CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_LR594677	Variovorax sp. PBS-H4 plasmid 3	0 crisprs	NA	1
NZ_LR594675	Variovorax sp. PBS-H4 chromosome 1	4 crisprs	csa3,DEDDh,DinG,cas3,WYL	6
NZ_LR594676	Variovorax sp. PBS-H4 plasmid 2	0 crisprs	PD-DExK	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4045 : 29854

Bacillus_phage(33.33%)

integrase,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068682754.1\|4045_5611_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	4.9e-20	27.2
WP_068682756.1\|6052_6310_+	hypothetical protein	NA	NA	NA	NA
WP_068682758.1\|6319_8260_+\|integrase	tyrosine-type recombinase/integrase	A0A1D8EVX7	Mycobacterium_phage	8.6e-06	28.1
WP_146039730.1\|9306_10278_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.3e-39	37.5
WP_068685009.1\|10606_12145_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-45	35.8
WP_031652704.1\|12426_13233_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.1e-31	35.5
WP_063599743.1\|13222_14788_-\|transposase	IS21-like element ISPpn1 family transposase	A0A2L1IVA1	Escherichia_phage	9.0e-14	26.4
WP_146039730.1\|15118_16090_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.3e-39	37.5
WP_102906381.1\|16166_16376_-	hypothetical protein	NA	NA	NA	NA
WP_068685915.1\|17082_17541_-	hypothetical protein	NA	NA	NA	NA
WP_157103529.1\|17540_17717_-	hypothetical protein	NA	NA	NA	NA
WP_003158660.1\|17942_20858_-\|transposase	Tn3-like element IS1071 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-52	24.0
WP_159597438.1\|20976_21624_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068673263.1\|22126_22873_+	hypothetical protein	NA	NA	NA	NA
WP_159597437.1\|23256_24204_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_162584082.1\|24505_24811_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_068673269.1\|24824_25160_+	hypothetical protein	NA	NA	NA	NA
WP_068673271.1\|25169_26249_+	maleylacetate reductase	NA	NA	NA	NA
WP_068673272.1\|26250_27429_+	muconate cycloisomerase family protein	NA	NA	NA	NA
WP_068673274.1\|27421_28120_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_083944095.1\|28571_28880_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068673276.1\|28925_29432_-	hypothetical protein	NA	NA	NA	NA
WP_159597436.1\|29449_29854_-\|transposase	transposase	A0A218MNE7	uncultured_virus	3.1e-27	43.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_LR594675

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LR594675_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594675_1

3023690-3023802

Orphan

Consensus_repeat	Method
TCGCGCCTTCGGGCGGCCGAGCGGCTCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594675_1

>merge|NZ_LR594675|1|3023690-3023802|CRISPRCasFinder
TCGCGCCTTCGGGCGGCCGAGCGGCTCTCGATAGCGCCCCCACGCTTGTCACTTCGTGTACTGCGCTGCCCCCCGAGGGGGCTTTCGCGCCTTCGGGCGGCCGGGCGGCTCTC

>NZ_LR594675|1|1|3023690-3023802|CRISPRCasFinder
TCGCGCCTTCGGGCGGCCGAGCGGCTCTC	GATAGCGCCCCCACGCTTGTCACTTCGTGTACTGCGCTGCCCCCCGAGGGGGCTT
TCGCGCCTTCGGGCGGCCGGGCGGCTCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594675.1\|WP_162580428.1\|3013331_3015971_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|225461
NZ_LR594675.1\|WP_162580440.1\|3036969_3038178_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380553
NZ_LR594675.1\|WP_162580441.1\|3038174_3039236_+\|xylose-isomerase	unknown	unknown	gnl\|CDD\|366542
NZ_LR594675.1\|WP_162580438.1\|3032345_3035717_+\|error-prone-DNA-polymerase	unknown	unknown	gnl\|CDD\|235553
NZ_LR594675.1\|WP_162580431.1\|3019838_3021389_-\|phospholipase-D-family-protein	unknown	unknown	gnl\|CDD\|197212
NZ_LR594675.1\|WP_162580426.1\|3007897_3010546_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225461
NZ_LR594675.1\|WP_162580432.1\|3022188_3023634_-\|DUF3482-domain-containing-protein	unknown	unknown	gnl\|CDD\|371831
NZ_LR594675.1\|WP_162580429.1\|3016048_3018694_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225461
NZ_LR594675.1\|WP_162583720.1\|3028366_3029233_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|184875
NZ_LR594675.1\|WP_162580430.1\|3018826_3019801_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_LR594675.1\|WP_162580436.1\|3030154_3031021_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380271
NZ_LR594675.1\|WP_162580424.1\|3005895_3006219_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|338835
NZ_LR594675.1\|WP_162580434.1\|3027496_3028330_+\|dioxygenase	unknown	unknown	gnl\|CDD\|153375
NZ_LR594675.1\|WP_162580439.1\|3035887_3036907_+\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239608
NZ_LR594675.1\|WP_162580425.1\|3007221_3007836_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_LR594675.1\|WP_162580435.1\|3029236_3030067_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381321
NZ_LR594675.1\|WP_162580427.1\|3010603_3013255_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225461
NZ_LR594675.1\|WP_162580433.1\|3025387_3027361_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_LR594675.1\|WP_162580437.1\|3031036_3032353_+\|DNA-polymerase-Y-family-protein	unknown	unknown	gnl\|CDD\|176458
NZ_LR594675.1\|WP_162583718.1\|3006223_3007195_-\|DnaJ-domain-containing-protein	unknown	unknown	gnl\|CDD\|182347

Protein	Function_ID	Function_description	E-value
NZ_LR594675.1\|WP_162580428.1\|3013331_3015971_-\|AAA-family-ATPase	gnl\|CDD\|225461	COG2909, MalT, ATP-dependent transcriptional regulator [Transcription].	4.41922e-56
NZ_LR594675.1\|WP_162580440.1\|3036969_3038178_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380553	cd06330, PBP1_As_SBP-like, periplasmic substrate-binding domain of active transport proteins. Periplasmic substrate-binding domain of active transport proteins found in bacteria and Archaea that is predicted to be involved in the efflux of toxic compounds. Members of this subgroup include proteins from Herminiimonas arsenicoxydans, which is resistant to arsenic (As) and various heavy metals such as cadmium and zinc. Moreover, they show significant sequence similarity to the cluster of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa.	9.80895e-128
NZ_LR594675.1\|WP_162580441.1\|3038174_3039236_+\|xylose-isomerase	gnl\|CDD\|366542	pfam01261, AP_endonuc_2, Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae.	0.000356077
NZ_LR594675.1\|WP_162580438.1\|3032345_3035717_+\|error-prone-DNA-polymerase	gnl\|CDD\|235553	PRK05672, dnaE2, error-prone DNA polymerase; Validated.	0
NZ_LR594675.1\|WP_162580431.1\|3019838_3021389_-\|phospholipase-D-family-protein	gnl\|CDD\|197212	cd09113, PLDc_ymdC_like_2, Putative catalytic domain, repeat 2, of Escherichia coli uncharacterized protein ymdC and similar proteins. Putative catalytic domain, repeat 2, of Escherichia coli uncharacterized protein ymdC and similar proteins. In Escherichia coli, there are two genes, f413 (ybhO) and o493 (ymdC), which are homologous to gene cls that encodes the Escherichia coli cardiolipin (CL) synthase. The prototype of this subfamily is an uncharacterized protein ymdC specified by the o493 (ymdC) gene. Although the functional characterization of ymdC and similar proteins remains unknown, members of this subfamily show high sequence homology to bacterial CL synthases, which catalyze the reversible phosphatidyl group transfer between two phosphatidylglycerol molecules to form CL and glycerol. Moreover, ymdC and its similar proteins contain two HKD motifs (H-x-K-x(4)-D, where x represents any amino acid residue) that characteriszes the phospholipase D (PLD) superfamily. The two motifs may be part of the active site and may be involved in phosphatidyl group transfer.	1.36791e-96
NZ_LR594675.1\|WP_162580426.1\|3007897_3010546_-\|hypothetical-protein	gnl\|CDD\|225461	COG2909, MalT, ATP-dependent transcriptional regulator [Transcription].	7.24084e-57
NZ_LR594675.1\|WP_162580432.1\|3022188_3023634_-\|DUF3482-domain-containing-protein	gnl\|CDD\|371831	pfam11981, DUF3482, Domain of unknown function (DUF3482). This presumed domain is functionally uncharacterized. This domain is found in bacteria and eukaryotes. This domain is typically between 289 to 301 amino acids in length. This domain is found associated with pfam01926. The central region of these proteins contains a hydrophobic region that is similar to pfam05433.	2.88047e-69
NZ_LR594675.1\|WP_162580429.1\|3016048_3018694_-\|hypothetical-protein	gnl\|CDD\|225461	COG2909, MalT, ATP-dependent transcriptional regulator [Transcription].	1.24424e-52
NZ_LR594675.1\|WP_162583720.1\|3028366_3029233_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|184875	PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional.	1.19502e-23
NZ_LR594675.1\|WP_162580430.1\|3018826_3019801_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	3.98345e-111
NZ_LR594675.1\|WP_162580436.1\|3030154_3031021_+\|hypothetical-protein	gnl\|CDD\|380271	NF033429, ImuA_translesion, translesion DNA synthesis-associated protein ImuA. A three-gene cassette encoding ImuA, ImuB, and ImuC (""inducible mutagenesis"") is induced by DNA damage, is capable of DNA synthesis across DNA damage lesions, and consequently is associated with mutagenesis. This family, ImuA (previously misnamed SulA in Pseudomonas putida) shows some homology to SulA itself and to RecA. ImuB resembles Y-family polymerases but may be catalytically inactive. ImuC is a C-family polymerase, and catalytically active.	1.96815e-58
NZ_LR594675.1\|WP_162580424.1\|3005895_3006219_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|338835	pfam13591, MerR_2, MerR HTH family regulatory protein.	9.46284e-12
NZ_LR594675.1\|WP_162580434.1\|3027496_3028330_+\|dioxygenase	gnl\|CDD\|153375	cd07363, 45_DOPA_Dioxygenase, The Class III extradiol dioxygenase, 4,5-DOPA Dioxygenase, catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine. This subfamily is composed of plant 4,5-DOPA Dioxygenase, the uncharacterized Escherichia coli protein Jw3007, and similar proteins. 4,5-DOPA Dioxygenase catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine (4,5-DOPA). The reaction results in the opening of the cyclic ring between carbons 4 and 5 and producing an unstable seco-DOPA that rearranges to betalamic acid. 4,5-DOPA Dioxygenase is a key enzyme in the biosynthetic pathway of the plant pigment betalain. Homologs of DODA are present not only in betalain-producing plants but also in bacteria and archaea. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.	1.2937e-115
NZ_LR594675.1\|WP_162580439.1\|3035887_3036907_+\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239608	cd03532, Rieske_RO_Alpha_VanA_DdmC, Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Vanillate-O-demethylase is a heterodimeric enzyme consisting of a terminal oxygenase (VanA) and reductase (VanB) components. This enzyme reductively catalyzes the conversion of vanillate into protocatechuate and formaldehyde. Protocatechuate and vanillate are important intermediate metabolites in the degradation pathway of lignin-derived compounds such as ferulic acid and vanillin by soil microbes. DDmC is the oxygenase component of a three-component dicamba O-demethylase found in Pseudomonas maltophila, that catalyzes the conversion of a widely used herbicide called herbicide dicamba (2-methoxy-3,6-dichlorobenzoic acid) to DCSA (3,6-dichlorosalicylic acid).	3.76296e-47
NZ_LR594675.1\|WP_162580425.1\|3007221_3007836_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	3.04189e-39
NZ_LR594675.1\|WP_162580435.1\|3029236_3030067_-\|aldo/keto-reductase	gnl\|CDD\|381321	cd19095, AKR_PA4992-like, Pseudomona aeruginosa PA4992 and similar proteins. Pseudomona aeruginosa PA4992 is the prototype of this family. It is a putative aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NAD(P)H as a hydride donor.	6.2124e-88
NZ_LR594675.1\|WP_162580427.1\|3010603_3013255_-\|hypothetical-protein	gnl\|CDD\|225461	COG2909, MalT, ATP-dependent transcriptional regulator [Transcription].	1.15942e-58
NZ_LR594675.1\|WP_162580433.1\|3025387_3027361_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	5.76628e-154
NZ_LR594675.1\|WP_162580437.1\|3031036_3032353_+\|DNA-polymerase-Y-family-protein	gnl\|CDD\|176458	cd03468, PolY_like, DNA Polymerase Y-family. Y-family DNA polymerases are a specialized subset of polymerases that facilitate translesion synthesis (TLS), a process that allows the bypass of a variety of DNA lesions. Unlike replicative polymerases, TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. The active sites of TLS polymerases are large and flexible to allow the accomodation of distorted bases. Expression of Y-family polymerases is often induced by DNA damage and is believed to be highly regulated. TLS is likely induced by the monoubiquitination of the replication clamp PCNA, which provides a scaffold for TLS polymerases to bind in order to access the lesion. Because of their high error rates, TLS polymerases are potential targets for cancer treatment and prevention.	3.56268e-24
NZ_LR594675.1\|WP_162583718.1\|3006223_3007195_-\|DnaJ-domain-containing-protein	gnl\|CDD\|182347	PRK10266, PRK10266, curved DNA-binding protein.	2.31825e-81

>NZ_LR594675.1|WP_162580432.1|3022188_3023634_-|DUF3482-domain-containing-protein
MSVQDAIRIAVVGHTNAGKTSLLRTLTRRVNFGEVSGQPGTTRHVEAIELQVDGRAAVRFLDTPGLEDAVALREHIDALDPRGELTPPERIRRFLAGPEAHGVFEQEAKVLRALLEVDAAFLVIDAREPVLPKFRAEIELLGACARPLLPVMNFLRDAGSREDAWKALLPAYGLHVVVRFDAAAPFVGAERELYRDLATLLRERRTQLERINAFLEEESGRRREAAGERIAELLVDAAAMRRTASAVEFEIASSRERLVAALQKAVFDKAQRCASDLLALYGFRENDADEAPLPLLEGRWTMDFFHPEALKDAGILLGKGVAVGAAVGVVADLALAGLSLGAGAALGGAIGGALSQGFGPLGRKLANKLRDVHELTVEDRVLVVLAAWQLRLLRALEQRGHAAVDRIAAPAPADAPMDDLEAARRPLAELVRAAQPARSHPDWDSEARLRWREAPQRRDLVLRVARQVPPAIEAFAKNHLQ
>NZ_LR594675.1|WP_162580431.1|3019838_3021389_-|phospholipase-D-family-protein
MRSLRAFLALSLTFLVLGCATLPATVQRPPSFALTSTDDTFLGHALAPELAAHPGLTGILPLIDAREAFAARMALAQTAQRSLDMQYYIWRGDTTGQLLFEAAWAAAERGVRVRLLIDDNNTSGLDGTLAVLDAHPNLEVRLFNPFANRGLRAGDFALDFSRVNRRMHNKSFTADNQAAIVGGRNVGDEYYGADQLLGFEDLDVVTVGPVVREVSRQFDLYWNSDAAYPASALLGKASSDAAARLLAQWDSLRQQPHTQDYLEAVRQTPLMREAAARRLPFEWADAHVVSDLPAKVRAASGREQQLMFPLLKQAMGEPRHALDLVSPYFVPGTDGAQELAALARRGVAVRVLTNSLAATDVAAVHAGYARYRKELLDAGVVLYELKPGAAPPPRPDEEKRRNPGGSSAASLHAKTFAVDRSRIFVGSLNLDPRSVHLNTEMGVVIDSPELARRLAVEIDHAVPTQAFEVRLPVGGGMEWIDRAPDGETRYRSEPDTGGLRRLWVDFLSLLPIEWLL
>NZ_LR594675.1|WP_162580430.1|3018826_3019801_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRRRIFLASATATPVFLSVWPTRADDYPVRSVRLVVPFGPGGVADLTARAVGRILGQRLGQSLVVDNRPGAGGVAAGETVAKAAPDGYTLLLLSNATAVSRGLFKHLPFDARKDFAPISLLSRYDLAFIVPGLSSFESLQAWLLAARQRPGELNVGTVNVGSTQHLAAELFRLSAHVDLQVVPFNGTPAVLTALRSGQIDAAVESLPPIMAHIRAQSIRPLAVLGETRSPPLPQVPTVAQGAGIEGFNVSSWTALAAPVKTPRDILARLAREVRELMELAEVKKELADLNVQARASTPEQLATLLDSEITRWGEVIARAGIPRQ
>NZ_LR594675.1|WP_162580429.1|3016048_3018694_-|hypothetical-protein
MPSTSLARAKIQAPRFRGGLIQREDLEQQLGDAMTSRRLVLLVAPAGYGKTAALSRQVQRLPAGCAAAWFTADEEDDLERLLSHLIEALEPLDPPWRLAPEALLELVAQGRLRETASALLGALEATDTANGVIVLDDLHAVADARVFEFLGHLLEGLPQNWTLVIATRVEPPLALGRWRARREIAEFDETALSFSRQEVRDLWRHATGHDDPERAERLLDRTQGWAAGLCLGLETSEGSAATAPKGVWHNRRHLFEYLASEVLEQLPGELQAFLLRCSLLAELTVPRCEQISGNPRAARLLEDIERRRLFVSVLDSEELTMRLHDLFRDFLEERLRRLHPEEVPGLLRLAAQGETDPVRRTLMYLRAGAWQEAQQGLADATADMLASDASAQVSRIIEQFPADIQAQSPLLAYARGLCAWPHYQYDAVRLAMGHAAAGFETMGRHNDAQRARAMQALATFFCGHMADARQLSQAVRAGPMDLETETLSELLDCWYEAYHGPVDGPGSRLAKVVDLLLQGGSAELWFRCQTRVNMLISRPGVTAQIQRLVHGARAAAGDGYWSLQANANLTEAWLFLWQGKTVELEGALQKIEDDSHWLGQPPGLRIRLLTLKVMYQLICDDRNAVRTTRDAIAAHAALLERSGEMALGYLAVAVRASAAIEDWPAVRMHLPAFNVDVGRENSSLQMFLSTFKAQLALQDGRVDEALATLRELATRSTVFDTNSLDATVRTRLALAELAHGSPAAAWRALEPLIERVSASGDVGQVLVTGLHGLTELSLAPWGDAASKEGLASLRRWVEIARRFKDGSQAQPRGSAVQDGGLSARELQVLALLAEGRSNKLIARALDLSPHTVKRHVARILDRLDLASRMQAAEWYAKRFGR
>NZ_LR594675.1|WP_162580428.1|3013331_3015971_-|AAA-family-ATPase
MQSASLARAKIQTPHFRSSLIERGELEQRLGEALASRRLVLLVAPAGYGKTAALSRQLQRLPAGSAVAWLTADEDDDLQRLLAHLIEALEPLDPPWRLAPEALLTLVDQGRLREAVPALLNTLEATDTPGGGVLVLDDLHAVADARVFEFLNHLLDGLPPNWTLVIASRVEPPLALGRWRAQREVAEFDEAALAFSRREVRDLWRHATGSDDPEHADRLHDRTQGWAAGLSLSLEASPQSAVTEPKGIRHSRRRLFEYLASEVLEQLPGELQAFLLRCSLLPELTVARCEQISGNPRAAELLDDIGRRRLFSSVLDSEELTLRLHDLFRDFLEERLRRVYPEEIPALLRRAAQGEIDPLRRTLMYLRAGAWEQAEQSLADGTAEMLADDRSAQILRIVEQFPADIQSRSPSLAYARGLCAWPRYQYATARSNMEHAAAGFDALGLHHDAQHARAMQALAMIFCGQMQAAKRLGQAIRSRPMDLETETLSEVLDFWYEGHHGPIEGPGHRLARIVALLTRGASAELWFRCMALFNIFLGRPGVSAQLQRLLRGARAAAGEAHWSLHVMEAWVLLWQGRIAELGTVLQDIEEDSRWLGEPSGLRIRLATLKVMYQIARDDMDNLRATRDVIATHASLLDRSSDMYLAVLGILVKACVALDDWPSVRTYMRSFNVEAGRENPGTQMLIDSFEAQLALHDGRVSEALTMLRRLVTRSSTLDTVYLDVTVRTQLALAELADGSPEAAWQALEPLVEQVVASGNVGQVLIVGIHVLTQLSLASWNGAAPKAGLAVLREWAETARQLKAGAQEQPRSSAAQAHAGLSPRELEVLALLAQGQSNKLIAKVLELSPHTVKRHVARILDRLDVDSRMQAARWYHTHVGG
>NZ_LR594675.1|WP_162580427.1|3010603_3013255_-|hypothetical-protein
MQSASLARSKIQAPRYRRGLIERGELEQRLGNALAHRRLVLLVAPAGYGKTAALSRQLQRLPAGCAVVWLTADADDDLQRLLAHLIEALEPLDPPWRLAPEALFERVAQGQLRETASALLGTLEVTDLPGGGVIVLDDLHAIADARVFTFLGHLLEGLPPNWTLVISSRVEPPLALARWRARREVAEFDQTALSFSKKEVQDLWRHATGREDAEQADRMLDQTQGWAAGLSLSLEASQRSTATAPAGTWHNRRHLFEYLASEVFEQLPGELQAFLLRCSLLPELTVPRCEQISGNPRAARLLEDIERRRLFSLVLDGEELTLRLHDLFRDFLEERLRRQHPDEVPMLLRRAAQGEADLLRRTTMYLRAGAWDEAEQTLAEATADLLASDKGARVIGLIEQFPADIQARSPMRDYLRGWCAWPRYQYSAVRSHMAQAAAGFEAQGRQRDAQRARAMQALAMFFCAHMAEARHLSQAVRSRPMDLETETLTELFDFWDEGHHGPIDGPGNHLAKVIDLLEQGAHAELWFRCMPRVNMFSSRPRVSEQIRRMVNGARAATGEGQWSLQVDANLMDAWLHLWHGRLAELEAAFQKIEEDAQWLGQPVGLHVRLLTLRVNYQLICDDTDAVRKTRDIMAARAALLDASSDLPLQYLSIVVRASAAIADWPGVRTHLPSLAVQVGHESPCMRMFLRCIEARLAFQEGRTDEALEALRELAEKSTAFDTSFLDAMVRTWLALAELADGSPAAAWRALEPLIEGVVSSGSPGQVLVTGARGLNELLQASWKGHASTRGLATLREWTEVAGCFKAGAQKKQHDPAGPQTASLSTRELEVLALLAEGQSNKLIARALDLSPHTVKRHVARILDRLDLASRMQAANWYRTRFAG
>NZ_LR594675.1|WP_162580426.1|3007897_3010546_-|hypothetical-protein
MQPVSHASAKIQTPHFRGGLIERYELEEQLGEALANRRLVLLVAAAGYGKTAALSRQLQRRPAGSALAWLTADEDDDLHRLLSHLIEALEPLDPPWRLAPEALLTLVDQGRLRDAVPALLNTLEATDTPGGGVLVLDDLHAVADARVFEFLNHLLDGLPPNWTLVIASRVEPPLALGRWRARREVAEFDEAALAFSVKEVQDLFRHATGSDGPEEARRLHDRTQGWAAGLSLSLAASGKSAATAPAGLRHDRRYLFEYLATEVLEELPGELQEFLLRCSLLSELTQVRCQQISGDPRAAQWLDEIGRRRLFSSVLEGEELTLRLHDLFRDFLEQRLRRVYPAEVPTLLRRAAQGEADPLRRTLTYLRAGAWDEAEQSLADATPDMLARDEGAQVIRLIEQFPPDIQASSPLLAYVRGWCAWPRYEYATARSHMANAADGFDELGRHDDAQRARAMQALAMFFCGFTDDALSLSQVVRAGRMDLETETLSELLSFWYEGYHGPADGPGQRLAKVIDMLERGGSAELWFRCMNRVNTFISRTGVSAQLQRMVNGARAAAGEGRWSLQATANLMEAWLLLWQGKVSETEAALQRIEEDSRWLGQPAGLRLRLLSLKAMYQVTCDERELVRETCKAMVAALSLLDRSSHLPLVYLIVIIVASASIEDWPTVRTNLPVLRRAVGNEKPDVQMLIHSFDAQLAFQDGRIGEALTGLRALVVSSAVLDTLFVDGTVRTRLALAELADGSPGAAWRALAPLIERIRTSGNVGQALFMGAQVLTKLSLAAWGNAATEEGLKILHHWRETARQFKAGAQEELAVAATGRDAGLTGRELEVLALLTQGQSNKLIARSLDLSPHTIKRHVASILDRLDMASRMQAANWYSARFS
>NZ_LR594675.1|WP_162580425.1|3007221_3007836_-|histidine-phosphatase-family-protein
MNNGLARLIELAKAQPLAPACDHFYFLRHGQTEGNAQRIFQAVDTPLSTLGLTQAARAAERLAGEPIRSVVCSDARRASDTARTVAAGLGKVPQHFDSLRERDFGALIGTSSAELDWSCEPEGGETLPQFVTRKRAALEAALAHPAPVLIVAHGGSLHVLVAALGIAADPNVLGNAQPLYFGRSGPTWAVRPLLHHSDGGAALA
>NZ_LR594675.1|WP_162583718.1|3006223_3007195_-|DnaJ-domain-containing-protein
MDFKDYYQALGVERNATEEDIRKAYRKLARKYHPDVSKEPDADRRMREINEANDVLRDKEKRAAYDALADQVASGRSAGARPGEGFQPPPGWDEGFEFHRGPGQGPADHAEFSEFFSSLFGAAERRSAQRRQYRARGEDHHAAIEIALEDALKGAEREITLRSQELDDQGQPQWKTRTLAVKIPPGVHPGQYIRLAGQGMPGHGGEPAGDLYLEVRLAPHKLYRVEGRDLYMTLPVTPTEAALGAQVKVPTPGGGVVEVTVPPNARNGLKLRLKGRGLAGQQAGDLYLLLEIALPPAQTEVARKAYEQLAQAAPFDPRRHLGV
>NZ_LR594675.1|WP_162580424.1|3005895_3006219_-|MerR-family-transcriptional-regulator
MPGPSFDTLPLGNAHPLRAGELAHACGAEITWVIQLVEIGIIEVRGPAEGPDDWCFHSADLQRALDARRLERDFGVGLDAAALILDLEHEVRRLKALLAARGLGREI
>NZ_LR594675.1|WP_162580433.1|3025387_3027361_-|ATP-binding-cassette-domain-containing-protein
MFTYFEKRLDPYPAAEPRLPPNGFFAFLWACTEGLRGKILAMALLTAAMSAFEALLFAMLGRIVDWLGNQVPARLWEERGTTLMWLGIALAASIAVVALQTIVKHQTLAVNLPMRLRWNFHRLMLGQSMAFYQDEFAGRITAKVMQTALAVRETVFVLADVLVAMGVYVATMIVLAAVLDRQLMLPFAIWLVLYVAMLFFFVPRLGKIGKAQADARAMMTGRITDAYTNIATVKLFSHAHREAGFARAAMQDFMATGYGQMRLVSAFEIANHTLSMGLTAGMAGMGLWLWSQGAVGVGAVAAATAMALRLQGMSHWIMWEMTSLFENIGTVQDGMKTLSRPRTVLDAPDAATLAVPRGEVRFEHVSFRYGLDPGEGGRRVIDDLTLTVAPGEKIGLVGRSGAGKSTLVNLLLRFHDLESGRILIDGQDIAHVTQDSLRAHIGMVTQDTSLLHRSVSDNIAYGQPDASAAAIRGAAERAEAHDFVQALGDPNGRRGYEAHVGERGVKLSGGQRQRIAIARVMLKDAPILLLDEATSALDSEVEAAIQASLYRLMEGKTVIAIAHRLSTIAAMDRLIVLDQGRVVEQGDHHTLLARGGLYARLWAHQSGGFLGEDDDEDDGVGPGLPGESYSARRTVTTTRQPVAGKLELSSTQEEPAP
>NZ_LR594675.1|WP_162580434.1|3027496_3028330_+|dioxygenase
MTTTPLTLPTYFISHGGGPWPWMKKEMGNAYAQLEAALADMPRQIGRKPEAILMVSAHWEEPAFTVMGNPRPPMIYDYGGFPEHTYSVHYDAPGSPALARRVQGLVEAAGLPAAFDAERGFDHGMFSPMAAIYPDADVPAVQLSLRRGLDPAEHVALGRALAPLRDENVLIVGSGLSYHNLRNFGPQAHEPSKAFDDWLADTVDADPTRRTERLLAWSQAPAARIAHPREEHLIPLMVAVGAAGQDAGVRIYHEDAFMGGIAVSSYRFGAAAGDSAA
>NZ_LR594675.1|WP_162583720.1|3028366_3029233_+|alpha/beta-fold-hydrolase
MFDPAADASAHRLIARLDALSTHHDVLHAGRRVRWRRFGEDNDQRPPLVLLHGGHGSWMHWLRNIEPLCAARAVWLPDMPGFNDSDTPPQPGAGQAPLDPALDALVGSLAALIGADAPIDLAGFSFGGLVASKFALRLGHVHRLALLGSAGHGTKRRMDVQMINWREAKDRLEERSALLHNLRALMLHDPAAIDALAFAIHDLSCHGTRFRSKEVSMAGGLQAALDAFAGPTLLLWGEHDVTADSRALVAQLVAGRPQCEGVVIDDAGHWVQYEQAMEINALLLRFFA
>NZ_LR594675.1|WP_162580435.1|3029236_3030067_-|aldo/keto-reductase
MDTVITRPIPSTREALPVIGCGTWIGFDVSPGSPEHQRLPGVLDALFAAGGTLIDSSPMYGRAETVVGALLAASGQRDKAFLATKVWTSGREAGIAQMEQSFQRLRTERIDLLQVHNLVDWRTHLATLRDWKAQGRVRYIGITHYTASAYAEVEAVLRAEPLDFLQINYSIDARQAEERLLPLAAERGVAVIANMPFGGGGLLRRLRALPLPGWAAEIGCASWAQLLLKFVLSHPAVTCTIPGTSRAEHMADNAAAATGSFPDAGFWQRHGASLPL
>NZ_LR594675.1|WP_162580436.1|3030154_3031021_+|hypothetical-protein
MGLPSFDSFSTAARHKVWRGDTLGLADGQVIGTGHAALDAELPGGGWPVGAMTELLQSAPEAHAWQLLLPALAQAVQGGAGPVVLVGAPQEPFGPALAAQGLPVEALLWVRSEAPPAAGPPQGRRGPLGGQRGHAVPSVGAHVARLWACEQALRCAEVAAVLAWLPQARVGELRRLQLAAAQHDRLLFVFRPDAAAAHSASPARLRLRLATCTTDSTQVDVHILKRRGPPLAAPLQLPARNQRMTALLAAGQLRRKLRQQQEGRLPPKAEGAEGATVVRLDLHPELVH
>NZ_LR594675.1|WP_162580437.1|3031036_3032353_+|DNA-polymerase-Y-family-protein
MHWIALRWPPEAAAAKEVPLPSPEALGWWALQFTPRVAWIDGEALLLEVSACERLWGGRLALMREIARLNPVPDVPVQRAQGATSLVALARLRMFARGEQPPQELPSGLPLETLSAAREHLAVLSHLGCRSWGDVEKLPRGGLVRRFGKALRAALDVAYGLAPDSHDWLQLPDVFEQKLELPALAEGAPQLMWSANRLLAALQIWLRARQRGVLALELQWTLDLKRLDGVALPPHQQVTVRTAEPTQDMAHLRRLLSERLALTALAAPASWLRLRSIETAPWAGASTSFLPEDNRKGDKLHELVERLSARLGPQQVLRAVARADHRPECRQAWQPALHKLPAEAGPPEAADAIYPPWLLREPLLLDMDGERPCYQGPLRKLIGPQRVETGWWGEGQPAVRDYYIAQSPGAGLVWIYRERPSSCFTSDTPRWYLQGLYA
>NZ_LR594675.1|WP_162580438.1|3032345_3035717_+|error-prone-DNA-polymerase
MPELSDKQIQKRTRASATVHALPPRLPQPDAGPPMPRGLPSYAELHCLTNFSFQRGASHPEELVQRAYELGYEALAITDECSVAGVVRAFEGLRELLETLDPSQRHPFRLLFGSEFRFERFKLVAIAHDLEGWGNLCEFITAARITAPKGTYEVSWEGSDLASLRHCEILFVPLRTPGAAPDAEALRADVAEAARLFEGHLWIAAELPNELDDDLWLITLLQAGAQAGVPLVAAGDVHMHVRSRKPLQDVITAVREGRAVAGCGFALQSNAERHLRSRLRLSNLYPAELLANTLEVARRCTFDLNVIREHYKYPLENVANGETPVQTLVRKTWEGAREKYPQGVPDKVQAQIRHELDLIAEMHYEMFFLTVEDIVRFARSRNILCQGRGSSANSAVCFCLGITAIDPETGNLLFERFLSRERREPPDIDVDFEHQRREEVIQYIYEKYGRERAAIAAVVICYRSRSAVRDVGKALGIDARLVDEFAKDHYWFDGVVLDQRLEEAMQRSGVQEDMPRLLQWIELTQQLRGFPRHLSQHVGGFVLTQSKLTRLVPVENASMKDRSVIQWEKDDLEAMGMLKVDVLALGMLSAIRRALALVNSWRGTALQMHQIPNDDEAVFDMICDADTVGVFQIESRAQMSMLPRLKPRCYYDLVIEVAIVRPGPIQGGMVHPYLKNREKLHKDGEIVYRYPDLIPALGRTLGVPIFQEQVMQIAMIAAKFTPDQADRLRRSMAAWKRKGGVEKFHEPLVDGMIGNGYDREFAEAIFKQVQGFGEYGFPESHAASFALLVIVSSWLKLHEPACFLAAMLDSQPMGFYSPSQLVQDARRHGVEVRAVDVTASELDCTLEAPVLAPSSSDGRLGWGQQPPQAIPPHFATRLGRPRQPAVRLGLRRITSLSEAGAKRVVEARAQAPFTSTEDLALRAELDAKDMAALAAADALLALSGHRRQQVWDATAQRRAPALLKGVPIHERALQLPLAPEGEEIVGDYASLGFTLRRHPLALLRPRLARMKLSSAEQLRDLPSGRTVRACGMVMGRQRPQTANDTIFVTLEDETGNVNVIVWKHVVEAWREQVLKSQLLAVQGTWQRDVDSGGEVRHLVATGFRDLTPLLGRLGKSSKSRDFH
>NZ_LR594675.1|WP_162580439.1|3035887_3036907_+|Rieske-2Fe-2S-domain-containing-protein
MTPFAYNAWYPLAWSRDIGREIVARRVLEEDLAVYRTEAGVVAALEDACPHRLAPLTIGWLQGDAIQCAYHGLTFDCSGRCVHAPGMPRVPESFRVRSYPTAESMGMVWVWMGDAEKADRSQVFHLPQYDDPAYSVVEGDALLVQANYLSLADNLCDPTHVVYVHQTTLASAGREETRVQHERQGNKVVTWRWVLDGPLIPIFEGLKDFGGNVDRWHYYHYHAPSIAVIDFGSARTGTGAPEGNRDDCIQMYACHFITPIDQRSCVQHWLCLKNSPADPVVDERLRSNLRMAFNEDKRVLEAIQRNEDKPRQWHRINLALDGSSIKMRRIVEELASGNG
>NZ_LR594675.1|WP_162580440.1|3036969_3038178_+|ABC-transporter-substrate-binding-protein
MKLVLSVSARLLAAASLCLAGAHAAAQGTIKIGEINSYKALPQNLVPYKQGWMLAQEEINAAGGVLGKKLETVFRDDNGNPGDAVRMAEELLAREKVDILSGVTLSHVGLALTDFAKQKKFFFLASGPLSDKVVWDNGNRYTYRLRSGTYALATSVIGEAVKLKKKRWALVYPNYEYGQAAVAAFKENMKKAQPDVEFVAEQSPPLGKIDAGAVVQALADAKPDAIFNVMFGSDLTKLAREGKTRGLFEGREVVSLLTGEPEYLDPLKDDAPANWIVTGYPYASIDTPEHKAFLAAYQKKYNDYPRLNSVVGYATVKAIAAGVQKAGSTDTEKLIAAFKGLQFDSPFGPVVFRPQDNQSTLGIFVGRTAVKDGKGVMPSGTYLDGAKLQPAEEQIRKLRNPS
>NZ_LR594675.1|WP_162580441.1|3038174_3039236_+|xylose-isomerase
MTGATLPPIGCNGRGAQASSLERPVSLAEPPVEEQFRLVRESGAFDCFDRLPMPGQVDTYLRCIERFGLPVHTASWFYALGRDEALLADKLQLAAEVGARTHNIMLHWHDATGRPIGNDEVIDFYLRAYDEGMARGVEPAFEFHVNMWSEDPRRVAPVAEAVRRRGVPFHFTLDYSHAIFKIGNAQELAICGLTEDVASGRAVLDPFKPGNFVDQWLEMGIVRWLQVRSVAPNGPRNRWSLGDSGEAVAAVPEHSIFPYARGEPGRGILYPFTEPAPGEWHSPWDPGALACTREVVRKVLAYHCTHEESPLRWITTEMINLPDYAHNARFSLIGQNAAIARFVREQWAALAPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594675_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594675_2

3391843-3391988

Orphan

Consensus_repeat	Method
CCCCCTTCCGGGGGCAACACCAGCGGCCCGGCAAAGCCGGTTCCGCGGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594675_2

>merge|NZ_LR594675|2|3391843-3391988|CRISPRCasFinder
CCCCCTTCCGGGGGCAACACCAGCGGCCCGGCAAAGCCGGTTCCGCGGTGAGCATGTTGCTCCCCCCCAGGTTGGCTCACTTCGTGTAGCCGCCCGCCCCCTACCGGGGGCAACACCAGCGGCCCGGCAAAGCCGGTTCCGCGGTG

>NZ_LR594675|2|2|3391843-3391988|CRISPRCasFinder
CCCCCTTCCGGGGGCAACACCAGCGGCCCGGCAAAGCCGGTTCCGCGGTG	AGCATGTTGCTCCCCCCCAGGTTGGCTCACTTCGTGTAGCCGCCCG
CCCCCTACCGGGGGCAACACCAGCGGCCCGGCAAAGCCGGTTCCGCGGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594675.1\|WP_162580780.1\|3388906_3390106_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380551
NZ_LR594675.1\|WP_162580775.1\|3384389_3385265_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_LR594675.1\|WP_162580787.1\|3399936_3400977_-\|flavin-reductase	unknown	unknown	gnl\|CDD\|214900
NZ_LR594675.1\|WP_162580786.1\|3398522_3399800_-\|erythromycin-esterase-family-protein	unknown	unknown	gnl\|CDD\|377470
NZ_LR594675.1\|WP_174255720.1\|3400973_3401354_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319925
NZ_LR594675.1\|WP_162580784.1\|3394894_3398023_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_LR594675.1\|WP_162580783.1\|3393711_3394866_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_LR594675.1\|WP_162580773.1\|3382794_3383823_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|234585
NZ_LR594675.1\|WP_162580790.1\|3402149_3403217_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|366009
NZ_LR594675.1\|WP_162580774.1\|3383836_3384343_-\|DUF1993-family-protein	unknown	unknown	gnl\|CDD\|370447
NZ_LR594675.1\|WP_162580772.1\|3382053_3382779_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|182696
NZ_LR594675.1\|WP_162580782.1\|3392203_3393706_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_LR594675.1\|WP_162580785.1\|3398162_3398522_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR594675.1\|WP_162580781.1\|3390259_3391792_-\|sigma-54-interacting-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226350
NZ_LR594675.1\|WP_162580779.1\|3388073_3388838_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213186
NZ_LR594675.1\|WP_162580789.1\|3401350_3402136_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|235975
NZ_LR594675.1\|WP_162580777.1\|3386339_3387323_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_LR594675.1\|WP_162580791.1\|3403426_3404413_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_LR594675.1\|WP_162580778.1\|3387319_3388045_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213191
NZ_LR594675.1\|WP_174255792.1\|3385261_3386326_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323

Protein	Function_ID	Function_description	E-value
NZ_LR594675.1\|WP_162580780.1\|3388906_3390106_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380551	cd06328, PBP1_SBP-like, periplasmic substrate-binding domain of active transport proteins (substrate binding proteins or SBPs). Periplasmic substrate-binding domain of active transport proteins found in gram-negative and gram-positive bacteria. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.	1.55456e-159
NZ_LR594675.1\|WP_162580775.1\|3384389_3385265_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.85305e-18
NZ_LR594675.1\|WP_162580787.1\|3399936_3400977_-\|flavin-reductase	gnl\|CDD\|214900	smart00903, Flavin_Reduct, Flavin reductase like domain. This entry represents the FMN-binding domain found in NAD(P)H-flavin oxidoreductases (flavin reductases), a class of enzymes capable of producing reduced flavin for bacterial bioluminescence and other biological processes. This domain is also found in various other oxidoreductase and monooxygenase enzymes... This domain consists of a beta-barrel with Greek key topology, and is related to the ferredoxin reductase-like FAD-binding domain. The flavin reductases have a different dimerisation mode than that found in the PNP oxidase-like family, which also carries an FMN-binding domain with a similar topology.	1.08498e-58
NZ_LR594675.1\|WP_162580786.1\|3398522_3399800_-\|erythromycin-esterase-family-protein	gnl\|CDD\|377470	pfam05139, Erythro_esteras, Erythromycin esterase. This family includes erythromycin esterase enzymes that confer resistance to the erythromycin antibiotic.	8.76148e-147
NZ_LR594675.1\|WP_174255720.1\|3400973_3401354_-\|VOC-family-protein	gnl\|CDD\|319925	cd07264, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.85677e-11
NZ_LR594675.1\|WP_162580784.1\|3394894_3398023_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_LR594675.1\|WP_162580783.1\|3393711_3394866_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	2.0099e-59
NZ_LR594675.1\|WP_162580773.1\|3382794_3383823_+\|ferrochelatase	gnl\|CDD\|234585	PRK00035, hemH, ferrochelatase; Reviewed.	2.6075e-153
NZ_LR594675.1\|WP_162580774.1\|3383836_3384343_-\|DUF1993-family-protein	gnl\|CDD\|370447	pfam09351, DUF1993, Domain of unknown function (DUF1993). This family of proteins are functionally uncharacterized.	6.59895e-91
NZ_LR594675.1\|WP_162580772.1\|3382053_3382779_-\|HAD-IA-family-hydrolase	gnl\|CDD\|182696	PRK10748, PRK10748, 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB.	3.67394e-34
NZ_LR594675.1\|WP_162580782.1\|3392203_3393706_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	2.84053e-77
NZ_LR594675.1\|WP_162580790.1\|3402149_3403217_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|366009	pfam00296, Bac_luciferase, Luciferase-like monooxygenase.	1.76733e-61
NZ_LR594675.1\|WP_162580781.1\|3390259_3391792_-\|sigma-54-interacting-transcriptional-regulator	gnl\|CDD\|226350	COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms].	5.19481e-140
NZ_LR594675.1\|WP_162580779.1\|3388073_3388838_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	1.11593e-108
NZ_LR594675.1\|WP_162580789.1\|3401350_3402136_-\|glucose-1-dehydrogenase	gnl\|CDD\|235975	PRK07231, FabG-like, SDR family oxidoreductase.	3.06489e-74
NZ_LR594675.1\|WP_162580777.1\|3386339_3387323_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	3.68309e-60
NZ_LR594675.1\|WP_162580791.1\|3403426_3404413_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.99129e-113
NZ_LR594675.1\|WP_162580778.1\|3387319_3388045_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213191	cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter. LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.	8.01562e-103
NZ_LR594675.1\|WP_174255792.1\|3385261_3386326_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.96919e-62

>NZ_LR594675.1|WP_162580781.1|3390259_3391792_-|sigma-54-interacting-transcriptional-regulator
MSAITAPTAALPLDAEGILALAARSMFHLFSSISQGMFLVDRGGRIVWVNEGYRRFLPALGFSSIDQFLGHPVEEVVPNTLMQRVLETGEPILIDLLTNKAGTFVVSRIPLREEREDGAAGAVIGAIGIVLFDHPEDTLQPLISKFALLQRDLDDARRELATQRNNPIWQHSADGQRRSKYTFASFIGASPAAVEVKRHARRAAQSSSPVLLLGETGTGKELLAHAIHAASARARNAFVSVNIAAVPDTLLEAEFFGVAPGAYTGADRKAREGKFKLADGGTLFLDEIGDMPLALQAKLLRALQEGEIEPLGSNKLVPFDARVIAATSRDLPALVREGRFREDLFYRLNVLPVRVPPLRERRADIPALVEALGEDMALRSGEAPPELMPDALALLAAQHWRGNIRELRNVLEQVTMRSDSQRIDAAQLERILRETGQEKIAAPDPLQPAPGTAAADDKALLLRPLAEQVAELERKAIAAAMAATGGNKLAASRLLKISRATLYERLENPD
>NZ_LR594675.1|WP_162580780.1|3388906_3390106_-|ABC-transporter-substrate-binding-protein
MHRRHLVALATVSAALGATALTTPALAQSNEIRIAHIYSKTGPLEAYGKQTQTGLMMGLDYATGGTMAVNGKKIVVIEKDDQGKPDLGKSLLAAAYADDKAALAVGPTSSGVALAMLPVAEEYKKILLVEPAVADSITGDKWNKYIFRTGRNSSQDAISNAVALDKPGVSIATLAQDYAFGRDGVKAFKEAIKKAKIVHEEYLPQNTTDFTAGAQRLIDKLKDQPGRKVIWIVWAGAGNPFKIADLDLKRYGIEIATGGNILPAMASYKQFPGMEGATYYYFGIPKNPVNEALVAAHYKEFKTPPDFFTAGGFSAAMAVVTALKKTGGDTGTNKLISTMEGMTFDTPKGPMTFRKEDHQALQSMYHFKIKADPAFAWGVPELVHEIKASEMDIPIKNKR
>NZ_LR594675.1|WP_162580779.1|3388073_3388838_-|ATP-binding-cassette-domain-containing-protein
MLETRDLTIRFGGHVAVNAVSCAFAPGTLTAIVGPNGAGKTTFFNLISGQLKASAGTVSLDGQLLSGLGASARTRAGLGRAFQLTNLFPNLTVLENVRLAVQATREGAHRRGLNLWSIWSDHRALTERADRILADVALKAKEHATVASLPHGDQRKLEVALLMALEPKVFMFDEPTAGMNAAEAPVILDLIRALKKDRSKTILLVEHKMDVVRELADRIIVLHNGQLVADGEPAEVIASPVVQEAYLGVAKEAA
>NZ_LR594675.1|WP_162580778.1|3387319_3388045_-|ATP-binding-cassette-domain-containing-protein
MSVNLLTLEGVHTHIGAYHILHGVDLVVPKGQLTMLLGRNGAGKTTTLRTIMGLWHASQGRVRFGERDITALRTPQIAELGIAYVPENMGIFSDLTVKENMLLAAHGAKNAEQMDEARLKWIFELFPAVQKFWNHPAGKLSGGQKQMLAVARAIVEPRELLIVDEPSKGLAPAIINNMIEAFGALKKSGVTILLVEQNLHFAQRLGDTVAVMDNGRVVHGGSMAAFSADEELQRSLLGLAL
>NZ_LR594675.1|WP_162580777.1|3386339_3387323_-|branched-chain-amino-acid-ABC-transporter-permease
MKLDFDWKPLLLVPVLALVALPLTGSFSTWLTLTVAGLAMGMIIFIIASGLTLVFGLMDVLNFGHGVFIALGAFVASTVLGGMGDWTGSQEVWRNLVAVFPAMLVAMAVAGAVGLAFERFIVRPVYGQHLKQILITMGGMIIGEELIKVIWGPGQIPLPLPDGLRGSLLVGDAAISKYRLLAVAVGLVVFGVLAWTLARTKIGLLIRAGVQDREMVESLGYRIGRLFIGVFVVGSALAGLGGVMWGLFQQNLIPQMGAQVNVLIFIVIIIGGLGSTTGALIGALLVGLLTNYTGFLLPVATQFASIALMVAVLLWRPQGVYPVASSR
>NZ_LR594675.1|WP_174255792.1|3385261_3386326_-|branched-chain-amino-acid-ABC-transporter-permease
MLKRLLSNDMPRSRVLAVLLVLLLIGLAFAPFIFPGVKALSVAAKVLVFIVLVASFDLLLGYTGIVSFAHTMFFGIGAYGIAISATRLGPGWGALLLGLGAALVVSLLLSLAIGLFSLRVRAIFFAMITLAVASAFQTLASQLSDFTGGEDGLTFKLPELISPSFEFAEEPFLGVSLDGRLLCYYLLFVAAVVLVLALLRIVNSPFGRVLQAIRENEFRAEAIGYRVVVYRTTASVLSALFATLAGAMLAIWLRYNGPDTSLSFEIMIDVLLIVVIGGMGTIYGAAIGAALFVVAQSYLQDLLRLGSEAVSSVGWLAALLSPDRWLLWLGVLFVLSVYYFPTGIVGRLRARAHR
>NZ_LR594675.1|WP_162580775.1|3384389_3385265_-|alpha/beta-fold-hydrolase
MNAPTSNYLQVAGREIHWMDWGEQGGPVVVAWHGLARTCRDMDELAGHFSARGFRVICPDTLGRGLSQWSPAPDDEYHLAFYARLAAGLCDALALERVHWVGTSMGGAIGMVCAGGLVEPRMKARIASLVLNDNAPQIANAAVERIRSYAGQPPAFDTVAELEAFFRTVYKPYGWLSDAQWRRLTETSTRRLPDGRVTPHYDPAMVRQFVVHPEDYVLWPHYDAIEVPVLCLRGVDSDLVLPDTLGEMQRRGPGAAGRLQVIEVPGCGHAPALNVPAHLDPIEAFVRGAGI
>NZ_LR594675.1|WP_162580774.1|3383836_3384343_-|DUF1993-family-protein
MALSFYDISVPVFLRGLGQLSHLLDKGLAHAQESGIDPAVLVNARLAPDMFTLAGQIQSASDASKLGIARIAGLTAPSFPDTETTYPELQARVAKTVDYLQSVDRALVDGFEDRPVTMKARGNELNFTAQRYLLQFALPNFFFHVTTAYDVLRHSGVPLGKMDYLGPF
>NZ_LR594675.1|WP_162580773.1|3382794_3383823_+|ferrochelatase
MPFRPEAPAAATDPERTAVLWCNLGSPDEATARAVRPYLAEFLGDSRVVEIPKALWTPILQGIILRTRPAKSAAKYASVWMPEGAPLKVWTQKQAKLLAGWLGERGHRVTVREAMRYGQPSIPSQLDALKAEGAARVLVLQAYPQYSGTTTASVIDAVNAWSARVRRVPEFRFVNDFYGEPLYIEALARSVEDHWKHHGRPDRLLMSFHGIPERNIRLGDPYQVQCLATARLLAERLKLADAQYRVTFQSRFGRAKWLEPYTEPTLRELGASGVARVDVMCPGFPADCLETLEEIAMEGRDAFLQSGGKEFHYIPCLNDRSDWITALAAIAERHLSGWPTRV
>NZ_LR594675.1|WP_162580772.1|3382053_3382779_-|HAD-IA-family-hydrolase
MALATPDSQALDVKRIAAISLDLDDTLWPIWPTIERAERALHEWLLREAPKTANLLITPGVLRELREATEKERSDLAHDLSALRRESIRTALKRAHEDPALADPAFDIFFAERQRVTLYDDALPALEWLSERYPLVAISNGNADVHLAGVGRWFRAAFSAREFGSAKPHPAIFRAAAASIGAPPEHVLHVGDDAALDVVGALGAGMQAAWLVREERPWEHGARPQLIVSNLQALCMALDSA
>NZ_LR594675.1|WP_162580782.1|3392203_3393706_+|efflux-transporter-outer-membrane-subunit
MRNSRLRALCFALPFTLPLAFSACTLPRPPEKVTAPTPVQWSTPLPHGGSLPVLADWWRQLDDPLLVELIDAAQAASPNVASAAARIAEARASRVAAGAALAPSLNANASASRSNSPTSGFGGLSGTGSTGAGSTSTSIPAITTLQAGLQSNWELDLFGGLRATRDANQARLDSTVARWHEARVSVAAETANAYFGERACRRQLAVATDDTRSRAETARLNDLSARAGFTAPADAALARAGASDASARLTQQRAQCALLQQALVAMTGIDAPTLQARLDAAPVERALPGVQPVASVPAEVLAQRPDVYASELGVAAASAEAGSALAQRFPRLTLQGSIGRLQFRTSGFRETVDTWSIGPVALTVPIFDGGTLAANVDAARARYDEAVALYRGSVRQAVREVEEALINLQSTDQRAGDADAAVQNYQASFDATSARYQSGLASLFELEDSRRTLFAAQTARVSLQRERAEAWVALYRTTGGGWSRPGTESTSTSSIATSAK
>NZ_LR594675.1|WP_162580783.1|3393711_3394866_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MTRMKRSTLLIIVAVGVLLLAAAAFLWSRGKPAEHAAGKPKEAAAQPRPALTVTVARPETSELTITLAANGNVAAWQEASIGSESTGLRLAEVRVNVGDAVKKGQVLATFSQETVQADVAQARASLAEARATAADAAGNAARARTLQATGALSQQQINQYQTAEQTAKARVAAAEAVLAAQQVRGRNTQVLAPDDGVISARTATVGSVLGAGTELFRLIRQGRLEWRAEVTSAELSRVTVGTPAVITSASGAQVSGKVRSIAPTVDPQTRNALVYVDIPGVQQASAVKAGMFARGEFQLGRSSALTVPQAAVVPRDGFNHLLLLQPDNRVAQLKVETGRRVGDRVEITTKLPDDARIVVQGAGFLNDGDLVRVVDALPVKRSAP
>NZ_LR594675.1|WP_162580784.1|3394894_3398023_+|efflux-RND-transporter-permease-subunit
MNVSAWSIRNPIPAVMLFVLLTFAGLLSFNAMKVQNFPDIDLPTVTVSVSLPGAAPSQLENDVARKIENSIATVQGLKHITTKVQDGAATMIVEFRLEKPVQEAVDDVRSAVQRVRADLPADVRDPVINKLDFAAQPVLAFTIASSRMDPEALSWFVDDTVTKKLLAISGVGAVNRVGGVTRQVHVDLDPGRLQSLGATAADISRQLRQVQTESAGGRTDLGGSEQPVRTLATVRSADALRDMQIPLSDGRSIRLDQVARVSDTIAEPRAAALLDGKAVVGFEVARSRGASEVEVGAAVQKALAELRAQHPDIQLTEAFNFVEPVEEEYDGSLHLLYEGALLAVIVVWLFLRDWRATFVSAVALPMSAIPAFIGMHWLGFSINVVTLLALSLVIGILVDDAIVEVENIVRHLRMGKTPYQAAMEAADEIGLAVIATTFTLIAVFLPTAFMSGVAGKFFKQFGWTASLAVFASLVVARMLTPMMAAYILKPLVGAEKEPRWLSFYMRLAERSLRHRFTTMVLATLFFFGSIALIPLLKTGFIPADDNSQTQVYLSLPPGATLAQTLAMAEETRQRVMAVEHVKSVYTTVGGGSAGGDPFASFGTPETRKATLTIKLADRGDRPRKQGIENNIRKTLETLPGVRTTVGLGGSGEKYILVLTGEDPYALSTAARAVEKDLRTVPGLGNITSTASLIRPEIAVRPDFARAADLGVTSSAIAETLRVATLGDYDQALPKLNLAQRQVPIVVKLEDSARQDLSLLERLTVPGARGPVMLSQVAALTMEGGPAVIDRYDRSRNVNFEIELSGVGLGDAKKAVEALPSVRNLPPGVRVAEVGDAEMMSELFASFGLAMLTGVLCIYIVLVLLFKDFLHPVTILCALPLALGGAFIGLLLGQQALSMPSMIGFIMLMGVATKNSILLVEYAIVARRDHGMTRWDALRDACHKRARPIIMTTLAMGAGMAPIALGLGAADSSFRAPMAMAVIGGLITSTVLSLLVVPAVFTYIDDIEHWLHRMVARMRGRQPDAADAPEGPPPRTREQPAAR
>NZ_LR594675.1|WP_162580785.1|3398162_3398522_+|hypothetical-protein
MKPSQLPRTFFVCAGLATAVAASAQSAPDALQRRYERDIAACNNGTLATPAREACIRAAGTALDRARGGPPSEVPQPSADGRATIVAPPGAAASSGSDAITSRDGRATIVQPAGQAPQR
>NZ_LR594675.1|WP_162580786.1|3398522_3399800_-|erythromycin-esterase-family-protein
MRGKGQDDDGAIRAIRAAACPLGTSPHCHAALLFAVADARFVLLGEASHGTDDFYRERAAITKRLIEEKAFDAVAVEADWPDALRVDRFVRGLSDDSSALQALGDFQRFPAWMWRNPPVREFVDWLRAFNQGRAPEQRVGFYGIDLYSLYTSIESVLEYLDRVDPEAARRARSRYGCFDHFAEDTQAYGHAAAFGLSASCEDAAVAQLMELREKKVHAGVDAHFHAEQNARLVRNAEHYYRTMFKGRVASWNLRDQHMAQTLEALDAHLSARRSRPARIAVWAHNSHLGDARATEMANIGELNVGQLMRERYGGQCFNVGFTTASGEVMAASAWDGDAERKRINPPLAGSIEALLHETGLGRFALILRNHQVLAEALRDARLQRAIGVIYAPATERQSHYFEARVAEQFDALVHLDQTSALESLA
>NZ_LR594675.1|WP_162580787.1|3399936_3400977_-|flavin-reductase
MRRTAVPKSNSTAAAGEGTPVSHSTPHIDAIEPKLFRQLLGCFPTGVAVITTNAADGRPAGLTCNSFSSVSLEPPLVLFSLRKASSLLRAFVEADAFAINILSQSQDLLSARFASSKIVDKFEGVAWRAGPLGTPLIDDCLASFECRVHARHEAGDHEIFIGEVKHMATGSADHALVFYKGAYMMLAESLRKVVLEGRLGTADIDEAYRSLYGTLLRLACERGSDAEVDAIEAAANEIEQHQGQHALAQRIEATARFFSSIALAGHNEALRLMAQTMTTVLRERMTHVIPVRPRPDAFPLRHKVVQCLRARDAEGAANALDELIAKLRQGDGAHDDSGVVLAPAQR
>NZ_LR594675.1|WP_174255720.1|3400973_3401354_-|VOC-family-protein
MSRTMESPKRLQNVFVVAERPAELHAFYESALGLQLKFRDKDRWIQYGVGNTSVALACREEALPATSGVVMVFEVEDFAATIERVAAAGGEVLGTRDMGSHGAVLSLRDPEGNIVQLFKRQGTTTP
>NZ_LR594675.1|WP_162580789.1|3401350_3402136_-|glucose-1-dehydrogenase
MSSPNPFDSHALQGKVAVVTGASGGLGLAMCEQLRAIGAQVVQVDISYPAAPVEADGSLSVQCDIADPASITAMAELTRSRFGRCDVLVNNAAITSSPVPLEDFPIALWDRIFHVNLRGALLCAQALVPMMFDREAGSIINIASIAAQVSTRVGAYGPTKAAMRALTHQMAVEWGPRGIRANSVSPGMIRTPLSEVHYRDEAVLKTRTSRIPARRVGVPSDVAGAVCFLASDASTYINGQDLVVDGGFLKASLANVYNNAS
>NZ_LR594675.1|WP_162580790.1|3402149_3403217_-|LLM-class-flavin-dependent-oxidoreductase
MEFGVFILAQQRGYHQSSQQVIQNSIEQTVVAEQAGFNTAWYAEHHFNNYSLSPSPLMMIAHMAAKTQRIRLGSAVCILPLYHPARFLAEVGFVDTVSNGRLELGIGSGYQEFEFERFGVKIEDSGAIYNEFLDIIPKGLTQKIVEYDGKFLKLPPSSIAVRPVQDPMPPLWITSGNPVTLGRGVREGHNLFVTALLNGTDAIVSLRERLDKVAADNNADLDEDVKFGFLRCAFASDKQSEIDAYLDNARFQRRISESLKFRRAQSDDGYMVKEVPSPTDPSFEQLRKNLPVGSVNQVIDKMLEEISILRPKHIALQTQLGDFDQKTMLRQIELWGEKIIPAIRKEVESMNAVAA
>NZ_LR594675.1|WP_162580791.1|3403426_3404413_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MIQVPIKRRTVLLGSMLLGAGVGAFASTGNWPSRPIRLVVAGSAGAGGDTFARLIAEPLSKVLKQPVVVDPKAGANGLIACDAVAKAPGDGYTLLFAPSSAILINPVIHPKLPYDAEKDLVPITQIGAAGILLVANPSMGFKNLKDMVAYAKANPGKLAYGSWGTGSSGHLAMEGIKAHYGLDMPHAPYKTLVTEVTDLIANNISVGFTDIQSPLQHMRSGRLVGLGQTGSQRWPATQDLPTLAEQGYKFEADGWYGVFAPAGTPVEIIDRLNAEINRLQKTDEVRQKIEGQNMIVPPARSAQQFAASIKKDAAIWQGLAKTTDLKDK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594675_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594675_3

3731459-3731568

Orphan

Consensus_repeat	Method
GTACACGAAGTGACAAGCGTGGGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594675_3

>merge|NZ_LR594675|3|3731459-3731568|CRISPRCasFinder
GTACACGAAGTGACAAGCGTGGGGGCGCTATCGTGCGCCGCCCGGCCGCCCGAAGGCGCGAAGGCCCCCTGGGGGGGCAGCGCAGTACACGAAGTGACAAGCGTGGGGGC

>NZ_LR594675|3|3|3731459-3731568|CRISPRCasFinder
GTACACGAAGTGACAAGCGTGGGGGC	GCTATCGTGCGCCGCCCGGCCGCCCGAAGGCGCGAAGGCCCCCTGGGGGGGCAGCGCA
GTACACGAAGTGACAAGCGTGGGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594675.1\|WP_162581049.1\|3734208_3734940_-\|3-oxoacyl-ACP-reductase-FabG	unknown	unknown	gnl\|CDD\|235546
NZ_LR594675.1\|WP_162581053.1\|3739411_3740002_-\|outer-membrane-lipoprotein-carrier-protein-LolA	unknown	unknown	gnl\|CDD\|319983
NZ_LR594675.1\|WP_162581048.1\|3733399_3734176_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133022
NZ_LR594675.1\|WP_162583771.1\|3737021_3739418_-\|transporter	unknown	unknown	gnl\|CDD\|226709
NZ_LR594675.1\|WP_162575182.1\|3725180_3725648_-\|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH	unknown	unknown	gnl\|CDD\|234634
NZ_LR594675.1\|WP_162581043.1\|3726294_3726912_-\|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase	unknown	unknown	gnl\|CDD\|185680
NZ_LR594675.1\|WP_162581051.1\|3735411_3736173_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379312
NZ_LR594675.1\|WP_162581041.1\|3724578_3725184_-\|septum-formation-inhibitor-Maf	unknown	unknown	gnl\|CDD\|179341
NZ_LR594675.1\|WP_162581045.1\|3727816_3729127_-\|phosphoribosylamine--glycine-ligase	unknown	unknown	gnl\|CDD\|234856
NZ_LR594675.1\|WP_162581042.1\|3725644_3726295_-\|ribosome-silencing-factor	unknown	unknown	gnl\|CDD\|272901
NZ_LR594675.1\|WP_162581046.1\|3729151_3729877_-\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|234640
NZ_LR594675.1\|WP_174255795.1\|3739979_3740957_-\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|226712
NZ_LR594675.1\|WP_162581039.1\|3721209_3722994_+\|lipid-A-export-permease/ATP-binding-protein-MsbA	unknown	unknown	gnl\|CDD\|131258
NZ_LR594675.1\|WP_162581044.1\|3726902_3727817_-\|oxygen-dependent-coproporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|235413
NZ_LR594675.1\|WP_162583770.1\|3732635_3733433_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_LR594675.1\|WP_162581052.1\|3736182_3737022_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200582
NZ_LR594675.1\|WP_162581047.1\|3730046_3731408_+\|tryptophan-7-halogenase	unknown	unknown	gnl\|CDD\|380163
NZ_LR594675.1\|WP_174255723.1\|3731574_3732618_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275237
NZ_LR594675.1\|WP_162581050.1\|3734953_3735415_-\|hydroxymyristoyl-ACP-dehydratase	unknown	unknown	gnl\|CDD\|238616
NZ_LR594675.1\|WP_162581040.1\|3723033_3724560_-\|ribonuclease-G	unknown	unknown	gnl\|CDD\|183285

Protein	Function_ID	Function_description	E-value
NZ_LR594675.1\|WP_162581049.1\|3734208_3734940_-\|3-oxoacyl-ACP-reductase-FabG	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	5.67112e-106
NZ_LR594675.1\|WP_162581053.1\|3739411_3740002_-\|outer-membrane-lipoprotein-carrier-protein-LolA	gnl\|CDD\|319983	cd16325, LolA, LolA, a periplasmic chaperone. This family contains periplasmic molecular chaperone LolA which binds to outer-membrane specific lipoproteins and transports them from inner membrane to outer membrane (OM) through LolB, a lipoprotein anchored to outer membranes. There are five Lol proteins (LolA, LolB, LolC, LolD, and LolE) involved in the sorting and membrane localization of lipoprotein and are highly conserved in Gram-negative bacteria. LolA accepts OM-specific lipoproteins that are released from the inner membrane by the LolCDE complex and transfers them to the OM receptor LolB. Studies have shown that hydrophobic surface patches large enough to accommodate acyl chains of the OM lipoproteins and the structural flexibility of LolA are important factors for its role as a periplasmic chaperone.	5.79421e-12
NZ_LR594675.1\|WP_162581048.1\|3733399_3734176_+\|glycosyltransferase	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.20428e-39
NZ_LR594675.1\|WP_162583771.1\|3737021_3739418_-\|transporter	gnl\|CDD\|226709	COG4258, COG4258, Predicted exporter [General function prediction only].	1.37043e-138
NZ_LR594675.1\|WP_162575182.1\|3725180_3725648_-\|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH	gnl\|CDD\|234634	PRK00103, PRK00103, rRNA large subunit methyltransferase; Provisional.	8.04198e-79
NZ_LR594675.1\|WP_162581043.1\|3726294_3726912_-\|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase	gnl\|CDD\|185680	cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase. Nicotinamide/nicotinate mononucleotide (NMN/ NaMN)adenylyltransferase (NMNAT). NMNAT represents the primary bacterial and eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide. It is an indispensable enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway. Human NMNAT displays unique dual substrate specificity toward both NMN and NaMN, and can participate in both de novo and salvage pathways of NAD synthesis.	2.99866e-68
NZ_LR594675.1\|WP_162581051.1\|3735411_3736173_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.46061e-13
NZ_LR594675.1\|WP_162581041.1\|3724578_3725184_-\|septum-formation-inhibitor-Maf	gnl\|CDD\|179341	PRK01839, PRK01839, septum formation inhibitor Maf.	8.27873e-100
NZ_LR594675.1\|WP_162581045.1\|3727816_3729127_-\|phosphoribosylamine--glycine-ligase	gnl\|CDD\|234856	PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional.	0
NZ_LR594675.1\|WP_162581042.1\|3725644_3726295_-\|ribosome-silencing-factor	gnl\|CDD\|272901	TIGR00090, rsfS_iojap_ybeB, ribosome silencing factor RsfS/YbeB/iojap. This model describes a widely distributed family of bacterial proteins related to iojap from plants. It includes RsfS(YbeB) from E. coli. The gene iojap is a pattern-striping gene in maize, reflecting a chloroplast development defect in some cells. The conserved function of this protein is to silence ribosomes by binding the ribosomal large subunit and impairing joining with the small subunit in response to nutrient stress. Note that RsfS (starvation) is an author-endorsed change from the published symbol RsfA, which conflicted with previously published gene symbols. [Protein synthesis, Translation factors].	1.89068e-41
NZ_LR594675.1\|WP_162581046.1\|3729151_3729877_-\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|234640	PRK00110, PRK00110, YebC/PmpR family DNA-binding transcriptional regulator.	8.95094e-157
NZ_LR594675.1\|WP_174255795.1\|3739979_3740957_-\|acyl-CoA-synthetase	gnl\|CDD\|226712	COG4261, COG4261, Predicted acyltransferase [General function prediction only].	1.44488e-81
NZ_LR594675.1\|WP_162581039.1\|3721209_3722994_+\|lipid-A-export-permease/ATP-binding-protein-MsbA	gnl\|CDD\|131258	TIGR02203, Lipid_A_export_ATP-binding/permease_protein_msbA., lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other].	0
NZ_LR594675.1\|WP_162581044.1\|3726902_3727817_-\|oxygen-dependent-coproporphyrinogen-oxidase	gnl\|CDD\|235413	PRK05330, PRK05330, oxygen-dependent coproporphyrinogen oxidase.	0
NZ_LR594675.1\|WP_162583770.1\|3732635_3733433_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	2.44811e-35
NZ_LR594675.1\|WP_162581052.1\|3736182_3737022_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200582	cd10959, CE4_NodB_like_3, Catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases. This family includes many uncharacterized bacterial polysaccharide deacetylases. Although their biological function still remains unknown, members in this family show high sequence homology to the catalytic NodB homology domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Like SpPgdA, this family is a member of the carbohydrate esterase 4 (CE4) superfamily.	9.98058e-57
NZ_LR594675.1\|WP_162581047.1\|3730046_3731408_+\|tryptophan-7-halogenase	gnl\|CDD\|380163	NF033113, halo_ClmS, chloramphenicol-biosynthetic FADH2-dependent halogenase CmlS.	1.54219e-59
NZ_LR594675.1\|WP_174255723.1\|3731574_3732618_+\|hypothetical-protein	gnl\|CDD\|275237	TIGR04444, hypothetical_protein_ThecoDRAFT_3161, chorismatase, FkbO/Hyg5 family. Members of this include two chemically distinct enzymes that cleave pyruvate from chorismate. FkbO and RapK convert chorismate to pyruvate plus (4R,5R)-4,5-dihydroxycyclohexa-1,5-dienecarboxylic acid (DCDC). HygB and Bra8 convert chorismate to pyruvate, water, and 3-hydroxybenzoate. These two enzymes are closely related, and lack homology to chorismate lyase, EC 4.1.3.40, which converts chorismate to pyruvate plus 4-hydroxybenzoate.	1.04613e-65
NZ_LR594675.1\|WP_162581050.1\|3734953_3735415_-\|hydroxymyristoyl-ACP-dehydratase	gnl\|CDD\|238616	cd01289, FabA_like, Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ). This group appears to lack the conserved active site histidine of FabA and FabZ.	2.16675e-38
NZ_LR594675.1\|WP_162581040.1\|3723033_3724560_-\|ribonuclease-G	gnl\|CDD\|183285	PRK11712, PRK11712, ribonuclease G; Provisional.	0

>NZ_LR594675.1|WP_162581047.1|3730046_3731408_+|tryptophan-7-halogenase
MNIPPTTNAEAAAPAHQACDVLVIGGGPAGSTAAALLAQQGRNVVLLEKAHHPRFHIGESLLPANVQLFDRLGLREEIERIGMPKWGVEFVSPDHEHVAMVEFADAWDKTMPYAWQVRRSEMDEILFRNATARGAETIEGCHVRDVQFDADGATVTARLADGATRSWRARFVLDASGRDTFLSNKLKAKQKNPKHNSSALFGHFTNADRLPGKLEGNITIFWFAHGWFWYIPLADGTTSVGAVCWPYYLKSRTKPVKDFFADTIALCPQLAARLSNATLVDDAVYATGNYSYTSTHCSGERYLMLGDAYSFIDPVFSSGVYLAMYSAFEGAEVVAAALDRPAEAAAARQRFERDMRRGPREFSWFIFRVTNPTIREFFMYPQNPFRVKEALLSLLAGDIYGKTPIWRSLRLLKALYYLVSAGHPLRTWQSWQRRRRNIRDLGPLAGENVVEAR
>NZ_LR594675.1|WP_162581046.1|3729151_3729877_-|YebC/PmpR-family-DNA-binding-transcriptional-regulator
MAGHSKWANIQHRKGRQDEKRGKLWTRAIREIMVAAKAGGGDLSANPRLRLAVDKAKAVNLPADTIKRNIDKATGNLEGVSYEEIRYEGYGIGGAAIIVDTMTDNRVRTVAEVRHAFGKHGGNMGTEGSVAFQFKHCGQLVFAPGTSEDKVMEVALEAGAEDVVTDEDGAIEVLTAPGDFESVRDALEAAGLKPEVAEVTMRAENTIELAGEDAAKMQKLLDVLEDLDDVQDVYHNAALSE
>NZ_LR594675.1|WP_162581045.1|3727816_3729127_-|phosphoribosylamine--glycine-ligase
MKVLVIGGGGREHALAWRLAQAARVSRVYVAPGNGGTRADSRYECIDIAEPAALRAWALQEKIALTVVGPEAPLAAGVVDEFRAHGLRIFGPTKAAAQLESSKAFSKAFMKRHKIPTAEYEAFTHPAAAHAYVDAKGVPIVIKADGLAAGKGVVVATTLAEAHEAIDFMLLDNKLGISHNEGEDGKASPRVVIEDFLQGEEASFIVLCDGVNVTALATSQDHKRLQDGDQGPNTGGMGAYSPAPVVTAEVHARAMREIILPTIRGMEKDGIPYTGFLYAGLMIDAAGHPRTLEFNCRMGDPETQPIMMRLKSDLFEVFWHATDGTLDQIELEWDRRVALGVVMAAHGYPLSPRKGDAIHGIPPEAPDAVVFHAGTTFEDGELKTSGGRVLCVTVLADSVKQAQQRAYALAARVHFDGAQYRKDIGHRAVQVRTPHG
>NZ_LR594675.1|WP_162581044.1|3726902_3727817_-|oxygen-dependent-coproporphyrinogen-oxidase
MPDPRRMVGDYLRGLQQRIVAAVEAADGTPCLRDPWQKAPGEPLQGSGLTCILEEGALFERAGCGFSEVRGPKLPPSATQHRPELAGAPFEAMGVSLVFHPRNPYVPTVHMNVRMLAALPPRGEPVCWFGGGMDLTPCYGFEEDAVHFHRGCRDALAPFGADKYPRFKTWCDEYFFLKHRNEQRGVGGIFFDDFAELGFEQSFAMLRAVGDAFLPAYLPIVERRRAMPHGERERAFQLYRRGRYVEFNLVWDRGTHFGLQSGGRTESILLSMPPQASWAYRREPEPGTPEAALYSDFIVRREWL
>NZ_LR594675.1|WP_162581043.1|3726294_3726912_-|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase
MALNRLRIGVFGGAFDPPHNAHVALVQAALAQLGLAELRIFPTGDAWHKKRALSGGASRLAMAQLAFEALPGAVVDARELRRAGPTYTLDTLRELQQEHPAAELVLIMGADQAAWLPQWHGWREILEMAVVAVARRPGTADGTPFDPHELPDLPPGARFENLMLAPMDTSATEVRTRAAQGQDLFQLVPPAVARYIDQHHLYRST
>NZ_LR594675.1|WP_162581042.1|3725644_3726295_-|ribosome-silencing-factor
MSTEAAAKKDTQKLQRAIIDGLEDVKAQNIQVFDTEHLSPLFERVIVASGTSNRQTKALAASVRDAVRDAGFNKPRVEGEDNGEWIIVDCGAAVAHIMQPAIRQYYHLEEIWGDKPVRTKLGAAKPAAARPAEEKPPVAAKTSPSLRRSSAAKTAQRAADAAAKPKPAAKKTSARKAPASKAPVKTVVVNKAPAKKAAAKKATPAKKAPRKTTARA
>NZ_LR594675.1|WP_162575182.1|3725180_3725648_-|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH
MKLLVVAVGQRVPDWAQTAWDDYAKRFPPELKLELRAVKTEPRGSKTLETLYAAERERIEAAIAKGMRIVVLDERGTALTTKALAARLQAWQGGGDDVALVIGGPDGLDPAFKAAAHERIRLSDLTLPHAMARVLLVEQLYRAWSVNAGHPYHRE
>NZ_LR594675.1|WP_162581041.1|3724578_3725184_-|septum-formation-inhibitor-Maf
MTDPFIYLASQSPRRAQLLGQLGVRHELLLAGPEEDAEALEHVQPGESPTAYVQRVTALKLDAAVARHQRLGLPPAPVLCADTTVAFGRTILGKPANAQDAQRMLALLSGRTHRVLTAVALQHGRRRDAALSVSRVRFAAIEKRRIAAYVASGEPDGKAGAYAIQGRAAAFVEHISGSHSGIMGLPMFETAQLLRQAGFAL
>NZ_LR594675.1|WP_162581040.1|3723033_3724560_-|ribonuclease-G
MQDILINWSPQETRVALVEHGAVQELHVERTLERGLVGNVYLGKVSRVLPGMQSAFIDIGLDRTAFLHVADIVAPFTPGSRPSAAALDRDGRNGGAAVPIEKQVFEGQSLLVQVIKDPIGTKGARLSTQISIAGRLLVFLPQDNHVGVSQKIPPDLRDALRRRMQALIEAAAAAGAGGVVPEATGGFILRTNGEDSSDAELAEDIAYLRKTWSRIRELSTRMPPMSLLHQDLSLLQRVLRDMTTEDTQTIRIDSREQFDALLKFGLEFMPQAAGKLQLYKGERPIFDLYSIDEEIAKALGRRVELKSGGYLVVDQTEALTTIDVNTGGYVGARNFDDTIFKTNLEAAQAIARQLRLRNLGGIIIVDFIDMVRDDHREQVLAEFRKQLARDRVKTTAGGFSQLGLVEMTRKRTRESLAHMLCEPCLACNGQGIVKTARSVAYDVLREILREARQFTPREFRIVSSPQVIELFLDEESQHLAGLSDFIGKPISLRAEPAMGQGQYDIVLL
>NZ_LR594675.1|WP_162581039.1|3721209_3722994_+|lipid-A-export-permease/ATP-binding-protein-MsbA
MQPSPAAESARPPLTRRLARLMTWFGGSRHWWALGLVCALIAAVTEPLMAAMLKPLLDRGFTRGQLPLWAIPAAVILLFAVRGLAQFVSQYALARIANEGMQRLRRVLFERLLAAELALFSRQSASTLSNTVVYEVQTGALLLVQALLGLSRDGFTLIALLLYLVYLNWKLTLIVGVLAPCVAWIIKAFSKRLYRLTLLGQRATDELAYVVEENVLAHRMVRLHNAEAGQIQRFDRLSHDLHRLAVKSTIASAATTPLTQIVAAVALSAVVMIALWQSGKQGFTVGGFVAYITAMLMLIAPIRRLADMTSPITRGLAALERGLALIDEVPPESQGSFQARRVTGRIELRAVNVSYRGAEEARALDGISLTLAPGEVVAFVGPSGSGKTTLVNLLPRFVLPSAGQVLLDGHDVGDWQLKNLRSQFAMVSQDVVMLNDTLAANVALGAELDRDRVLACVEAANLSVHVEGLPEGIDTVLGHNATQLSGGQRQRLAIARALYKDAPVLLLDEATSALDTESERLVQEALQRLMRNRTTLIVAHRLSTIQHADRIVVMDRGRIVEQGSHGQLMALDGLYARLQANAVRSAPEGSEPSL
>NZ_LR594675.1|WP_174255723.1|3731574_3732618_+|hypothetical-protein
MSARDFNGVPPLRVERLSLSESLALSSGGPPPFGALGYGTPDHLSWMPTVNARVLSEAGAMADVWHASEPIESGTTGGVRWRCDGHWMLGAIELDEAREGVGLTELAHRAYRDLFQSLAQTGCNHVLRIWNYLPRINADGGGLERYRQFNLGRQQAFVESGQAAFEGAPAACALGIHQGALCIRFLAGRVAPMPVENPRQVSAYHYPPAYGPRSPTFSRAALAEIGGGNVALFISGTASIVGHETVHLGDVRAQTEETLRNLEAVIAAANERGSARFGVDAIDAVVYVRHDADTPIVREVLERKLGVHSHTLRHAVHLEADICRQELLVEIEAHAVAGGSLGTPGKA
>NZ_LR594675.1|WP_162583770.1|3732635_3733433_+|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MKRLLRWTFSLPLALLLYALLALLGIISLTWNLAAMLLYPVLPARTGRALGRRVIALAYRAFWGTASAAGMMRIDASCLDTLREERGVIFVANHPTMLDALLLVARLPRSACIMKADLMRNIFLGAGARLARYIRNDSARTMVRLAVEDLKAGGQLVIFPEGTRTGTPPLNPFRPGVTLIAKLAQAPIQTVFIDTDSPYLAKGWPLWRVPPLPIVFTLRLGRRFAPQQDSDRLLREIEQYFRHPTEQRATDAQPACQQPRAPTLS
>NZ_LR594675.1|WP_162581048.1|3733399_3734176_+|glycosyltransferase
MPAASRTHLVLIPSYNTGERLFSTVSAARAQWNPVWVVVDGSTDGTAERLQQMAAADPGLRVWVLPHNQGKGAAVLHGLRAAQAAGYTHALTMDSDGQHPADLIPAFMQASQARPETMVLGRPVFDASAPLLRVRGRKVSNGWTQLETMFAGVGDSLYGFRVYPVSPLIAIMERQPWMRRFDFDTEAVVRLAWRGVKPVNIDAPVKYLSAEEGGVSHFRYLRDNALLTWMHTRLMAEFVLRLPSLLLRRVRRAPPFQR
>NZ_LR594675.1|WP_162581049.1|3734208_3734940_-|3-oxoacyl-ACP-reductase-FabG
MSLNGKRALVTGASGALGTAVAQRLARDGATVLLHANSRPQAIEELAAAITASGGQAECHVFDLGSDEACSAACERILAGGPVQILVNNAGVHDDAVLPGMRAAQWHKVIDVSLNGFFRVTQPLLLPMLRTRWGRIINMSSVASLTGNRGQVNYAAAKGALNSATKALSLEVAARGVTVNAIAPGIIASPMAEGSFDKAMIDQLVPVKRAGKPEEVAALAGFLASEEAAYITGQIISINGGMA
>NZ_LR594675.1|WP_162581050.1|3734953_3735415_-|hydroxymyristoyl-ACP-dehydratase
MNAVQQLDQTGIARLIPHSGSMCLLERLEAWDAHHIHCTTGTHRRTDNPLRTAGGLLSPNAIEYAAQAMALHGGLIAPEGSEPSAGFLASARNVRLAVARLDEVDGPLHVHAQRVSGDASQVLYEFAVKDEAGRALAEGRAVVVLNTPLPMQT
>NZ_LR594675.1|WP_162581051.1|3735411_3736173_-|methyltransferase-domain-containing-protein
MNDSLSTDAAWRQLHEAATAPYKKAGSFAWHFARGKLGRDPVFRGLIERGLIGDRRRRVVDIGCGQGLFASLLSAMAGMQAKPRGWPAAWAATPAMAEYTGIELMPKDVARAQASIGHLEPAPRLVCEDMCKAALPACDLVVILDVLHYVDHAAQEGVLRRVHGALQPGGRLLLRVGDAASRRGFAVSQWVDRTVTRIRGHRVSPTWGRTLSEWTGLLQGLGFSPVQSIPMSAGTPFANVLLVADRARESSSS
>NZ_LR594675.1|WP_162581052.1|3736182_3737022_-|polysaccharide-deacetylase-family-protein
MGKSASMSQTLDVSGSWPWPPVVRASVGWHLAALAAALLVPGAWPWAIGAVVLNHVLITAAGLTPRSSLLGPNVTRLPAASAARGEVAITIDDGPDPEVTSQVLDLLDAHGQRATFFCIAERVREQPALAREIVERGHSIQNHTARHRHTFSFLGPRGFHAEIARAQQLLQEVTGERPICFRAPAGLRNPFLAPVLHRLGLVLVSWTRRGFDTRERDAATVLARLTKDLRAGDILLLHDGNAARTSSGRPVVLEVLPLLLERLHADGLRAVTLPQALTP
>NZ_LR594675.1|WP_162583771.1|3737021_3739418_-|transporter
MVSRPEAAAAGRGRHALAIVIWLLALAAGIALIARTHFSADLSAFLPASPDERQRVLIEQLQSGIASRTVFIGIEGGKGAAQRGAVSRAVAASMRESKLFDQVQNGETGDWKEAGTWLFEHRYQLSPGIAPGRFTAEGLRDAIGDTLSMLGTPAGNLVKPLLERDPTGETQRIAEGLIPASSPRSEEGVWVSRTAPRALILATTHAAGSDLDAQAQAIAQIQQAFDAATREMSGAGPRLQLTGAPVFSVQSRDQIKHEAIQLATVGGIVMGALLLLAFASPRALVVALLPVATGVVGGTAAVSLAFGEVHGLTMGFGSTLIGETVDYAIYYLIQARGAAVPGTGWMRWREIHWPTVRLGLLTSVCGFAALVFSGFPGLAQLGVFSLAGLIAAALVARFVLPVLAPDGAAGMGMRRQMAHMAGLIVRALPRLRLVFAGLGIAALGLVLWQGGQLWRADLSAMSPVPKAAQQLDEALRADIGASDGGTLVVVRGADEQAALRNTEAAGAKLEALLDQGELAGFESVTRVLPSEAAQAARIASLPDAGTLKARLAEATQGLPLPASRLEPFLADVEKARGQPLVHRTDLAGGPLDAVASALMFERPGGGWSTLIALHPGERFDPKRLEAALAAVPEVQVVNVGDELRGLYRRYLHEAFVQVMLGALAVVVLLGAWLRSGRRLLAVCEPLLVAVLLTLGGLAVLQVPLGILHLVGLLLVVAVGSNYALFFDQLRETGRADEDTLASLLLANLTTVVSFTLIAISDIPALSAIGRVVAPGALLALLLSAAFARGPAQPSAVRG
>NZ_LR594675.1|WP_162581053.1|3739411_3740002_-|outer-membrane-lipoprotein-carrier-protein-LolA
MTSGKKIERWSRWLVAALAFTASSAWAFELPELMVLLARQKNGEARFTEQRFVRGIEGPLDASGTLSFQAPDRLTRRTLTPRPETMTVDGNTLTLSRGGRTRTLTLDSMPELLGMVEAMRSTLNGNVQTLQRYFRSTLTGTTDKWALDLVPIDEKLAAQVRSLRLTGKAGEVLGVEMEFIGGDRSVMAITPVRGAS
>NZ_LR594675.1|WP_174255795.1|3739979_3740957_-|acyl-CoA-synthetase
MRAASLREAGDAKSSRADWSRTPERSNMLALRVICWIAIRCGRPLARLVLHPICLYFLLFSPAPRRHIKRYLFRAIGPRAGWSDGYKLLHAFASTVLDRIYFLRGRMDLFDVRVHGNAPVEAEVAAGRGAFMLGAHIGSFEALGACKHQSGRPKDLRLAMLMYQDNAQQISAVLDAIAQPGLRPHIIALGRPHSMLDLRDWLDGGGLAGLLGDRTLPGPEEAGQQRGNSIELPFLGHPALINDGPFRLAALLRRKVFFMAGLYVGGARYDVHFEPLADFSERVSDPVERERRIRAALESYVARLEALCRAYPYNWFNFHDFWQED

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LR594675_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR594675_4

4732773-4732903

Orphan

Consensus_repeat	Method
CCGCGGAACCGGCTTTGCCGGGCTGCTGGTGTTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LR594675_4

>merge|NZ_LR594675|4|4732773-4732903|CRISPRCasFinder
CCGCGGAACCGGCTTTGCCGGGCTGCTGGTGTTGCCCCCGGTGGGGGGTGGGCGGCTACACGAAGTGAGCCAACCTGGGGGAGAGCCAAGTAACGCCGCGGAACCGGCTTTGCCGGGCCGCTGGTGTTGCC

>NZ_LR594675|4|4|4732773-4732903|CRISPRCasFinder
CCGCGGAACCGGCTTTGCCGGGCTGCTGGTGTTGCC	CCCGGTGGGGGGTGGGCGGCTACACGAAGTGAGCCAACCTGGGGGAGAGCCAAGTAACG
CCGCGGAACCGGCTTTGCCGGGCCGCTGGTGTTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR594675.1\|WP_162581906.1\|4725763_4726909_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_LR594675.1\|WP_162581904.1\|4722536_4723658_+\|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|180601
NZ_LR594675.1\|WP_162581913.1\|4736830_4737361_+\|TRAP-transporter-small-permease-subunit	unknown	unknown	gnl\|CDD\|225632
NZ_LR594675.1\|WP_162581915.1\|4738663_4739677_+\|beta-propeller-fold-lactonase-family-protein	unknown	unknown	gnl\|CDD\|182912
NZ_LR594675.1\|WP_162581905.1\|4723696_4724374_+\|glutathione-S-transferase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|223698
NZ_LR594675.1\|WP_162583846.1\|4726937_4727726_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|184875
NZ_LR594675.1\|WP_174255734.1\|4735817_4736813_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270389
NZ_LR594675.1\|WP_162581914.1\|4737360_4738644_+\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|224509
NZ_LR594675.1\|WP_162581918.1\|4742086_4743184_+\|beta-propeller-fold-lactonase-family-protein	unknown	unknown	gnl\|CDD\|182912
NZ_LR594675.1\|WP_162581910.1\|4732954_4733926_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_LR594675.1\|WP_162581917.1\|4741294_4742059_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|235500
NZ_LR594675.1\|WP_162581912.1\|4734928_4735747_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|223528
NZ_LR594675.1\|WP_162581908.1\|4730272_4731709_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143415
NZ_LR594675.1\|WP_162581916.1\|4739687_4741280_+\|galactarate-dehydratase	unknown	unknown	gnl\|CDD\|274491
NZ_LR594675.1\|WP_174255733.1\|4727833_4729366_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|270325
NZ_LR594675.1\|WP_162581902.1\|4720530_4721376_-\|FCD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224715
NZ_LR594675.1\|WP_162581903.1\|4721279_4722389_-\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239608
NZ_LR594675.1\|WP_162583845.1\|4724399_4725767_+\|phospholipase	unknown	unknown	gnl\|CDD\|197259
NZ_LR594675.1\|WP_162581909.1\|4731819_4732731_-\|5-dehydro-4-deoxyglucarate-dehydratase	unknown	unknown	gnl\|CDD\|235141
NZ_LR594675.1\|WP_162581911.1\|4734047_4734860_-\|FCD-domain-containing-protein	unknown	unknown	gnl\|CDD\|225097

Protein	Function_ID	Function_description	E-value
NZ_LR594675.1\|WP_162581906.1\|4725763_4726909_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	4.21903e-10
NZ_LR594675.1\|WP_162581904.1\|4722536_4723658_+\|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase	gnl\|CDD\|180601	PRK06520, PRK06520, 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase.	1.0708e-154
NZ_LR594675.1\|WP_162581913.1\|4736830_4737361_+\|TRAP-transporter-small-permease-subunit	gnl\|CDD\|225632	COG3090, DctM, TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism].	1.84349e-29
NZ_LR594675.1\|WP_162581915.1\|4738663_4739677_+\|beta-propeller-fold-lactonase-family-protein	gnl\|CDD\|182912	PRK11028, PRK11028, 6-phosphogluconolactonase; Provisional.	1.00694e-97
NZ_LR594675.1\|WP_162581905.1\|4723696_4724374_+\|glutathione-S-transferase-N-terminal-domain-containing-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	1.52683e-32
NZ_LR594675.1\|WP_162583846.1\|4726937_4727726_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|184875	PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional.	8.94852e-26
NZ_LR594675.1\|WP_174255734.1\|4735817_4736813_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270389	cd13671, PBP2_TRAP_SBP_like_3, Uncharacterized substrate-binding protein of the Tripartite ATP-independent Periplasmic transporter family; the type 2 periplasmic-binding protein fold. This subfamily includes uncharacterized periplasmic substrate-binding proteins similar to TRAP transport systems such as SiaP (a sialic acid binding virulence factor) and TeaA (an ectoine binding protein). TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process and a smaller membrane of unknown function. The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.20226e-150
NZ_LR594675.1\|WP_162581914.1\|4737360_4738644_+\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	3.95335e-135
NZ_LR594675.1\|WP_162581918.1\|4742086_4743184_+\|beta-propeller-fold-lactonase-family-protein	gnl\|CDD\|182912	PRK11028, PRK11028, 6-phosphogluconolactonase; Provisional.	8.74582e-105
NZ_LR594675.1\|WP_162581910.1\|4732954_4733926_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	4.62321e-128
NZ_LR594675.1\|WP_162581917.1\|4741294_4742059_+\|glucose-1-dehydrogenase	gnl\|CDD\|235500	PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.	1.43527e-75
NZ_LR594675.1\|WP_162581912.1\|4734928_4735747_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|223528	COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	2.95896e-28
NZ_LR594675.1\|WP_162581908.1\|4730272_4731709_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143415	cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like. Kinetic studies of the Bacillus subtilis ALDH-like ycbD protein, which is involved in d-glucarate/d-galactarate utilization, reveal that it is a NADP+-dependent, alpha-ketoglutaric semialdehyde dehydrogenase (KGSADH). KGSADHs (EC 1.2.1.26) catalyze the NAD(P)+-dependent conversion of KGSA to alpha-ketoglutarate. Interestingly, the NADP+-dependent, tetrameric, 2,5-dioxopentanoate dehydrogenase (EC=1.2.1.26), an enzyme involved in the catabolic pathway for D-arabinose in Sulfolobus solfataricus, also clusters in this group. This CD shows a distant phylogenetic relationship to the Azospirillum brasilense KGSADH-II (-III) group.	0
NZ_LR594675.1\|WP_162581916.1\|4739687_4741280_+\|galactarate-dehydratase	gnl\|CDD\|274491	TIGR03248, galactar-dH20, galactarate dehydratase. Galactarate dehydratase converts D-galactarate to 5-dehydro-4-deoxyglucarate which is subsequently acted on by GarL, tartronate semialdehyde reductase and glycerate kinase (GenProp0714).	0
NZ_LR594675.1\|WP_174255733.1\|4727833_4729366_+\|ABC-transporter-permease-subunit	gnl\|CDD\|270325	cd13607, PBP2_AfProX_like, Substrate-binding protein ProX of ABC-type osmoregulatory transporter from Archaeoglobus fulgidus and its related proteins; the type 2 periplasmic-binding protein fold. This subfamily includes the periplasmic substrate-binding protein ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus and its related proteins. AfProX is involved in uptake of compatible solutes such as the trimethylammonium compound glycine betaine and the dimethylammonium compound proline betaine, but the relative substrate preference is not known. To counteract the efflux of water, many microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. AfProX belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.02311e-111
NZ_LR594675.1\|WP_162581902.1\|4720530_4721376_-\|FCD-domain-containing-protein	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	4.81971e-37
NZ_LR594675.1\|WP_162581903.1\|4721279_4722389_-\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239608	cd03532, Rieske_RO_Alpha_VanA_DdmC, Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Vanillate-O-demethylase is a heterodimeric enzyme consisting of a terminal oxygenase (VanA) and reductase (VanB) components. This enzyme reductively catalyzes the conversion of vanillate into protocatechuate and formaldehyde. Protocatechuate and vanillate are important intermediate metabolites in the degradation pathway of lignin-derived compounds such as ferulic acid and vanillin by soil microbes. DDmC is the oxygenase component of a three-component dicamba O-demethylase found in Pseudomonas maltophila, that catalyzes the conversion of a widely used herbicide called herbicide dicamba (2-methoxy-3,6-dichlorobenzoic acid) to DCSA (3,6-dichlorosalicylic acid).	1.53822e-56
NZ_LR594675.1\|WP_162583845.1\|4724399_4725767_+\|phospholipase	gnl\|CDD\|197259	cd09162, PLDc_CLS_unchar1_2, Putative catalytic domain, repeat 2, of uncharacterized proteins similar to bacterial cardiolipin synthase. Putative catalytic domain, repeat 2, of uncharacterized proteins similar to bacterial cardiolipin (CL) synthases, which catalyze the reversible phosphatidyl group transfer between two phosphatidylglycerol molecules to form CL and glycerol. Members of this subfamily contain two HKD motifs (H-x-K-x(4)-D, where x represents any amino acid residue) that characterizes the phospholipase D (PLD) superfamily. The two motifs may be part of the active site and may be involved in phosphatidyl group transfer.	1.77247e-78
NZ_LR594675.1\|WP_162581909.1\|4731819_4732731_-\|5-dehydro-4-deoxyglucarate-dehydratase	gnl\|CDD\|235141	PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate dehydratase; Provisional.	0
NZ_LR594675.1\|WP_162581911.1\|4734047_4734860_-\|FCD-domain-containing-protein	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	9.53865e-62

>NZ_LR594675.1|WP_162581909.1|4731819_4732731_-|5-dehydro-4-deoxyglucarate-dehydratase
MNPQELKSIMGSGLLSFPLTDFDAEGNFHKRGYIERLEWLAPYGASALFAAGGTGEFFSLTSDEYPEIIETAVQTCRGKVPIIAGAGGPTRFAIQCAQAAEKAGAHGVLLLPHYLTEAGQEGLAAHVEAVCKSVKFGVIVYNRGQSRLYPDTLAKLAERCPNLVGFKDGIGDIELMSSIHLRMGDRFAYLGGLPTAEVYAAAYKALGTPVYSSAVFNFIPKTAMDFYKAVAADDTATQHRLLKQFFMPYLEIRNKGQGYAVSIVKAGARIVGHDAGPVRTPLTELKPQEYDALASLIGQLGPQ
>NZ_LR594675.1|WP_162581908.1|4730272_4731709_-|aldehyde-dehydrogenase-family-protein
MQNFDNLINGEWRSGASYSPNTNPSNLQDVLGHYAQGDAAQVDEAVAAANAAFPAWSTGSVQARSDALDKIGNEILARKEELGTLLAREEGKTRAEGIGEATRAGHIFKFFAGECLRLAGEVIPSVRPGIGIEITREPVGVVGLITPWNFPIAIPAWKVAPALAYGNCVVLKPADLVPGCAWALAEIISRSGIPAGVFNLVMGRGSVIGDALVNHPGIQAISFTGSVGVGRRIAVQCATTHKKVQLEMGGKNPQVVLDDADLNQAVELSVQSAFYSTGQRCTASSRLIVTEGIYPKFIEAMKARMAKIKVGDALAQGTDIGPVSSESQLQQDLEYIDIGRGEGASLVAGGDRLRLDTEGYYMSPALFSETVGSMRINKEEIFGPVASVIRVKNYEEALATANDTEFGLSAGIATTSLKYATHFKRHSQAGMVMVNLPTAGVDYHVPFGGRKGSSYGAREQGRYAQEFFTVVKTAYTLA
>NZ_LR594675.1|WP_174255733.1|4727833_4729366_+|ABC-transporter-permease-subunit
MHCLHPLRLLVLSCLGLLCAAMPSHAQDAGLGIGSKRFTESYILAEVLAQTAAPHLPAPPRLRQGLGNTAIVYEALRSGSIDLYAEYTGTVALEILKNPQPMTREAMNAALAPLGLGIAIPLGFNDGYALAMRAAEAERLGVRTLGDLARHPELRLGLSNEFIGRADGWQGLAARYGFTQKPAGLDHGLAYDAIAAKQVDVIDIYTTDAKIEHLGLRVLTDDRAYFPRYDAVVLYRLDVPTRWPAAWAALQKLEGRIDERAMIAMNARAELQGVAFDVIARDYLAQGGVGGKAGASGSEGARGFVAKLFGPDLGRITRQHLLLVAVSVGLAVLIAVPLGIAVFPHLRLRALVLGLTGLLQTVPSLALLAVLISLIGAIGTLPALIALTLYSLLPIMRNTVTGLAEVPTGLRQAGTALGMTGAQSLRLVLLPLALPTLLAGVRTAATIAIGTATIAAFIGAGGFGERIVTGLALNDRELLVAGAVPAAVLALLSEGLFEVIEYWLRRGRAG
>NZ_LR594675.1|WP_162583846.1|4726937_4727726_-|alpha/beta-fold-hydrolase
MLINYVRRGQGKSLLLVHGLGSNWRSWQGIIEPLAERRSVTAIDLPGFGKSPPLDGEVSMQTMADALAQFLWEHELIGTDAAGSSVGGRLLLELARRGGVLGSVVSLGPGGFWLGWERFLFAASAWLSHGLARSLQSAMPSLIAHDWSRSLLMAQFSVAPAALSSSMVLEEMRSYASARSYGAVLRALLREPAQQGADAGSLTSPLVIGWGRLDRICLPRQAARAMQLYPGARLHWFERCGHFPHWDAPEETTRLILEATAD
>NZ_LR594675.1|WP_162581906.1|4725763_4726909_-|ROK-family-protein
MAPKNKAHKARPKKNNDNGSSNGSNPYAPPPPSADIHGAKELPAVLVEGYSLQLRGEQGFLGDQASQTAFRELLERWRRRVRKKGKPDPLGQQHSRDLAKGTLDAALRAGKATEATDVVHAAIEEFAESLAEVIDSFLRQPSWQGVERIVVGGGFPESDVGERAVLQAAAILQEMKVQVELARICHEPDDAGLLGWVHLTPPELLEHFDAILALDIGGTNVRCGIVKTRRKRAADLSRAKVLRREKWRHADDGPNRRELVARLAEMLEAQVRYCEKKGIRLAPFVGIGCPGLIRKDGSIARGAQNMPGDWTSEHFHLPTELAKKIPTIRGIPTMVLMHNDAVVQGLSELPFMRDLKRWAVLTIGTGMGNASYTNLEPPKKA
>NZ_LR594675.1|WP_162583845.1|4724399_4725767_+|phospholipase
MDDWLDWLPSPSQHLLVVTFALLVYVLTTRGRREHRAPATAIAWVMGLALLPYLILPTYLLFGQRKLRPSGSPRPSRSMPAGHWAADLIESFGLASPGPSPVRFHADGGAARDALWEVIEGAHTRIDVCTFIIGDDALGHEAINRLSRRAREGIKVRVLLDGFGALSLPRHHFDTLRDAGAEIAVFRPIFGLRRTGPRNLRNHRKLTIADDGWLWSGGRNLAGEYFLGNHEQPQPWRDLSFDLRGSVAAAAARQFDHDWGSVRGRKPRAITAEEPPAGELAQFLPSGPDQTEDTAHALLIDACFRAEHRLLAITPYFVPGDGLRDALRLAARRGVQVTIAMPARSNHPLADFVRARAMRDLARAGVSFRMLPFMAHAKAVVVDEQLALCGSINLDMRSLLLNHEAAVVFYGAEQIDWLAQWIETTASAGETYRARRPGLVRDVAEGLLLTIAFQL
>NZ_LR594675.1|WP_162581905.1|4723696_4724374_+|glutathione-S-transferase-N-terminal-domain-containing-protein
MKLFTGPLSMFGAKAQIAALEKGIAIEAVMVPFDKDDNYLPKHPEVLRVNPKRQVPVLIDGEVEVFDSTQIFEYLEDKVPEPPLWPRDVAARAGARQLEHLSDEVFFPHVIKLMGLQHDMGSEAAITACAACARFYEQMEQHLTQADYLAGPYSFADIAFYMAQVFADRKGAGMTDATPRLLAWRERVGARPAVRAVVGPMMRFLASEGRPVPAALQSHLGPVNA
>NZ_LR594675.1|WP_162581904.1|4722536_4723658_+|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase
MSEHARLPARYDHVGSFLRPQYLLEAREQKAKGEITPEQLRKVEDKAITEIVKFQEDIGLKSITDGEFRRTYFHIDFLEQLGGVKTDIPVTIRKPDGTEELAPPVMRVIDKVTHAKAIQLADFQYLKSQVSPGNTPKVTIPSPTMLHFRGGRAGISKQAYPELDPAFYDDVARAYGDELRSLAAAGCTYVQMDDTNLAYLCDEKMREAARQRGDDPNELPHRYAAFINKVVAQKPAGMTLAMHLCRGNFKSTHAAAGNYEPVAEALLKEMDLDAYFLEYDDARSGDFRPLRFLPKGKTVVLGLVTTKFGQLEDKDELKQRIEAAAKYVPLEQLALSPQCGFSSTVHGNKIAVDDQRNKLRLVVETAQEVWGST
>NZ_LR594675.1|WP_162581903.1|4721279_4722389_-|Rieske-2Fe-2S-domain-containing-protein
MSRSKSHFPLDAWYAAAYDVEVKHSLLARTVCNQKLVLYRRRDGQVAALEDACWHRLMPLSLGRLEGDELVCGYHGLVYNSQGRCTHMPSQETLNPSACVRAYPAVEKHRFVWIWPGDPAKADPALVPDMHWNDDPDWAGDGKMIRVACDYRLVVDNLMDLTHETFVHGSSIGNRAVAEAPFVATHGDRSATVTRWMENIDAPPFWAAQIRHARGYEGKVDRWQIIRFEGPCTVNIDVGVAPAGSGAVPREGHAGDRSRGVNGYVLNTITPETDTSCLYFWAFARNYCIGEQRLTHELREGVAGIFREDELVLEAQQRAMDERPGRDFNNLNIDAGAMWARRLIDQLIAKERPIASTIPIRPAPVAEGA
>NZ_LR594675.1|WP_162581902.1|4720530_4721376_-|FCD-domain-containing-protein
MGAPVDRSADREGAADRVHHPDPAGAGGGGRVSGGAEASEAGSSQAVKAQLRLREMVLAGELPGGTRIAEVAISEQLGVSRTPVRSALMRLEQEGLLEALPNGGYAVRTFSERDVADAIELRGTLEGLSARLAAERGAAPVVLREARACLRRIDELLREPALDDAAFSRYVEFNGQFHRLLSEMAGSPLLAQQMERVINLPFASPSAFVVVQANSPAARDMLVIAQDQHGQVLDAIENREGSRAESLMREHSRLAQRNLREALHGAHIHPLPGVQLIRRRA
>NZ_LR594675.1|WP_162581910.1|4732954_4733926_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MTLNRRDLVLGAVGVSLLASAAHAADAWPSKPVRIVVPYPPGGSSDIIARAISQPLSEALKQSVIVENRAGANGNLGADLVAKAPGDGYTLLLCDVGALAISPSVYTKLSFDPSKDLRGVTMLAYSPHLLVVHPSVQASSLKELVALSKKADLNFAVTATGSAPHLAGVALERASGARWQYVPYKGGVQAIQDTVGGQTQVLMNGMLATLPHVQSGKLKVLGVSKSTRMPLIGDVPTIAEQGVAGFESGTWQGLLAPRGTPDAVIQRLNKELVAIIRSADIRSRLAGQGAEVVTMTPAEQEQFFNKERARWAKVVDAAQIKLD
>NZ_LR594675.1|WP_162581911.1|4734047_4734860_-|FCD-domain-containing-protein
MSNLSTGTTAAAEPATSVERPRRRGRGLAHGLVDDLGEKIRSQQLRPGDKLPTESAIMQAYGVSRTVVREALSKLQAGGLVETHHGIGTFVLQPRAPGMFRLEASDIATTVDVLAVLELRISLETESAGLAATRRTEEQLAALRDALDDFERNVAVAGDTVAPDFRFHLQIAQATGNPYFADIMSHLGTTIIPRTRITAIRNHDRRGEYLSRVNREHEEIYAAIARGDPDSARAAMRIHLTNSRERLRVAQEAAQRESKAPAQGGEEPSA
>NZ_LR594675.1|WP_162581912.1|4734928_4735747_+|NAD-dependent-epimerase/dehydratase-family-protein
MSAