl\|CDD\|237504
NZ_LR594662.1\|WP_162588051.1\|4857663_4858983_-\|phenylacetate--CoA-ligase	unknown	unknown	gnl\|CDD\|131210
NZ_LR594662.1\|WP_162588043.1\|4847825_4848572_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223487
NZ_LR594662.1\|WP_162588049.1\|4855473_4856247_-\|phenylacetate-CoA-oxygenase-subunit-PaaC	unknown	unknown	gnl\|CDD\|368300
NZ_LR594662.1\|WP_162588045.1\|4851301_4852330_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_LR594662.1\|WP_162588046.1\|4852573_4853725_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380556
NZ_LR594662.1\|WP_162588052.1\|4859016_4859454_-\|hydroxyphenylacetyl-CoA-thioesterase-PaaI	unknown	unknown	gnl\|CDD\|131339
NZ_LR594662.1\|WP_162588036.1\|4842142_4842973_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225544
NZ_LR594662.1\|WP_162588040.1\|4845735_4846236_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162588053.1\|4859468_4860272_-\|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase	unknown	unknown	gnl\|CDD\|236163
NZ_LR594662.1\|WP_162588042.1\|4846783_4847701_-\|DUF72-domain-containing-protein	unknown	unknown	gnl\|CDD\|376655
NZ_LR594662.1\|WP_162588050.1\|4856630_4857641_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	unknown	unknown	gnl\|CDD\|184320
NZ_LR594662.1\|WP_162588041.1\|4846325_4846787_-\|DUF4259-domain-containing-protein	unknown	unknown	gnl\|CDD\|372905
NZ_LR594662.1\|WP_162588047.1\|4853759_4854845_-\|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK	unknown	unknown	gnl\|CDD\|131215
NZ_LR594662.1\|WP_162588037.1\|4842969_4843731_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213227
NZ_LR594662.1\|WP_162588048.1\|4854848_4855382_-\|phenylacetate-CoA-oxygenase-subunit-PaaJ	unknown	unknown	gnl\|CDD\|131214
NZ_LR594662.1\|WP_162588039.1\|4844604_4845702_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378934
NZ_LR594662.1\|WP_162588044.1\|4849210_4851049_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213186
NZ_LR594662.1\|WP_162588054.1\|4860447_4861050_+\|phenylacetic-acid-degradation-protein-PaaY	unknown	unknown	gnl\|CDD\|131340

Protein	Function_ID	Function_description	E-value
NZ_LR594662.1\|WP_162588038.1\|4843727_4844477_-\|ABC-transporter-permease	gnl\|CDD\|227008	COG4662, TupA, ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism].	6.18412e-57
NZ_LR594662.1\|WP_162589808.1\|4856256_4856580_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	gnl\|CDD\|237504	PRK13781, paaB, phenylacetate-CoA oxygenase subunit PaaB; Provisional.	1.25597e-65
NZ_LR594662.1\|WP_162588051.1\|4857663_4858983_-\|phenylacetate--CoA-ligase	gnl\|CDD\|131210	TIGR02155, Phenylacetate-coenzyme_A_ligase, phenylacetate-CoA ligase. Phenylacetate-CoA ligase (PA-CoA ligase) catalyzes the first step in aromatic catabolism of phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Often located in a conserved gene cluster with enzymes involved in phenylacetic acid activation (paaG/H/I/J), phenylacetate-CoA ligase has been found among the proteobacteria as well as in gram positive prokaryotes. In the B-subclass proteobacterium Azoarcus evansii, phenylacetate-CoA ligase has been shown to be induced under aerobic and anaerobic growth conditions. It remains unclear however, whether this induction is due to the same enzyme or to another isoenzyme restricted to specific anaerobic growth conditions. [Energy metabolism, Other].	0
NZ_LR594662.1\|WP_162588043.1\|4847825_4848572_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	1.61104e-108
NZ_LR594662.1\|WP_162588049.1\|4855473_4856247_-\|phenylacetate-CoA-oxygenase-subunit-PaaC	gnl\|CDD\|368300	pfam05138, PaaA_PaaC, Phenylacetic acid catabolic protein. This family includes proteins such as PaaA and PaaC that are part of a catabolic pathway of phenylacetic acid. These proteins may form part of a dioxygenase complex.	3.40861e-115
NZ_LR594662.1\|WP_162588045.1\|4851301_4852330_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	6.79138e-49
NZ_LR594662.1\|WP_162588046.1\|4852573_4853725_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380556	cd06333, PBP1_ABC_RPA1789-like, type 1 periplasmic binding-protein component (CouP) of an ABC system (CouPSTU; RPA1789, RPA1791-1793), involved in active transport of lignin-derived aromatic substrates, and its close homologs. This group includes RPA1789 (CouP) from Rhodopseudomonas palustris and its close homologs in other bacteria. RPA1789 (CouP) is the periplasmic binding-protein component of an ABC system (CouPSTU; RPA1789, RPA1791-1793) that is involved in the active transport of lignin-derived aromatic substrates. Members of this group has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP).	1.75831e-160
NZ_LR594662.1\|WP_162588052.1\|4859016_4859454_-\|hydroxyphenylacetyl-CoA-thioesterase-PaaI	gnl\|CDD\|131339	TIGR02286, Acyl-coenzyme_A_thioesterase_PaaI, phenylacetic acid degradation protein PaaD. This member of the domain family TIGR00369 (which is, in turn, a member of the pfam03061 thioesterase superfamily) is nearly always found adjacent to other genes of the phenylacetic acid degradation pathway. Its function is currently unknown, but a role as a thioesterase is not inconsistent with the proposed overall pathway. Sequences scoring between trusted and noise include those from archaea and other species not known to catabolize phenylacetic acid and which are not adjacent to other genes potentially involved with such a pathway.	2.33548e-51
NZ_LR594662.1\|WP_162588036.1\|4842142_4842973_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|225544	COG2998, TupA, tungsten ABC transporter substrate-binding protein [Coenzyme metabolism].	2.71932e-98
NZ_LR594662.1\|WP_162588044.1\|4849210_4851049_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	2.00045e-102
NZ_LR594662.1\|WP_162588053.1\|4859468_4860272_-\|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase	gnl\|CDD\|236163	PRK08140, PRK08140, enoyl-CoA hydratase; Provisional.	1.02347e-120
NZ_LR594662.1\|WP_162588042.1\|4846783_4847701_-\|DUF72-domain-containing-protein	gnl\|CDD\|376655	pfam01904, DUF72, Protein of unknown function DUF72. The function of this family is unknown.	2.20554e-82
NZ_LR594662.1\|WP_162588050.1\|4856630_4857641_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	gnl\|CDD\|184320	PRK13778, paaA, phenylacetate-CoA oxygenase subunit PaaA; Provisional.	0
NZ_LR594662.1\|WP_162588041.1\|4846325_4846787_-\|DUF4259-domain-containing-protein	gnl\|CDD\|372905	pfam14078, DUF4259, Domain of unknown function (DUF4259). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 118 and 145 amino acids in length.	2.23928e-14
NZ_LR594662.1\|WP_162588047.1\|4853759_4854845_-\|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK	gnl\|CDD\|131215	TIGR02160, 12-phenylacetyl-CoA_epoxidase_subunit_E, phenylacetate-CoA oxygenase/reductase, PaaK subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other].	4.87677e-150
NZ_LR594662.1\|WP_162588037.1\|4842969_4843731_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213227	cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system. Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. PstA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).	6.86868e-70
NZ_LR594662.1\|WP_162588048.1\|4854848_4855382_-\|phenylacetate-CoA-oxygenase-subunit-PaaJ	gnl\|CDD\|131214	TIGR02159, Putative_12-phenylacetyl-CoA_epoxidase_subunit_D, phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other].	2.88175e-59
NZ_LR594662.1\|WP_162588039.1\|4844604_4845702_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|378934	pfam12727, PBP_like, PBP superfamily domain. This family belongs to the periplasmic binding domain superfamily. It is often associated with a helix-turn-helix domain.	3.31401e-60
NZ_LR594662.1\|WP_162588054.1\|4860447_4861050_+\|phenylacetic-acid-degradation-protein-PaaY	gnl\|CDD\|131340	TIGR02287, Phenylacetic_acid_degradation_protein_PaaY, phenylacetic acid degradation protein PaaY. Members of this family are located next to other genes organized into apparent operons for phenylacetic acid degradation. PaaY is located near the end of these gene clusters and often next to PaaX, a transcriptional regulator. [Energy metabolism, Other].	7.97995e-101

>NZ_LR594662.1|WP_162588045.1|4851301_4852330_-|branched-chain-amino-acid-ABC-transporter-permease
MDLQIALILGQDGIVNGAIYGLMALALVLVFSVTRVIFIPQGEFVAFSALSVVALQAGRVPATLWLLLVLAAAALVVELWRWKRGAVVDWVSTLAWCVALPLAACALVLLMRPESLVTQTLAALTVIVPLGPLLYRLAYRPLADATVLTLLIVSVALHGVLVGLGLLFFGAEGSRTPAFSEMRLDLGGVAITGQSLVVVAVTAALVVLMFLFFERSIVGKALRATAINRVGARLMGIPTGLSGDLSFALAAAIGAVSGLLIAPITTIYYDTGFLIGLKGFVAAIVGGLASYPLALVGALIVGQLEAFSSFWASAFKEVFVFTLIIPVLWWRSLSSRHVEDEE
>NZ_LR594662.1|WP_162588044.1|4849210_4851049_-|ATP-binding-cassette-domain-containing-protein
MTRRHLVMAFIIALAAAWGFLPDFSVTVLSYIGLYALVAAGLVMLTGVGGMTSFGQAAFVGAGAYATAWICTSPMAASALGGISPALLPWIGLLFGIVVTFVIAWGLGAITLRLSGHYLPLCTIAWGLSFYFLFGNLEFLGGHTGVAGVPAIEVAGISFASPRSLGLVIWGVLLLALWALHNLLDSREGRAIRALKGGRVMAESMGVDTGRYRIKVFVLAALLAAVSGWLYAHLQRFINPTPFNLNIGIEYLFMAVVGGAGHLWGAVLGAALITLLKEQLQDILPQLLGSSGNFEVIVFGLLMLVVLQRFADGLWPTLARIGGRFLKPAAVRPARRVLALPETALPPRGQVVLEAKAVTKRFGGLVANDAVSLDVKAGEIHALIGPNGAGKSTFFNMISGVDDPTDGEVRLMDRPMTGRPSRAFAALGLGRTFQHVRLLGQRRVIENVALGAHRRGQRGWIASMLRLDRAEEAALLAQARQQIERCGLGEFAEVPAGSLALGQQRVVEIARALAGHPAVLLLDEPAAGLRHLEKRALATLLDQLRAEGLGILVVEHDMEFVMNLADRVTVLEFGAVIARGTPAQVQGDPKVLDAYLGGVDEAVEAGLVEQVV
>NZ_LR594662.1|WP_162588043.1|4847825_4848572_-|ATP-binding-cassette-domain-containing-protein
MSSSPLLQLEDFCVSYGPVEAVHHIDLRVDTGEIVTVIGPNGAGKTTLLCAAMGLLPSRGRVLLGGELMTRVSVEAMVARGVGLVPEKRELFGEMAVEDNLLLGGFSRWWRGERDQRQRMDEVFAIFPRLAERRAQLASTLSGGERQMLAIGRALMARPRLLMLDEPSLGLAPLIVREVLQVVSSLRKHGVSVLLVEQNARAALQVADRAYVLEMGAVALQGAASELLHDRRIIDTYLGLGARAEKVA
>NZ_LR594662.1|WP_162588042.1|4846783_4847701_-|DUF72-domain-containing-protein
MAGTSGETRIGISGWRYAPWRGKFYPKGLPQRQELAFASRMLPTIELNGSFYSLQRPESYLAWHDETPDGFVFAVKGSRYITHMRRLKDVRIALANFLASGVLALRAKLGPFLWQLPPSMAYDPERFEDFLSLLPRDTSAALALARQHDERLEGRSWLKRSAKRPLRHAVEVRHPSFVDPAFIAQLGRHGIALVVADTAGRWPLLEDLTADFVYLRLHGDKELYASGYDDAALDQWATRIDAWRHGRQVKDARRASTRAAPRRARRDVYCYFDNDIKVHAPYDAANLARRLGVATGLGADGEFAA
>NZ_LR594662.1|WP_162588041.1|4846325_4846787_-|DUF4259-domain-containing-protein
MNLSKRACIAALAWMLILPARAGAWGEGAFDNDAAQDFLAECARSTDVAVVTEAIDMALVASFVDADDGAAAVAAAEVLANALGRNGAAPRTRVVPCLAAATHDQLRALAPRAQQAVTRVTDPTSSELAQQWAEEKPNRWRASVQRLAARLRP
>NZ_LR594662.1|WP_162588040.1|4845735_4846236_-|hypothetical-protein
MKWLLRMFSGIHAFMALLFACAALMLIAVSASIGWSALAEGLDRSAAESIIEAVGLLAAAVVALQVAQTILEEEVVRDAHISAPTRVRRFLSRFMVVIVVALAVEGLVATFRAHGDPAQLLYAAGMVGSVALLLAGWGLFVHLNRSAEELEPEAMADAKREDRKLS
>NZ_LR594662.1|WP_162588039.1|4844604_4845702_+|LysR-family-transcriptional-regulator
MQQIELSYAIAPRRSGRTLIRNPLMELLHAVREHGSISAAARALGLSYRHVWGELKHWEQALGHPLVTSEQGRSAQLSEFGDKLLWAERQAQARLAPQIEALHADLERAFAMAFDDGLHVLSLHASHDDALVLLRAHAAERARLQLDIRFTGSVDAISALNQGRCVMAGFHTLERPPAGSLAQRTYKPLLKPGLHKLIGFARRTQGLIVAPGNPLGLRSIGDVARRRARYVNRALGTGTRVLLDDLLVQEGLDADALEGYARDEPSHTAVAHAVASGQADAGLGIESAARGADLGFVPLVHESYHLACLKSALDQPAVEALLALLRSAAWQHQLGTLAGYESAGSGEVQSLSALLPWWRFKGPKP
>NZ_LR594662.1|WP_162588038.1|4843727_4844477_-|ABC-transporter-permease
MNTFTDSAIAAWHLLVSGDPVLLAIVGRSLAVSATACALACGFGLLLGAWLAVARFAGRGLLLTLLNTLLALPSVVVGLVIYLLLSRSGPLGFLGWLFSFKAMVLAQTLLVLPVVTALTRQAVEDADRAHGEQLRSLGARGLVRALLLVWDERYALVTVLIAAFGRAVSEVGAVMIVGGNIDGFTRVMTTAIALETSKGDLPLALTLGLVLLGVVLLLNLAISALRGWRERVDGGAADAAGPRRVEVAA
>NZ_LR594662.1|WP_162588037.1|4842969_4843731_-|ATP-binding-cassette-domain-containing-protein
MSVRPGLRVVAARSEGEPQAPALAGPALFALHAIDVRYGRVPALADITLSIHAGERVALIGANGSGKSTLLRVLHGLVPHAAGAFVSQVPLRAQAMLFQRPHMLRMSVHKNVALALWLRGVPWRSAQGEAMVALGRVGLADVAGRNARTLSGGQQQRMALARAWALKPAVLLLDEPTASLDPTAKREVEALIADAAQGRTLVFASHNLGQVKRLASRVIYLEQGRVLADLPVDDFFHGPLPEEARLFVKGELV
>NZ_LR594662.1|WP_162588036.1|4842142_4842973_-|substrate-binding-domain-containing-protein
MNAFKFLAAALALAAGSFAAQAETITMASTTSTEQSGLFSHLLPAFRQASGIDVKVVAVGTGQAIDMARRGDADVLFVHDAAAEEKFVADGFAEKRYAVMYNDFVLVGPKSDPAAARGNDIAAALKKVAAANAAFVSRGDKSGTDAAERRLWAQTGLGEAGRPLPNDRKGAGYKECGCGMGPALNMAASSAAYVLADRGTWLSFKNRAGLAVLVEGDKRLFNQYGVMAVSPSKFPQLNHAGARKFVDWVISPAGQSTIASYKIGGEQLFFPNAGSQ
>NZ_LR594662.1|WP_162588046.1|4852573_4853725_-|ABC-transporter-substrate-binding-protein
MSSFTRLGVALLCAMAFAAHADINVGVTLSATGPAASLGIPEKNTIALMPKTIGGQKINYIVLDDASDTTAAVSNTRKLISENKVDIVLGSTVTPNSLAMIDVVAEEKVPMISMAASARIVEPMDAKRKWVFKTPQNDIMMSLAIAEHMAANGVKTVGFIGFSDAYGEGWFQEFTKAAELKKLKVVANERYARSDTSVTGQALKLISAKPDAVLIAGSGTPAALPQKTLKERGYAGKVYQTHGVANSDFLRVGGKDVEGTLLPSGPMLVASQLPDSHPLKKSALAYVNAYEAANGKGSVSTFGGHAWDAGLIMNAAIPVALKKAQPGTPDFRAALRDALEGVKNVAGAHGIFTMSPTDHLGLDQRARVMVKIENGAWKYQPQD
>NZ_LR594662.1|WP_162588047.1|4853759_4854845_-|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK
MSVIFHPLRVRSIEPDTAEAVIISFDVPQELRGVFGFTQGQYLTLRKEIDGQDLRRSYSICAGVDDGELRVGVRKVQQGLFSNWINSSLKPGDTLQVMAPQGRFFVPIEPEARRHHVGIAGGSGITPILSIMKTVLAREPHSRFTLIYGNRQLRSTMFKEEIEDLKNRYMSRLSLQLVFSDEHTDVPINAGLMNREKIAEFLQGLVPPGSIDHVYICGPFQMNDEAEAALLEAGVPEERIHIERFGLAQSPTGTVGAVVHAPQPGDAETARITIVRDGIAREIPYTLGQPSILDAASSAGLEVPYSCTSGVCGTCRAKLLEGEVRMERNFALDKNEVAGGFILTCQAHPLTERVRLSFDER
>NZ_LR594662.1|WP_162588048.1|4854848_4855382_-|phenylacetate-CoA-oxygenase-subunit-PaaJ
MSELRLPAADEARVARAWEVLGTVLDPEVPALSVCDLGIVREVLPQGEGLEIVLTPTYSGCPATEVIERSVLDAIDAAGLGPARVTLRRAPAWTTDWMSAEGKRKLREYGIAPPGAAALPGGAVPVRLVRRQAAAPVACPHCGSAHTERLSAFGSTACKSLYRCLDCREPFEHFKPL
>NZ_LR594662.1|WP_162588049.1|4855473_4856247_-|phenylacetate-CoA-oxygenase-subunit-PaaC
MQASIELDRSPAVQYLLRIGDTCLILAQRLGEWCGHAPVLEEDIAMTNMALDLVGQARALLTRAGQIEGRAHDEDQLAFLRDERDYFNATLVELPRGDFAFSVLRNAMAATLLKLLWERLESSSDAEVAAIAAKAVKEARYHQQHAADWVVRLGDGTDESHSRMEAALAQLWRYVPELFASDAIDEEARASGLGPAWSELREAWFAEMGSVLEEATLPMPAESAFLSTGKRGVHSEHMGYILAEMQHLQRAYPGGVW
>NZ_LR594662.1|WP_162589808.1|4856256_4856580_-|1,2-phenylacetyl-CoA-epoxidase-subunit-B
MGSSTEAPKATASAGREWPLWEVFVRSKAGLDHKHCGSLHAPDPKMALQMARDVYTRRQEGVSVWVVRSDQIVASDPGDKDMFFDPAEDKVYRHPTFYALPKSVDHM
>NZ_LR594662.1|WP_162588050.1|4856630_4857641_-|1,2-phenylacetyl-CoA-epoxidase-subunit-A
MYTQAMDTMGKDKDGPKAVRSAEEMRLEQRFDERIDAGGFIEAKDWMPEHYRKTLVRQISQHAHSEIVGMLPEGNWISRAPTLKRKAILLAKVQDEGGHGLYLYAAAETLGTSRDQMLDALHTGKAKYSSIFNYPTLTWADMGTIGWLVDGAAIMNQVPICRCSYAPYARAMIRICREESFHQRQGYEALLTMMQHGTEAQKAMVQDAVNRWWWPSIMMFGPPDDQSPNSAQSMRWGIKRFTNDELRQKFIDAAVEQAKVLGVTLPDPDLKWNEERQAHDHGPIDWAEFWRVIGGDGPCNRERLGARVKAWEEGAWVREAALAYAAKHERSERLAA
>NZ_LR594662.1|WP_162588051.1|4857663_4858983_-|phenylacetate--CoA-ligase
MPVRHPSPGDLEPIETASRDEIAALQLQRLKATLQRAYDKVPHYRQAFDARGVHPDDLKQLSDIAKFPFTVKKDLRDNYPFGMFAVPREQVARIHASSGTTGKPTVVGYTLQDIEHWANLVARSIRAAGARPGDIVHVAYGYGLFTGGLGAHYGAERAGCTVIPMSGGQTEKQVQLIRDFRPDVIMVTPSYMQVIIEEFQRQGLDARENSLKVGIFGAEPWTEAMRREIEHKGGMDAVDIYGLSEVMGPGVASECIESKDGPVVWEDHFYPEIIDPETGEVLPDGEEGELVFTSLTKEALPIVRYRTRDLTRLLPPTARSFRRMGKIVGRSDDMLIIRGVNVFPTQIEEIVLAHEKLSGQYLIKVDREGHLDNVEVRCELQRTAAEIPGAECDQIAQWVQQRVKTLVGISTTVVVQPPESLERTLTGKARRVIDERPKT
>NZ_LR594662.1|WP_162588052.1|4859016_4859454_-|hydroxyphenylacetyl-CoA-thioesterase-PaaI
MSDPHAQHTAERVRDAMFARDRAVRGLGMEIEAIAPGRADVVMTVREDMLNGHDICHGGFISALADSAFAYACNSYNEVTVASGFGIDFVAPAREGDRLVARCVEVSKTGRTGVYDTEVLNQRGERVAVFRGRSYTLKGKPVAPA
>NZ_LR594662.1|WP_162588053.1|4859468_4860272_-|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase
MNEPLVRTTQSGAVRTLELNRPEALNSFTSQLHAALMAALDEAADDAAVRCVVLGGAGRAFCAGQDLSDPMVAPDFAPGATPKDLGQVIESLYAPLVLRIRSMPVPVIAEVHGVAAGAGANLALACDLVVAGRSASFIQAFAKIGLVPDTGGTWLLPRLVGQARALGLALLGDKLPAAEAAQMGLIWKCVEDDELSLTVEGLAQRLAAMPVRALVATRQALADAQALDLPAALAREAALQRELGAAADYREGVEAFRAKRLPQFNDR
>NZ_LR594662.1|WP_162588054.1|4860447_4861050_+|phenylacetic-acid-degradation-protein-PaaY
MPCYALEGVVPVVDPGAYVHPTAVLIGDVIVGPGCYVGPCASLRGDFGRIVLARGANVQDNCVIHGFPDQDTVVEENGHIGHGAVLHSCVVRRDALVGMNAVVMDEAEIGESAFVAACAFVPAGMKVPARSLVTGVPARVRRQLGEEEIAWKQEGTRTYQDLTRRCLASLVEVQPLAAAEENRPRLQSPDVRPLIATRRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594662_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594662_7

6182150-6182297

Orphan

Consensus_repeat	Method
CACCGCGGAACCGGCTTTGCCGGGCCGCCGGTGTTGCCCCCGGTAGGGGGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594662_7

>merge|NZ_LR594662|7|6182150-6182297|CRISPRCasFinder
CACCGCGGAACCGGCTTTGCCGGGCCGCCGGTGTTGCCCCCGGTAGGGGGTGGGCGGCTACACGAAGTGAGCCAACCTGGGGGCGAGCAACATCCCCACCGCGGAACCGGCTTTGCCGGGCCGCTGGTGTTGCCCCCGGTAGGGGGTG

>NZ_LR594662|7|7|6182150-6182297|CRISPRCasFinder
CACCGCGGAACCGGCTTTGCCGGGCCGCCGGTGTTGCCCCCGGTAGGGGGTG	GGCGGCTACACGAAGTGAGCCAACCTGGGGGCGAGCAACATCCC
CACCGCGGAACCGGCTTTGCCGGGCCGCTGGTGTTGCCCCCGGTAGGGGGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594662.1\|WP_162589189.1\|6177663_6179052_-\|adenylosuccinate-lyase	unknown	unknown	gnl\|CDD\|236452
NZ_LR594662.1\|WP_162589192.1\|6181472_6182084_+\|glutathione-S-transferase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|182405
NZ_LR594662.1\|WP_162589186.1\|6176256_6176721_+\|DUF3717-domain-containing-protein	unknown	unknown	gnl\|CDD\|378869
NZ_LR594662.1\|WP_162589183.1\|6174243_6174597_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377198
NZ_LR594662.1\|WP_162589200.1\|6196789_6197305_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162589199.1\|6196126_6196753_+\|response-regulator	unknown	unknown	gnl\|CDD\|226932
NZ_LR594662.1\|WP_162589198.1\|6193204_6194020_+\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143596
NZ_LR594662.1\|WP_162589187.1\|6176744_6177053_+\|DUF2007-domain-containing-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162589188.1\|6177053_6177614_-\|YaeQ-family-protein	unknown	unknown	gnl\|CDD\|377782
NZ_LR594662.1\|WP_162589195.1\|6184210_6185152_+\|RNA-polymerase-sigma-70-factor	unknown	unknown	gnl\|CDD\|132002
NZ_LR594662.1\|WP_162589197.1\|6189026_6193148_+\|TIGR02099-family-protein	unknown	unknown	gnl\|CDD\|273971
NZ_LR594662.1\|WP_162589184.1\|6174618_6175083_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594662.1\|WP_162589190.1\|6179088_6180144_-\|M48-family-metalloprotease	unknown	unknown	gnl\|CDD\|320691
NZ_LR594662.1\|WP_162589194.1\|6183297_6184155_+\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|153109
NZ_LR594662.1\|WP_162589930.1\|6194040_6196098_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|236901
NZ_LR594662.1\|WP_174263164.1\|6182544_6183015_-\|glutathione-peroxidase	unknown	unknown	gnl\|CDD\|238207
NZ_LR594662.1\|WP_162589191.1\|6180207_6181365_-\|DUF898-family-protein	unknown	unknown	gnl\|CDD\|368695
NZ_LR594662.1\|WP_162589196.1\|6186196_6189001_-\|bifunctional-[glutamate--ammonia-ligase]-adenylyl-L-tyrosine-phosphorylase/[glutamate--ammonia-ligase]-adenylyltransferase	unknown	unknown	gnl\|CDD\|236836
NZ_LR594662.1\|WP_162589185.1\|6175104_6175842_-\|YjbE-family-putative-metal-transport-protein	unknown	unknown	gnl\|CDD\|163429
NZ_LR594662.1\|WP_174263115.1\|6185175_6186204_-\|septal-ring-lytic-transglycosylase-RlpA-family-protein	unknown	unknown	gnl\|CDD\|223868

Protein	Function_ID	Function_description	E-value
NZ_LR594662.1\|WP_162589189.1\|6177663_6179052_-\|adenylosuccinate-lyase	gnl\|CDD\|236452	PRK09285, PRK09285, adenylosuccinate lyase; Provisional.	0
NZ_LR594662.1\|WP_162589192.1\|6181472_6182084_+\|glutathione-S-transferase-N-terminal-domain-containing-protein	gnl\|CDD\|182405	PRK10357, PRK10357, putative glutathione S-transferase; Provisional.	4.42088e-53
NZ_LR594662.1\|WP_162589186.1\|6176256_6176721_+\|DUF3717-domain-containing-protein	gnl\|CDD\|378869	pfam12512, DUF3717, Protein of unknown function (DUF3717). This family of proteins is found in bacteria. Proteins in this family are typically between 75 and 117 amino acids in length. There is a conserved AIN sequence motif. There are two completely conserved residues (L and Y) that may be functionally important.	2.19503e-26
NZ_LR594662.1\|WP_162589183.1\|6174243_6174597_-\|phage-holin-family-protein	gnl\|CDD\|377198	pfam04020, Phage_holin_4_2, Mycobacterial 4 TMS phage holin, superfamily IV. These proteins are predicted transmembrane proteins with probably four transmembrane spans. The 1.E.40 is represented by the mycobacterial 4 phage holin, but it also contains many cyanobacterial. proteobacterial and firmicute proteins. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as in those of the bacteriophage of these organisms. The primary function of holins appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyze the cell wall polymer as a prelude to cell lysis. When chromosomally encoded the enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases.	4.1217e-23
NZ_LR594662.1\|WP_162589199.1\|6196126_6196753_+\|response-regulator	gnl\|CDD\|226932	COG4566, TtrR, Response regulator [Signal transduction mechanisms].	1.05985e-66
NZ_LR594662.1\|WP_162589198.1\|6193204_6194020_+\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143596	cd07572, nit, Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases). This subgroup includes mammalian Nit1 and Nit2, the Nit1-like domain of the invertebrate NitFhit, and various uncharacterized bacterial and archaeal Nit-like proteins. Nit1 and Nit2 are candidate tumor suppressor proteins. In NitFhit, the Nit1-like domain is encoded as a fusion protein with the non-homologous tumor suppressor, fragile histidine triad (Fhit). Mammalian Nit1 and Fhit may affect distinct signal pathways, and both may participate in DNA damage-induced apoptosis. Nit1 is a negative regulator in T cells. Overexpression of Nit2 in HeLa cells leads to a suppression of cell growth through cell cycle arrest in G2. These Nit proteins and the Nit1-like domain of NitFhit belong to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 10.	4.34763e-135
NZ_LR594662.1\|WP_162589188.1\|6177053_6177614_-\|YaeQ-family-protein	gnl\|CDD\|377782	pfam07152, YaeQ, YaeQ protein. This family consists of several hypothetical bacterial proteins of around 180 residues in length which are often known as YaeQ. YaeQ is homologous to RfaH, a specialized transcription elongation protein. YaeQ is known to compensate for loss of RfaH function.	6.4912e-97
NZ_LR594662.1\|WP_162589195.1\|6184210_6185152_+\|RNA-polymerase-sigma-70-factor	gnl\|CDD\|132002	TIGR02957, putative_sigma_factor, RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.	1.6104e-113
NZ_LR594662.1\|WP_162589197.1\|6189026_6193148_+\|TIGR02099-family-protein	gnl\|CDD\|273971	TIGR02099, probable_transmembrane_protein, TIGR02099 family protein. This model describes a family of long proteins, over 1250 amino acids in length and present in the Proteobacteria. The degree of sequence similarity is low between sequences from different genera. Apparent membrane-spanning regions at the N-terminus and C-terminus suggest the protein is inserted into (or exported through) the membrane. [Hypothetical proteins, Conserved].	0
NZ_LR594662.1\|WP_162589190.1\|6179088_6180144_-\|M48-family-metalloprotease	gnl\|CDD\|320691	cd07332, M48C_Oma1_like, Peptidase M48C Ste24p, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	2.26195e-75
NZ_LR594662.1\|WP_162589194.1\|6183297_6184155_+\|ferritin-like-domain-containing-protein	gnl\|CDD\|153109	cd01050, Acyl_ACP_Desat, Acyl ACP desaturase, ferritin-like diiron-binding domain. Acyl-Acyl Carrier Protein Desaturase (Acyl_ACP_Desat) is a mu-oxo-bridged diiron-carboxylate enzyme, which belongs to a broad superfamily of ferritin-like proteins and catalyzes the NADPH and O2-dependent formation of a cis-double bond in acyl-ACPs. Acyl-ACP desaturases are found in higher plants and a few bacterial species (Mycobacterium tuberculosis, M. leprae, M. avium and Streptomyces avermitilis, S. coelicolor). In plants, Acyl-ACP desaturase is a plastid-localized, covalently ACP linked, soluble desaturase that introduces the first double bound into saturated fatty acids, resulting in the corresponding monounsaturated fatty acid. Members of this class of soluble desaturases are specific for a particular substrate chain length and introduce the double bond between specific carbon atoms. For example, delta 9 stearoyl-ACP is specific for stearic acid and introduces a double bond between carbon 9 and 10 to yield oleic acid in the ACP-bound form. The enzymatic reaction requires molecular oxygen, NAD(P)H, NAD(P)H ferredoxin oxido-reductase and ferredoxin. The enzyme is active in the homodimeric form; the monomer consists mainly of alpha-helices with the catalytic diiron center buried within a four-helix bundle. Integral membrane fatty acid desaturases that introduce double bonds into fatty acid chains, acyl-CoA desaturases of animals, yeasts, and fungi, and acyl-lipid desaturases of cyanobacteria and higher plants, are distinct from soluble acyl-ACP desaturases, lack diiron centers, and are not included in this CD.	2.08654e-06
NZ_LR594662.1\|WP_162589930.1\|6194040_6196098_+\|PAS-domain-S-box-protein	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	9.43403e-42
NZ_LR594662.1\|WP_174263164.1\|6182544_6183015_-\|glutathione-peroxidase	gnl\|CDD\|238207	cd00340, GSH_Peroxidase, Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes.	6.45549e-73
NZ_LR594662.1\|WP_162589191.1\|6180207_6181365_-\|DUF898-family-protein	gnl\|CDD\|368695	pfam05987, DUF898, Bacterial protein of unknown function (DUF898). This family consists of several bacterial proteins of unknown function. Some of the family members are described as putative membrane proteins.	4.8372e-81
NZ_LR594662.1\|WP_162589196.1\|6186196_6189001_-\|bifunctional-[glutamate--ammonia-ligase]-adenylyl-L-tyrosine-phosphorylase/[glutamate--ammonia-ligase]-adenylyltransferase	gnl\|CDD\|236836	PRK11072, PRK11072, bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase.	0
NZ_LR594662.1\|WP_162589185.1\|6175104_6175842_-\|YjbE-family-putative-metal-transport-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	7.75451e-82
NZ_LR594662.1\|WP_174263115.1\|6185175_6186204_-\|septal-ring-lytic-transglycosylase-RlpA-family-protein	gnl\|CDD\|223868	COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, outer membrane].	3.84288e-56

>NZ_LR594662.1|WP_162589192.1|6181472_6182084_+|glutathione-S-transferase-N-terminal-domain-containing-protein
MKLIGSAASPYVRKVRVVMAEKRLDYQFVIEDVWSDDTTIASSNPLGKVPCLIMDGSEAMFDSRVIVEYLDTLSPVGKLIPQPGRERAEVKTWEALADGVMDAGVLWRLEATWARRADGERSRAWMDRQRAKVEAGIRAMAKGLGDKPFCSGIHLSLSDISVGCALGWIAFRFPDIDWRGEHPNLGKLYDKLMLRASFADTAP
>NZ_LR594662.1|WP_162589191.1|6180207_6181365_-|DUF898-family-protein
MVTEAPIDTVPERHPIEFTASGSEYFRIWIVNLLLIVLTLGIYLPWAKVRKLKYFYSNTWVGGDALDFHGEPAKMLRGTLIAAGFLIAYSVGSNFSGWAALLAALAFVALWPALFRAAMRFRLANTSWRGLRFRFAGDTAGAYACMLPPLALALLPAALAGAMAGASMDGKPPALPAVATGVVGLGMLAFVAGLPYFFWRVRRYQHDNYAIGTLQTRLKADVGVLYGIFIKLIAISLGAFAIMLLVAGLFAFTGRRTGTGATFVVVAALMGFGTILLVNILPKSYLQVRLQNLLWSTTGNEVLRFDSRLKFGSYLGLQCRNYLLIFLTLGLYWPFAVVNTRRAQIDAVELQTRIGLDQLSQVAGREDPGAAGDMAADLFGLDIGL
>NZ_LR594662.1|WP_162589190.1|6179088_6180144_-|M48-family-metalloprotease
MNALEVRFFDGRSSRPQAARLHVQGDVLTISPAPGETFASFSVPLARLRWPERTRHGGRLLQLPQGASVQALDVAAWDAWAAQLGRSESWVVRAQQNWRGVALALALLLAATAALYQWGLPWVARGVTAAVPAGVDTTIGAEVLESIDQSLLAPSALAPEEQERIRRTFARMVQAAHPEGAPAWKLEFRRARDPRLGPNALALPGGTIVLTDELVQLMPGDPDAVLGVLGHEFGHVRLRHAMRQLVQASAIGFAVSAAFGDYGTLIGSAPVLLATLGYSRDAEREADAEAVRLMRAAGISPRVMIGFFEAVERWRAGQKRAGLDDDVIGLAFSSHPATAERIAFFREAAAN
>NZ_LR594662.1|WP_162589189.1|6177663_6179052_-|adenylosuccinate-lyase
MSFSTVSALSPLDGRYAAKLSALRPLMSEQGYMHRRVQVEVAWFIALSDCGFPEFKPLTGGARKYLLGLVNNFSEADAIAIKQIEKTTNHDVKAVEYWIKSKFEARPELQAASEFVHFACTSEDINNTSHALQIQAAREKVVLPAIDGLIATLREMAGRFAEVPMLSRTHGQTASPTTVGKEIANVAVRLAKARERIAGVALLGKMNGAVGNYNAHMAAWPEFDWEAFSRKVVETPAPLGLGLSFQPYSIQIEPHDYMAELFDAVARVNTILIDFARDVWGYVGLGYFKQRLKEGEIGSSTMPHKVNPIDFENAEGNLGLANALLRHLSDKLPISRWQRDLTDSTVLRNIGVAFGYAVLAYASLATGLGKLELNEEALAEDLEASWEVLAEPIQTVMRRFGVQGAYEQLKEVTRGKTVTAEALHELIRSLEIPEEEKERLLAMTPASYTGKAVELARRAQTP
>NZ_LR594662.1|WP_162589188.1|6177053_6177614_-|YaeQ-family-protein
MALKSTIFKATLAVADIDHGYYADHALTLARHPSETDERMMIRLVALALNAHKLQDVCQGDGTLAFGAGLSNPDEPDVWLRDFTGAVRLWIEVGQPEDKPIIKACGKADETIVYAFHHAAEVWWRGIENKLTRPQNLAVYRVPTAASQALAALAQRSMQLQATVQEGTLMLGDGTHNVDIEPVRWK
>NZ_LR594662.1|WP_162589187.1|6176744_6177053_+|DUF2007-domain-containing-protein
MRRLAQAPNLAIATLWADALREEGVAASVQREYLGAAAGQLPPDQCLPEIWIEDEAQFERAKQLLHALQHRPQRRWQCGCGELVEGGFEQCWRCGAMMPGEA
>NZ_LR594662.1|WP_162589186.1|6176256_6176721_+|DUF3717-domain-containing-protein
MAAIHITDIEAAINYWREKKPSPDGITLAPELRALAEVYALMVFHHEDEAAEVGFPPKAWDAWLAWYQTTPDTPCIAICSTSQGDDECKGCGRSFDEVQHWPSMTPGEKRATWRRITMQDKAWRFNRYAERAREAEPAWPDDEPAPGELVELPR
>NZ_LR594662.1|WP_162589185.1|6175104_6175842_-|YjbE-family-putative-metal-transport-protein
MEQFLTPEFWVAVGQIIMIDILLGGDNAVVIALACRKLPPAQRTKGILWGTAGAIVLRVILIFFALTLLAIPFLKLAGALLLVWIGVKLLAPEHDDAHGNIAASDKLWAAVKTVIVADLVMSVDNVIAIAGAAQGAGSDHQMPLVIFGLLVSIPIIVWGSQLVIKLMDRFPIIITLGGMLLGWIAGTMAVSDPAVVNPAAWAWVPKVPQTDMVRYIAGIGGALLVLLIGKWVAMRRPKPQDTATA
>NZ_LR594662.1|WP_162589184.1|6174618_6175083_-|hypothetical-protein
MEKIILYVDDAAYARELLSRLTPEAVGTGARHWVLVACAPRMTHRISKWVSHSARENWRNKWLAKTQEQLLPLLQLQDGQVTSVLAKGPLAELTRRLKMEHGAARVIDARRPKIGVDLEPVAPDVKSPSQSGWALPGAVLGMGALLMLANELSE
>NZ_LR594662.1|WP_162589183.1|6174243_6174597_-|phage-holin-family-protein
MRLVIKWLLSALALLAVTYVYSGVQVSSFTSALIAAAVIGLLNMVVRPVLVVLTLPVTIVTLGLFLFVINALLFWAASGLLPGFHVNGFVAALIGSLIYSLLGLVIEAALGGLFARG
>NZ_LR594662.1|WP_174263164.1|6182544_6183015_-|glutathione-peroxidase
MLQHTFPRLQDEKPQALCQYTGKVVLVVNTASFCGFTPQYKGLEALDSKYRSRGLVVLGFPSNDFSQETGTNKEIAEFCESTFGVKFPMFAKSSVRGPQANPLFKELAQASGTTPKWNFYKYLISREGKVVESYSSMTSPDDRAFVRDLEKQLGPQ
>NZ_LR594662.1|WP_162589194.1|6183297_6184155_+|ferritin-like-domain-containing-protein
MLYPELFRQLESVRWDMDKDIPWQSFDASRLSEEQAQTIKMNAITEWAALPATEMFLRDNRHDSDFSAFMSIWFFEEQKHSLVLMEYLKRFSPQHAPTEQELHEVRFDFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYTTLSQDEARHGGAYLRYMKRALEKFGDEARAAFTKVGVLMASARRTAQALHPTNLHVNKALFPKDTIQSRVPDPDWLEHWLDKQIKFDAVWEHKVGDRILHNLSLLMNRSFKTVQELNRYRKEVTATLGPKAEYQGA
>NZ_LR594662.1|WP_162589195.1|6184210_6185152_+|RNA-polymerase-sigma-70-factor
MDDSTHTFDRHRKRLLGIAYRMLGSAADAEDVVQDAWLRWNDATVDALNNPEAWLVTVVTRLSIDRLRAAKLQREHYEGTWLPEPLLTDAPASPEQMLERADNISVAFLAVLERLAPEARAAFLLREVFDAEYEDVARTLGKSEAACRQLVHRAKTQIQDERPRFAVERDTHWRLMQGFAEASTSGDMRRLKELLAEDAELIGDSGGKVPAFRKMLRGAQRIAQYFYAVPRLLGGGLRLELAEINGEPGLLRFYNGSLESVQTIETDGERILRIRTQRNPEKLARIAARFSARAITRAELEALRTAAPPEALP
>NZ_LR594662.1|WP_174263115.1|6185175_6186204_-|septal-ring-lytic-transglycosylase-RlpA-family-protein
MADARVLALAVGAALVLLAGCASGPRGSGIGRDGPDANPPPGLGQMPDAEPRVEAIRGSGGTSKPYVVLGRSYVPITDDRPWRETGLASWYGRKFHAQSTASGEPYDMYAMTAAHKTLPLPSYVRVRNPANGREVIVRVNDRGPFHDDRIIDLSYTAAYKLDLLRGVAPVEIERITNADIRAGTWRRGDTALAQAAPAQAPVALAAAPATPGAADAVAVPAALTSPVVAAPRAEVRELDTLPPLPAPSSEPVPAPAAESPPVAPASGFWVQLGAFSQRDGVERFQQQVARSLPVLAGALNVFAERGTYRLQAGPYASRDQARDMAEQVRNGLQLAPMIVERR
>NZ_LR594662.1|WP_162589196.1|6186196_6189001_-|bifunctional-[glutamate--ammonia-ligase]-adenylyl-L-tyrosine-phosphorylase/[glutamate--ammonia-ligase]-adenylyltransferase
MTASLPPGSTDTHTEGGAADAPQMPFAASSRFVQRLRRRYAGELALLAAGEPRRATMAQAYDALRERGDGVADALRIVRQLVMERLVTLDCEQQAALAVVTTAVTELAEFALDIACREACAELEATHGTPLGPDGQHAQLWVVGMGKLGARELNVSSDIDLIYLYDHDGETVGDAQGRARLANQEFFSRAVKRIYALVGDTTEHGFVFRVDLALRPNGNSGPSVVSLDALEEYFQVQGREWERFAWLKSRVVAPQSVIADCSAQALRGVVLPFVFRRYLDYSVFDSLRTLHRQIREQAARRSAGRPERANDVKLSRGGIREIEFIVQLLQVVRGGQFPELRTRPTLDALQRLARANLMPQETADALAAAYEFLRRVEHRIQYLDDQQTHVLPVQDEDLRWIARTLGYEGCCPFLAQLDAHREFVAQEFDKLLGGTKAPCKRCNGAAAGTVPADLGDLIEALPAPFAERIQAWRDSPRVQALRDETRARLRQLVQRTGQWLREPDGEGPGEIAHHIDGAMRWVDWIEPLMRRENYIALLVERPAVQERLLRLLGSARWPARYLMQHPGVIDELASHEMLAGRFSAAEFERELEARHLSLRQTGEADEERLLNLLRHAHHAELFRTLARDVEGRITVEQVADDLSALADAVLRVTARWCWPHVRNPHRETPRFAIIGYGKLGGKELGYGSDLDIVFVYDDDDERAGEVYAAYVRKLINWLTVKTREGDLFEIDTALRPNGNSGLLTTSFDAYEKYQLGRGSNTAWTWEHQAMTRARFVDMASGPEDSGDCSLCDRFDRIREAVITAPRDRAALKAEIVAMREKVRAARPVKADRFDVKHSPGGMVDAEFAVQFLVLSEAKAHPELIPNVGNIALLVRAEEAGLLPEGIGRNAAAAYRELRRVQHRARLNEEPTQVPMSALAAEREAMLALWKAVFG
>NZ_LR594662.1|WP_162589197.1|6189026_6193148_+|TIGR02099-family-protein
MNDTTSSPSRLLKITAVAARWLLALLIGAWLMLALSVLVLHAWIVPRIGEYRGALEAQASKAIGVPVRIGSITAKGGTLFPSFELREVVLHDPQQREALRLARVVASVSPRSLWRLNFEQVYIERPELEVRRDAAGKLHVAGLSMDTDTTGESRGADWFFAQREFVIQGGIVRWIDESRGAPSLLLSDVQFIARNGSRSHTMRLDATPPPGWGERFSLRGAFRQPLLSVRSGNWQSWDGVAYAELPRIDIRQLGQYVTLDARIREGDGALRIWADIDDGQIAGGTADLALLRVDASLGKSLEPLVLRDVTGRLAGRMTQEAQEFSTTDLQFQTPDGMRWPGGNLWFQHLPAKGRVAERGALRADRLDLAALAMIADRLPLDAKSRKLIDGLVPRGLVERIDASWQGPLGAPDRYQARGRVSGFGVASRSAETVAMPAARVVPAPRSSAPAAAANAAAPPPAGAPGIRGATIDFDATQAGGSAALSIANGALDFPGVFEEPVIAIDQLSAQLSWKIDDDKSQLQVSGLRFANADAEGEAQASWRTSDPASSSSRARFPGVLDLQGKLTRADGTRVYRYLPQHIPKETRDYVRDAVQKGSASAVDFKVKGDLHDMPFTDPKLGDFRIAARVGDVHYAYAPPVAGSEKNWPALTGVSGELVFERAGMQVRNARGRIAGAPGIEVTKAEAQIPDLDHHAPLLKVDAQAKGPLAELLRAGSPLAGEAGPALAGARATGNADYRLRLELPLSAMDKAKVQASVALADNDIQILPEAPTLGQARGTLSFTEGGFSLAGVQARALGGALRIEGAGRWGAVQELNLRAQGNASAEGMRAAREVDWLARLARHASGSTPYTATFSMRDGASEFSLASSLQGLGLQLPAPLAKPPEDPMPLAIEKKIVQRETRAGATPLLQDRLSVELARVGSASYVRDISGSEARVLRGGIGIGLSAGESAAPPERGVLANIQLARVDVPAWQALFGDTTGKPAEATEGGDDASAYLPTILALRAQELAIGGRTLHNVVLGGTREGTLWHANIDATELSGYAEYRSAQAGRLYARLARLKIAPSTANAVESLLDEQPSTLPALDIVVDDFELLGRRLGRAEIDAVNRGGAGREWRLNKLAFTTPEASFTAQGAWAAAPAGTGARGRGEPRRTTMDFKLDIADAGGLLGRFGMKDVIRAGRGRLEGQVHWSGSPFALDYPSLGGQLKIDVESGQFLKAEPGIAKLLGVLSLQALPRRLTLDFRDVFSQGFSFDFLRGDARINQGVASTNNLQMKGVNAAVLMDGSADIARETQSLRVVVVPEINAGTAALVATAINPAIGLGTFLAQMVLSRPLIAAATQEFQIDGTWADPKITKIPRRLLPAAQGAPAAPAVR
>NZ_LR594662.1|WP_162589198.1|6193204_6194020_+|carbon-nitrogen-hydrolase-family-protein
MKVAAIQMVSAIAREANLARAHALLGEAAAGGAELAVLPEYFCMMGARDTDKLGLRETAGAGTVQGFLADAAREFGLWIVGGTLPLETGDERHVFNSSLAYSPDGEHVARYDKIHLFFYDNGRERYDERRVIAPGAEPVCFDLPSRDGHRWRIGMSVCYDLRFPELYRELARQGAELLLVPSAFTHTTGSAHWEVLLRARAIENLCWVVAPAQGGTHENGRRTWGQSMVVDPWGEVVAQRAVEEGVVSFELDARQVEHARTQLPALSHRVL
>NZ_LR594662.1|WP_162589930.1|6194040_6196098_+|PAS-domain-S-box-protein
MPIARTVRGAFSGLRSLRSLHSLWQRWFLWVILAVLVIALLATVVWLAGRHEVEQVQTALDRDTADAVSDLRSGLQRNAQSLRASQVNGRDREHWPMEAAALLREHREWLRLEWRDAALRPLAAVDTPYRRRVFDDANRGREQADVALACAAARKAGAPAYSPSHYVPFVPSGGLEVMELCLPVDGGGYLVATYSLRDTLIELVAPTLTRGQEVAFTEPDGTRLVAVGAARRVGTRVFTAQQLVDLPGNALMLRVDGWRAAPDLFPNLLTGLVTAISIALVSVLVLLARDTRRRLRAEHDLADALAFRKAMEDSVITGLRARDLQGRITYVNPAFCEMVGFSAEELMHHASDMPYWPTELAQEYRQRQALRMAGGVPPREGFESVFMHKDGRRFPVLIFEAPLINAQGAQTGWMSAFIDVSEQRRIEELSRASQERLQASARLATVGEMASLLSHELTQPLAAIASYASGSLNLLRSAGASPGGDHGEVAMAVRRIAEQADRAGQVIRSVHDFVRRRDRLREAVAPQALIDAVMPLVRLQARKLGVRVDVHYEERLPRVLCDRTLVEQVLLNLARNAMQAMDLPELSERVLHLRVARARAVGESGDTPDKADVRRWVEFSVADRGVGISEEVAARLFTPFFTTRPDGMGLGLSLCRTVVEQHGGALAFEPQRPRGTVFRFTLPAA
>NZ_LR594662.1|WP_162589199.1|6196126_6196753_+|response-regulator
MQPLIDALIFIVDDDASVREALAWLLRSRRLVSEQYASAEDFELRLAEGPLADQPHCLLLDVRMPGMSGLALFDRLAERGLLEVMPVIFLTGHADVPTAVDAVKRGAFDFCEKPFSDNALVDRIEHALGASLRAVEAQRARRLLLRRVEELTERERDVMRRVVEGLPNKLIADQLSISVRTVEVHRARVFEKMEVRSAVELANLLRGI
>NZ_LR594662.1|WP_162589200.1|6196789_6197305_-|hypothetical-protein
MQTSVNVVGHSGRDHHGLELQVGTLQHGATMMGDDTANALGSLLTKQATLVSVSFVSNGRRDDFFLKPLVEALRQNTTLLQLDVSKFAVGAWRDELRDHLARNRNIFKMAVANGMWHGLSVLLGGRFYDDIVNRIIDTAEFSDRDALALSSLHPTAWAERHKTLQMDGVPK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_LR594662_7	7.1\|6182202\|44\|NZ_LR594662\|CRISPRCasFinder	6182202-6182245	44	NZ_LR594662.1	883370-883413	0	1.0
NZ_LR594662_7	7.1\|6182202\|44\|NZ_LR594662\|CRISPRCasFinder	6182202-6182245	44	NZ_LR594662.1	3932344-3932387	1	0.977
NZ_LR594662_7	7.1\|6182202\|44\|NZ_LR594662\|CRISPRCasFinder	6182202-6182245	44	NZ_LR594662.1	4671400-4671443	2	0.955

1. spacer 7.1|6182202|44|NZ_LR594662|CRISPRCasFinder matches to position: 883370-883413, mismatch: 0, identity: 1.0

ggcggctacacgaagtgagccaacctgggggcgagcaacatccc	CRISPR spacer
ggcggctacacgaagtgagccaacctgggggcgagcaacatccc	Protospacer
********************************************

2. spacer 7.1|6182202|44|NZ_LR594662|CRISPRCasFinder matches to position: 3932344-3932387, mismatch: 1, identity: 0.977

ggcggctacacgaagtgagccaacctgggggcgagcaacatccc	CRISPR spacer
ggcggctacacgaagtgagccaacctgggggggagcaacatccc	Protospacer
******************************* ************

3. spacer 7.1|6182202|44|NZ_LR594662|CRISPRCasFinder matches to position: 4671400-4671443, mismatch: 2, identity: 0.955

ggcggctacacgaagtgagccaacctgggggcgagcaacatccc	CRISPR spacer
ggcggctacacgaagtgagccaacctgggggagagcaacatgcc	Protospacer
******************************* ********* **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LR594662_2	2.1\|780150\|37\|NZ_LR594662\|CRISPRCasFinder	780150-780186	37	NZ_KU237244	Sphingomonas sp. SH plasmid pSH, complete sequence	5235-5271	9	0.757

1. spacer 2.1|780150|37|NZ_LR594662|CRISPRCasFinder matches to NZ_KU237244 (Sphingomonas sp. SH plasmid pSH, complete sequence) position: , mismatch: 9, identity: 0.757

agagcaacatccccgggccgctggtgttgcccccggt	CRISPR spacer
ccatcgccttcgccgcgccgctggtgttgcccccggc	Protospacer
  * *. * ** *** ********************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4056515 : 4074267

Synechococcus_phage(50.0%)

plate,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162587393.1\|4056515_4058660_-\|tail	phage tail protein I	NA	NA	NA	NA
WP_162587394.1\|4058666_4059656_-	hypothetical protein	NA	NA	NA	NA
WP_162587395.1\|4059660_4062483_-	hypothetical protein	NA	NA	NA	NA
WP_162587396.1\|4062485_4064621_-\|plate	putative baseplate assembly protein	NA	NA	NA	NA
WP_162589752.1\|4064625_4065669_-\|plate	putative baseplate assembly protein	NA	NA	NA	NA
WP_162587397.1\|4068092_4068506_-	GPW/gp25 family protein	A0A0E3ETF4	Synechococcus_phage	2.1e-07	31.8
WP_162587398.1\|4068510_4068792_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_162587399.1\|4068807_4069473_-	hypothetical protein	NA	NA	NA	NA
WP_162587400.1\|4069488_4070682_-	phage late control D family protein	NA	NA	NA	NA
WP_162587401.1\|4070681_4071335_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_162587402.1\|4071338_4072076_-	hypothetical protein	NA	NA	NA	NA
WP_162584107.1\|4072105_4072315_-	hypothetical protein	NA	NA	NA	NA
WP_162587403.1\|4072266_4072632_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_162587404.1\|4072648_4073074_-\|tail	phage tail protein	NA	NA	NA	NA
WP_162587405.1\|4073085_4074267_-\|tail	phage tail sheath subtilisin-like domain-containing protein	J9PVC2	Bacillus_phage	1.2e-31	37.7

DBSCAN-SWA_2

5764085 : 5774302

Acinetobacter_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102905612.1\|5764085_5765279_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.2e-13	28.7
WP_162588847.1\|5765890_5766595_-	uracil-DNA glycosylase	A0A0B5IW78	Pandoravirus	2.8e-47	48.5
WP_162588848.1\|5766650_5767451_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.4e-58	51.7
WP_162588849.1\|5767463_5768489_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	8.4e-77	45.3
WP_162588850.1\|5768507_5769170_-	LysE family transporter	NA	NA	NA	NA
WP_162588851.1\|5769162_5770212_-	low-specificity L-threonine aldolase	NA	NA	NA	NA
WP_162588852.1\|5770216_5770801_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	1.4e-57	56.9
WP_162588853.1\|5770797_5771187_-	GxxExxY protein	A9YW17	Ostreococcus_tauri_virus	2.5e-05	29.0
WP_162588854.1\|5771186_5772689_-	anthranilate synthase component I	S4VT78	Pandoravirus	2.5e-37	30.2
WP_162588855.1\|5773022_5773529_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_162588856.1\|5773525_5774302_-	SDR family NAD(P)-dependent oxidoreductase	W8CYX9	Bacillus_phage	9.3e-12	44.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_LR594664

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LR594664_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594664_1

2397-2497

Orphan

Consensus_repeat	Method
AGCGGTGGGGACCAGGTCGCCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594664_1

>merge|NZ_LR594664|1|2397-2497|CRISPRCasFinder
AGCGGTGGGGACCAGGTCGCCACTTAAAGGGCGCCACCTCTTGGTCCAGGGCCAATGGCTGGTTTCAGAGCGTTCCCCAGGGGTGGGGACCAGGTCGCCAC

>NZ_LR594664|1|1|2397-2497|CRISPRCasFinder
AGCGGTGGGGACCAGGTCGCCAC	TTAAAGGGCGCCACCTCTTGGTCCAGGGCCAATGGCTGGTTTCAGAGCGTTCCCC
AGGGGTGGGGACCAGGTCGCCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594664.1\|WP_162590305.1\|6531_7653_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274757
NZ_LR594664.1\|WP_162590304.1\|5882_6443_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_LR594664.1\|WP_162590311.1\|13330_14080_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590310.1\|12829_13144_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590308.1\|10742_11549_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	unknown	unknown	gnl\|CDD\|374893
NZ_LR594664.1\|WP_162590307.1\|10389_10728_+\|DotD/TraH-family-lipoprotein	unknown	unknown	gnl\|CDD\|379881
NZ_LR594664.1\|WP_162590309.1\|11555_12833_+\|Flp-pilus-assembly-complex-ATPase-component-TadA	unknown	unknown	gnl\|CDD\|131576
NZ_LR594664.1\|WP_162590648.1\|117_1320_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274585
NZ_LR594664.1\|WP_162590302.1\|2532_2766_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590306.1\|8272_10156_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590303.1\|3867_5304_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590301.1\|1331_2330_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319262

Protein	Function_ID	Function_description	E-value
NZ_LR594664.1\|WP_162590309.1\|11555_12833_+\|Flp-pilus-assembly-complex-ATPase-component-TadA	gnl\|CDD\|131576	TIGR02524, ATP-binding_protein, Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.	4.34089e-53
NZ_LR594664.1\|WP_162590648.1\|117_1320_+\|AAA-family-ATPase	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	3.58991e-71
NZ_LR594664.1\|WP_162590305.1\|6531_7653_-\|hypothetical-protein	gnl\|CDD\|274757	TIGR03739, PRTRC_D, PRTRC system protein D. A novel genetic system characterized by six major proteins, included a ParB homolog and a ThiF homolog, is designated PRTRC, or ParB-Related,ThiF-Related Cassette. It is often found on plasmids. This protein family is designated PRTRC system protein D. The gray zone, between trusted and noise, includes proteins found in the same genomes as other proteins of the PRTRC systems, but not in the same contiguous gene region.	1.68318e-39
NZ_LR594664.1\|WP_162590304.1\|5882_6443_-\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	3.80576e-07
NZ_LR594664.1\|WP_162590308.1\|10742_11549_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	gnl\|CDD\|374893	pfam16932, T4SS_TraI, Type IV secretory system, conjugal DNA-protein transfer. T4SS_TraI is a family of putative Gram-negative, largely Proteobacterial, type IV conjugal DNA-Protein transfer or VirB secretory pathway (IVSP) proteins.	3.37626e-49
NZ_LR594664.1\|WP_162590301.1\|1331_2330_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319262	cd16405, RepB_like_N, plasmid segregation replication protein B like protein, N-terminal domain. RepB, found on plasmids and secondary chromosomes, works along with repA in directing plasmid segregation, and has been shown in Rhizobium etli to require the parS centromere-like sequence for full transcriptional repression of the repABC operon, inducing plasmid incompatibility. RepA is a Walker-type ATPase that complexes with RepB to form DNA-protein complexes in the presence of ATP/ADP. RepC is an initiator protein for the plasmid. repA and repB are homologous to the parA and ParB genes of the parABS partitioning system found on primary chromosomes.	1.46776e-31
NZ_LR594664.1\|WP_162590307.1\|10389_10728_+\|DotD/TraH-family-lipoprotein	gnl\|CDD\|379881	pfam16816, DotD, DotD protein. The DotD protein is a component of the Dot/Icm type IVB secretion system. It is involved in the outer membrane targeting of DotH.	4.83096e-15

>NZ_LR594664.1|WP_162590301.1|1331_2330_+|ParB/RepB/Spo0J-family-partition-protein
MASFNKRIFDTTRLVEEKMAEKSLHSQPEVPAPSGPARTAPGRLMQASGQIVDLQSELAQLREKLSRWDGSMATTALDPSTISRSRFANRHLRSFETPDFERLKQSIQHSEGNVQPILVFPKAEGGYELVFGHRRHQACLELGIPVLAVIWDKPLSAQAHFLAMERENRDRTDLSAYESGMSYIAALEEGFFRSERQLAEAVGVSRRWIAKCLQVARLPPAIVEAFDSPLEIKPAHAELLQAALDENSKAVLRRAEKLRQRTGTLRPSAVIAALLGVGVEATGPRKLTTAAGAFGSWRRDAVGRTIFTLDPGLADEKVEAIMAAIEKVVAEQ
>NZ_LR594664.1|WP_162590648.1|117_1320_+|AAA-family-ATPase
MMHELRGTLLAPGAEKSAPMISSTRLAALCGIDKAKLAYRVTRGDLPVGRVTATGGLREFTVPESRVWTRSFRADRMRPAGQKALTLASSNFKGGSNKTTTATVLAQGLALRGHKVLAVDCDPQGSMSTLFGLLPGADIDSDMTILELISNRGEEPAKRQLQFDDLRYAVRDTYWDGLDLIAAAPLLFDAEFMLPSLVTADRTAKFWNVVNEGLEPLRDLYDVIIIDTPPSLSYVTLNALFAADGLIVPIPPSALDYASLSQFWALFSDLGSDLEKRGPDPKFYDFIHVLLTQVEPDNVDAVTGPVRRWVQSVYGEYLLPIEIPKTSATKSSAAQFGTIYDVGRNDMNARTYKRALDAYDRFVELIEASIVQTWRNRLLVGAARKQQVVGGGDQVATPAV
>NZ_LR594664.1|WP_162590302.1|2532_2766_-|hypothetical-protein
MHRDLLELKRELVQFTALRNNLITRLDDAVARAQEAIAAVGGRAAPGPDPLVEARRDRDMGVVKSMLGEILASVGKK
>NZ_LR594664.1|WP_162590303.1|3867_5304_-|hypothetical-protein
MSFNPDLNPDSGPNSVRREPEDPTAHDPFANTHPSGSGYSMNSAPDDSAPAQRLSNWYASAVQPVSAKTAASYRRTFDTLISRTASLLDLSPDSVAIADLIEQLRSDPTLKVDSKRTYRAAIAWALRQPDIEFSQPAREKGLELIAAFNPREGAKQEIVRNSRVSARTIPEEDLGPLLNALLGARVTKQAWATKTTSWLNAGIATGARPGEWEFAYWFNRDRRILRLPNAKLKKQAPFRWQHIPERLLNRADADLASMADADPENISLVVAAAKRHSDLLARNLAFFDQAEAGTDAGNAEAIDTLRRLRAWELHNAGLAWRDIEVPGRWVGAVDAHLTNLANYLSGPPDRFGSPTFKRYYDGCRTALRTACLSAFQDGRLYSLYDTRSTAAANMQATIGAEAAATVMGHYMKRKRTIKANYAGPDRAYRGAGRFAPGLADTQNQRDQAADRTAPRGPSDSGGAGDTPDATSHGPLLGE
>NZ_LR594664.1|WP_162590304.1|5882_6443_-|hypothetical-protein
MSQSDDILDFRVRVHRDESPMLFRAIAALESAPGMRKRNLFVRQLMEMGLMVMEERMRNQNGLATRISRGLADEVSASAGMMVRASGLPAATQLTPESTTAAEIVGAAPATPAPVNTAQATVAASATSSPVETAPPAVAPAPAPVPQPVTVAAPVAAYSPPADDDRPPPRVGGARAVRMLDGESFR
>NZ_LR594664.1|WP_162590305.1|6531_7653_-|hypothetical-protein
MSSESGAPIVAAIDLGYGLTKFTRRNADTGAIEYDLFPSVAFGVDRRRYELEERRSENVKVVSYNGESFVVGPDVMSRAASSSDFGRHLDDKYYESAPYHALMRGALAYMEEDRIDVLVLGLPVSHFRDPGKPAALKKAYTGKISLDGERSVLIDKVIVRPQPMGGFYSLDRQIDGINTTIARFPQSGLKPLADWDQLVDTMTVVTVDPGEYTLDWLLVNRGKPNTDVSGAAGDAGRHRVMTSVKEHLEAKLGRAIAPTNLNRLNNSLRTGAVFKLDGRAIDMKDPEILAAARRAVRDPVSIMMNGIKGAWDIIDMVVLVGGHPSHYGEEIAERMPDMPIYVPKHSVFSNVEGLQLIGEGIAQAEARAEAEAL
>NZ_LR594664.1|WP_162590306.1|8272_10156_+|hypothetical-protein
MINSKGDRYCYLNARHTLETAAVSGGAGFFSKLHQLLINGNQGKAPPKQWASMIRALQTKGVKRSELEDSKILESLETSIEKSLTKEQVAGLVLSGLPTVKELELKSPRYAAWRHPGGDYKELLYVLNSQRDNVQDELSELEYRLEAMQYDAADLAFSLESLMDDPELPGRMQAQMKALRDLLPKAWDYETPHFRDALDGTVDKNIMAHARITERGSLFFVEEIQSDWAQAGGKASRRAAREAVISLLMTRLGDGASYGDRQFLESAIRSKATVELRGVKYDPKDPEMIAAAEEGRKAGWSGSTPAAPFVTNTEEWSGLILRRLIQRAAAIPAVNQFAWITQSMRNGGRAGGSASLDDFYKNILPKLADKLLKPMGAKVTMGQVTLNGTTYDVPQFPMTPEMKEVLRGPMPLYSMSPVWKGARNGQAEVNRVLAECELMMGTARHVKLMDQLYDIATHRQVAGKYINNGILLNLHAQNLDRAARHEAWHFATEHMLTVEERVAMQREFASHKPLARRTQQTLIQLGELDAARQCSHPEECAAHAFALWSSGEMEITEPAPKGLFQEVWSVLKDCGRWLAERVSGEKAVTTESIFEALRTGELAKMRESRARGPQEVDIEQRAPRMAA
>NZ_LR594664.1|WP_162590307.1|10389_10728_+|DotD/TraH-family-lipoprotein
MAVQLDRLFQKSAEQAAFTGSADAKAPAPRMADGKLWVTWRGDANDLLKNLEPVTGQKLSVTGPTPRLPLYVQVHALGVPVDEVMRDIGYQLGQRADLVLLPSGVEIRYRAF
>NZ_LR594664.1|WP_162590308.1|10742_11549_+|type-IV-secretory-system-conjugative-DNA-transfer-family-protein
MNRTPFFKASRLAFVVMALAGGQAAAAQTQTLSIESLMNAQGATESESRLSMVRETALRETAFGLGTRLGLLQRSREIAAEVAKRAHELDKRFDFGGLMMGPGVLPPVILESRDAISLEATTMRVSGAIYKIEEPARFVAIAPTWRDWLLLGLPTEDSADMSSVKSLLPRDGTEQAFWKKEVAQAVATGRAQAQQIFDLNVANLEKTYFGMRLFYDLWKRGMVTIPVVASAQTMVDHESPNTISVGNTMFRITRQAGFEDSSRWKPLE
>NZ_LR594664.1|WP_162590309.1|11555_12833_+|Flp-pilus-assembly-complex-ATPase-component-TadA
MLDAAEKAVPRFHLPIGNIRRQDLNEFLANVYDLGVSDIKFSSTDFVWAEVNRMWHPVTDRRLDDSEVNTILSLLFNESGQTEIGAANAIDSRVDAVVSRDKVLSFRLNATGCSVGNTPSGVNITLRAMPQQIPTCAQLGLEQELMDNLFPRYGMVLIVGTTGSGKSTLLAAAHRYRLEERRHDPVHILTYEQPVEYLLKGYAQGFMPEPTQTEVGMGAQLRSMDMVGPNAMRRKGQVIQMGEIRDMDSARAGFELGATGHAAYATMHTETPDRALSRTLQLFPPVEHARVANEFIEQTRLVIAQKLARRLDGKVIAFRSWCVFDREVKRSVEDLPSHQWGLAVRKLVSERGNDFESKAFAALAEGLISYESFVEVSSMTRAEASDYCAHRGFNPNAGPVVTSLPAATQVAATEAAPEAEVEEPA
>NZ_LR594664.1|WP_162590310.1|12829_13144_+|hypothetical-protein
MSSSYWPRTGKSYRIPGTPLPPQAGAPMVLALFHFSWWTLAIAFGVCAVFAYASYKNRTLVWALRRLRSKMRSGGVVARPRFYRQRFTFDQQLSDIDFRERGKK
>NZ_LR594664.1|WP_162590311.1|13330_14080_-|hypothetical-protein
MKKTPLLAFPTSSSSKPQPIDPDLLMPTTKYVGLLPGAKPLVFKRDIDNDHFNAICPDSHTSSFEYQGITVTFEQYNEICTSNSNDTACVTPDGAAWLLELYAKGLIPMSRKSPGTPPEEAIAYSHSHDELVRRSEQNRAEARARAEAYAAKLANPNAIPESEFTYTLLNDLSFRARPEGGPCEFDAGGLRITKHVTTLRSNSGKDHDSSVSFQWRSNGELHTIDKESRYAGNRRNDPERNWGLPPSGY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594664_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594664_2

327874-327974

TypeV

Consensus_repeat	Method
GCGCCGCGCTCGTCCTGGGCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594664_2

>merge|NZ_LR594664|2|327874-327974|CRISPRCasFinder
GCGCCGCGCTCGTCCTGGGCGCCGTCCTTCTCGCTCCCGTGATCGCCGTGGCCACGCTGGTGGTGGCGGTGCGCATGGGCGCCGCGCTCGTCCGGGGCGCC

>NZ_LR594664|2|2|327874-327974|CRISPRCasFinder
GCGCCGCGCTCGTCCTGGGCGCC	GTCCTTCTCGCTCCCGTGATCGCCGTGGCCACGCTGGTGGTGGCGGTGCGCATGG
GCGCCGCGCTCGTCCGGGGCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594664.1\|WP_162590560.1\|330226_331048_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319786
NZ_LR594664.1\|WP_162590564.1\|333710_334484_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590680.1\|320402_320552_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370696
NZ_LR594664.1\|WP_162590561.1\|331097_331952_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590551.1\|325132_325486_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590547.1\|321388_321691_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590555.1\|328018_328537_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590557.1\|328790_329390_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590548.1\|321687_322416_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590546.1\|320582_321392_-\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|223890
NZ_LR594664.1\|WP_162590562.1\|332018_332390_-\|helicase-SNF2	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590553.1\|326830_327124_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590558.1\|329407_329689_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_LR594664.1\|WP_162590556.1\|328533_328794_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590681.1\|322412_322634_-\|DUF1653-domain-containing-protein	unknown	unknown	gnl\|CDD\|377930
NZ_LR594664.1\|WP_162590559.1\|329709_330225_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594664.1\|WP_162590550.1\|323654_325136_-\|dTMP-kinase	unknown	unknown	gnl\|CDD\|234814
NZ_LR594664.1\|WP_162590549.1\|322951_323638_-\|DUF3850-domain-containing-protein	unknown	unknown	gnl\|CDD\|372409
NZ_LR594664.1\|WP_162590563.1\|332612_333710_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274042
NZ_LR594664.1\|WP_162590552.1\|325654_326608_+\|ATP-grasp-domain-containing-protein	unknown	unknown	gnl\|CDD\|375726

Protein	Function_ID	Function_description	E-value
NZ_LR594664.1\|WP_162590558.1\|329407_329689_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.97994e-09
NZ_LR594664.1\|WP_162590680.1\|320402_320552_+\|hypothetical-protein	gnl\|CDD\|370696	pfam09791, Oxidored-like, Oxidoreductase-like protein, N-terminal. Members of this family are found in the N terminal region of various oxidoreductase like proteins. Their exact function is, as yet, unknown.	2.41752e-05
NZ_LR594664.1\|WP_162590681.1\|322412_322634_-\|DUF1653-domain-containing-protein	gnl\|CDD\|377930	pfam07866, DUF1653, Protein of unknown function (DUF1653). This is a family of hypothetical bacterial proteins of unknown function.	2.37143e-05
NZ_LR594664.1\|WP_162590560.1\|330226_331048_+\|hypothetical-protein	gnl\|CDD\|319786	cd02587, HAD_5-3dNT, 5'(3')-deoxyribonucleotidase. This family includes cytosolic 5'(3')-deoxyribonucleotidase (cdN) and mitochondrial 5'(3')-deoxyribonucleotidase (mdN). cdN and mdN specifically dephosphorylate the deoxyribo form of nucleoside monophosphates helps maintain homeostasis of deoxynucleosides required for mitochondrial DNA synthesis. Their preferred substrates are dUMP and dTMP. cdN also dephosphorylates dGMP and dIMP efficiently. They can also dephosphorylate the 5'- or 3'-phosphates of pyrimidine ribonucleotides. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	9.92957e-16
NZ_LR594664.1\|WP_162590550.1\|323654_325136_-\|dTMP-kinase	gnl\|CDD\|234814	PRK00698, tmk, thymidylate kinase; Validated.	1.12579e-85
NZ_LR594664.1\|WP_162590549.1\|322951_323638_-\|DUF3850-domain-containing-protein	gnl\|CDD\|372409	pfam12961, DUF3850, Domain of Unknown Function with PDB structure (DUF3850). The search results from NCBI sequence alignment indicates a conserved domain belonging to ASCH superfamily. Dali searching results show that the protein is a structurally similar to the PUA domain, suggesting it may be involved in RNA recognition. It has been reported that the deletion of PUA genes results in impaired growth (RluD) and competitive disadvantage (TruB) in Escherichia coli. Suggestions have been put forward that, apart from their usual catalytic role, certain PUS enzymes (e.g. TruB) may also act as chaperones for RNA folding. The interface interaction indicates that the biomolecule of protein NP_809782.1 should be a dimer.	1.49815e-27
NZ_LR594664.1\|WP_162590563.1\|332612_333710_+\|hypothetical-protein	gnl\|CDD\|274042	TIGR02224, Tyrosine_recombinase_XerC, tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK. [DNA metabolism, DNA replication, recombination, and repair].	5.32895e-09
NZ_LR594664.1\|WP_162590546.1\|320582_321392_-\|radical-SAM-protein	gnl\|CDD\|223890	COG0820, COG0820, Predicted Fe-S-cluster redox enzyme [General function prediction only].	6.75237e-23
NZ_LR594664.1\|WP_162590552.1\|325654_326608_+\|ATP-grasp-domain-containing-protein	gnl\|CDD\|375726	pfam18299, R2K_2, ATP-grasp domain, R2K clade family 2. Family of ATP-grasp enzymes belonging to the R2K clade, wherein one of the absolutely-conserved lysine residues has migrated to the RAGYNA domain which is a part of the core ATP-grasp module. This family is predicted to catalyze peptide ligation reactions on protein substrates in biological conflict contexts, probably between bacteriophages and their hosts.	4.77399e-27

>NZ_LR594664.1|WP_162590553.1|326830_327124_+|hypothetical-protein
MPPVDLSDVSEADLVAELERRRFQRERPPRLRHVYTCTRCSNVYRAGTSPVTIYAWSGAVRCRSCNGSTTEATEPWENLVRSGNAPSGNARSEPRSI
>NZ_LR594664.1|WP_162590552.1|325654_326608_+|ATP-grasp-domain-containing-protein
MLVLQAETSAEVRTALLVATMRGMPVRRVSLKELQSNLDVRASLAAYLGEILPVGTVEFVRTVMGIRGVPEPEGMGYGPVGDFLRREIREGVLYELKAAEGPVFVKPVATKTFSGFVYDPRPGAKHTEYQLEQLKAIASLKTATRVWLSEVVEFACEWRYYVDATGRILAKARYDADGDDDAPEPTAEVVQSAIDSTVTYLEARGNAHPFAIDVGVLTNRRTAVVELSDAWALGLYAHSCTPAGTDWKADDYVDFLLQRWRSIVAYGQLRAAREAADRLAKAEKVEPPPPKVPARRGRPRKVSLQATAQAAVVAAGT
>NZ_LR594664.1|WP_162590551.1|325132_325486_-|hypothetical-protein
MNSAAQTPHTRESALQGSPAPAPTIAGSYEAFQVLCAEFLRAADTADGDALAAGVKCVGLAFLGIQWDDSSPFHKIHRAAGAPALMRLVTKKTIERETALAMAEAEAADVPGERCAP
>NZ_LR594664.1|WP_162590550.1|323654_325136_-|dTMP-kinase
MSAERGLFLSLEGVDGAGKSGHIEAIAKIFEDAGRTVVLTREPGGTPLAEQLRAMILSESMDPLTEALLCFAARRDHIQTKIAPALAAGKVVICDRFTDSTFAYQGGGRGFDLATLGTLEAMVQSRDMLTASGRAPGPNAGGALLQPDLTLLFYLDPAIAAQRLAGARAPDKFESQPVDFFHAVNNGYLARVHSDSKRFVLINATLSREQVWADVRANLVARGVLDAAAPPEQARSATNPEEAATGSRTESAGGLAPRGSTQPARTIQARLAELQADNERSANVLAPQGFQMQAAAARAMARLCKQILGWVDAGVPLTLADSAKDPAFTEAEKHAEPRIYAHPQDYERREDGRVVRKDRWEWGLRNIVTVLHGPRHSFEIDEIVESVRALAERAKDPAEEAGAVISAYALDISPTTSIKIERVLNREGPAKWAVRLDGDCLSRQGEWEWEPMPSGRDDDFLAAALIPPRKRSSRPRKRWPPCSRRASTRLALQ
>NZ_LR594664.1|WP_162590549.1|322951_323638_-|DUF3850-domain-containing-protein
MNSTPPAAVPAQAPPARRIHELKTDPEVFQASWDGLKTFEIRVNDRDFQVGDSLYLLETEHTGEEMRAGAPLVYTGRTLRKVVSHVLTGYGLAPGWCCLSHTTQQAPAHPVDTTRDALGLLIDVYDAMGAPRGPARILAEEALRAAPAAGAPSTGTLNGPPVDEFEGPARALHDALCRASMIQCKHGWSFSGWTADGRAVRHRIRIEGYERTGPGVEKERAARTGVQA
>NZ_LR594664.1|WP_162590681.1|322412_322634_-|DUF1653-domain-containing-protein
MSERAPAPGVRCRHRKTGGIYERIGEARLQSSTPITDMATLVLYRGQDGALWVRPPAEFNERFEPLAKDEQKS
>NZ_LR594664.1|WP_162590548.1|321687_322416_-|hypothetical-protein
MTIATATPATLTPTRTPAAAPAPERAQLIDAAVKLIFDLLGMKPPPAELITPDTFGPMHAFVDEVQAIVSRSRGPLPEAAPAAPASSASLPIEPLWNRKGNVIHAAVDRLGAAQRAAAELADIPAVMPPGMAEPGTWVCDGARVAKVREVHAPTKHEPEGAYDLVIYARDGTRIGRESPAMGGPRGFEPFCSAENWQKIEEPRFPLDRYDYLKNLVKFKPPAGSSLEETGAVEGALHEAPRP
>NZ_LR594664.1|WP_162590547.1|321388_321691_-|hypothetical-protein
MSDRAVDEQLLLELTRRYEPTVVPACRRCGAPLEIVACGGGSPTRYACSTQTNTLLPADWKHYEASRWEDRRQGGDEGVMLLIAAYRALRTPPAAPAASE
>NZ_LR594664.1|WP_162590546.1|320582_321392_-|radical-SAM-protein
MTPASPAPAPSVHWRAAEFSGYRTGALDISLTARRIISVPTQLGCRIGCTFCVSGEGPLVRNLTSAEILHLAEEALRAAPPDGRPLELSFTGEGEPAMNWRQAAAVCEALLCISPDFDSVRYCFSGLGADRLLAKLDGGPFPTRLQLSLHAARQHVRDGLVGNSAPLPSIFAALELHEDRFTSIELNVVLQDGVNDSDEDLAALARWGSPAWPILLNPLLRDGAEVPGSRAEHIERGLRAAGRMVLRYREIGARISRGGIYPLMAARRR
>NZ_LR594664.1|WP_162590680.1|320402_320552_+|hypothetical-protein
MPDAPEAPDLDACCGNGCEPCIFDLHDMAMDRYRQALREWKARHPEAAG
>NZ_LR594664.1|WP_162590555.1|328018_328537_+|hypothetical-protein
MSAMRGMREAPARKPAPSILDAPVSLTHRMDDVKPARPMPLWPEQELDALQPSPASPGALGFSIKAEINQGSVDFRVSGKASAVTFEELEAACREQLPGVVLEHRTKWLQYTFDLWSHAGQCLYSIPHRQHRGAQAPSPASAQAAPAPGRTRAAPPSGIAREEPSPQAPGIT
>NZ_LR594664.1|WP_162590556.1|328533_328794_+|hypothetical-protein
MKTFIATVALSPWIAYHLLGLLAGEDAAWQFVSSSLWVGTPILVVVAALRAYGEGLQRGERRAKGYDDESHPDRPAFQTTQLGQLN
>NZ_LR594664.1|WP_162590557.1|328790_329390_+|hypothetical-protein
MTSAADLLSRHLFGCIPVAPTTPADAACTIRSMDGLPPLRRQRPGLHRHPATDITPAMRSLNCPSVRGAGVPEPGTQMKAEIAALWADALESGKYKRGARRLKDRLGRHSAVGVLCEVHRSLHPDMRGLQTEGASYLGESALLPRVVLAWAGLDLFASQGPEIAIKSKLTRQWRSFAVDVHDFMGASWPEIARALRSQI
>NZ_LR594664.1|WP_162590558.1|329407_329689_+|helix-turn-helix-domain-containing-protein
MKRRSSAAGLTGFIGFDAAWFGACLKQRRLNKSLTLQELAALTGFSVSSISEMENGQKPTFPKAAGVCQALGVRLSRVMLEAEQHADAARAAK
>NZ_LR594664.1|WP_162590559.1|329709_330225_+|hypothetical-protein
MVRDPLRTLALAEALTTGEFRGLEWAVSRARRDSDAYGTRPENALSAIRKLKQHMCAPRAEADLMSVKEQRGLAWAVERATKDADGYASEAHAARSAIAKLHDTIRFEQQARLGGHRDWAYKLEERQAASGHLGQVAMLAARETLGRRFEMRDLTSSSTPPRATAHSNALA
>NZ_LR594664.1|WP_162590560.1|330226_331048_+|hypothetical-protein
MGERTYPDLHRVYVDMDGVIADFEAAARAQGIAPAQLKLQRGAYLALQVIAGAKEALQDLAGMDVDLFVLTKIPSCNAYAATEKLLWIESHFPELHDRVIITSDKGCVGKQRDFLIDDHPEWANARQFPGTIITFTGDWPSVVEQIRIGLRIPQSMASALSASPSPTASVPAPAATTPPGPVPASPFRSGMWIAREDQLGRVRYVHPDGSLDIVLFAPDGRQIGRVTPPMGGPRGFEPNCHPDGWAQIEKPALPATRFAFLHDLVEPVDRLRA
>NZ_LR594664.1|WP_162590561.1|331097_331952_+|hypothetical-protein
MDYNALLKRFYTALLEAANPELMGAVHTFRADGVIGLDDIFLPGVSDGYGEAPLKVMVIGRERHYRYRAPRAEAPAANARPALSIREYVEHGMRRHEEVRTEIFVKDAHDSDLLGLLVSVAKAIKTEESPLGAGVVYANLFAVAFKGGDPRKTEAWPHIRDLSKALLDIQIDVLKPDVIVFANGIDSAPQRKLFFPHTPKKRSKGGEVVRCTNGVSWKATHGIEAGHLYGFKLDERIQCYRIHHPSSPSHRAKAAAARVVLLKLLKETLATRTAAFAQPASQEQ
>NZ_LR594664.1|WP_162590562.1|332018_332390_-|helicase-SNF2
MNTASKILSGFALAIVAAAGVHAETYHGVLKFESVKARAEVRADGAAAARADQFSDAAGQGVTQIASTVDRASVRSQGVVAAHSANPYAEGYGQGVTRVQSSADRASVRMQARAAARGDQPAI
>NZ_LR594664.1|WP_162590563.1|332612_333710_+|hypothetical-protein
MARTITNSSARSLPWLQNPLQAHKEWRATLSWSHAGDESNGDALYTEHSNNLYQSFWGKFCRWLAARSLKLDQVKQAHIEDFLASLRGRKNSPASVRTMRTYLAEIHRVFTHLEASEILRTNPAAVVLEGKRRKAESRLETDPPLPPGPTFLAAYEKMAARMFIEESDELRQGWTPARNLALRLLVAECGLKLSEVCKLIPRNISFMDDGTVVIRSPGHRQVAARTLVGKRRLAASLARWMEMRSQLRVVKSRRAIAEGSRASNRLFLGQVDIAPAGDVVAGGHGAARSPIAPDLAERVVTSCVKRTLEELGHQAAFHGPQFVRNAYAARLIHRGMNDADVSDQLGMKTTFTARAIREKLQLVQA
>NZ_LR594664.1|WP_162590564.1|333710_334484_+|hypothetical-protein
MLNQKNRHGATTQPPGHKGLDPVAVNAALHEAHCRIFTPAALAPFLGMPGRSGVFLPMATPAYCNSVGRIIVVGRAPKAWLNEVDLSATPTAEYVRRSAKAHLGVLLAKPGKHKFLQFLKCGSQRMGGVVGALGWCNLFATSHSRASPMSIARDFPDAYQAIKRLSRELLDAQLSILQPQVICFTTNPSLDQQLKCHFGERMGPITVENEGARLRFHLDGIPAWRINHPMHLAKLERKTALAEMISVAKAAATRETA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LR594664_1	1.1\|2420\|55\|NZ_LR594664\|CRISPRCasFinder	2420-2474	55	NZ_LR594664	Variovorax sp. RA8 plasmid 3	2420-2474	0	1.0
NZ_LR594664_2	2.1\|327897\|55\|NZ_LR594664\|CRISPRCasFinder	327897-327951	55	NZ_LR594664	Variovorax sp. RA8 plasmid 3	327897-327951	0	1.0

1. spacer 1.1|2420|55|NZ_LR594664|CRISPRCasFinder matches to NZ_LR594664 (Variovorax sp. RA8 plasmid 3) position: , mismatch: 0, identity: 1.0

ttaaagggcgccacctcttggtccagggccaatggctggtttcagagcgttcccc	CRISPR spacer
ttaaagggcgccacctcttggtccagggccaatggctggtttcagagcgttcccc	Protospacer
*******************************************************

2. spacer 2.1|327897|55|NZ_LR594664|CRISPRCasFinder matches to NZ_LR594664 (Variovorax sp. RA8 plasmid 3) position: , mismatch: 0, identity: 1.0

gtccttctcgctcccgtgatcgccgtggccacgctggtggtggcggtgcgcatgg	CRISPR spacer
gtccttctcgctcccgtgatcgccgtggccacgctggtggtggcggtgcgcatgg	Protospacer
*******************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

391963 : 398191

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162590622.1\|391963_393325_+	replicative DNA helicase	Q1MVI0	Enterobacteria_phage	2.1e-51	35.7
WP_162590623.1\|393321_393723_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_162590624.1\|393726_394029_+	hypothetical protein	NA	NA	NA	NA
WP_162590625.1\|394195_394744_-	hypothetical protein	NA	NA	NA	NA
WP_162590626.1\|394808_395135_-	hypothetical protein	NA	NA	NA	NA
WP_162590684.1\|395171_395426_-	GIY-YIG nuclease family protein	A0A068LKN9	Peridroma_alphabaculovirus	2.1e-05	39.7
WP_162590627.1\|395461_395722_-	hypothetical protein	Q855Z0	Mycobacterium_phage	3.2e-09	43.5
WP_162590685.1\|395718_396582_-	DNA/RNA non-specific endonuclease	A0A2H4N7Z3	Lake_Baikal_phage	4.1e-24	37.0
WP_162590628.1\|396650_397088_-	hypothetical protein	NA	NA	NA	NA
WP_162590686.1\|397084_397327_-	hypothetical protein	A0A0U1VYM8	Pseudomonas_phage	2.9e-12	60.7
WP_162590629.1\|397354_398191_-	class I SAM-dependent methyltransferase	A0A2K8I312	Pseudomonas_phage	2.5e-63	47.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LR594662

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_LR594664

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection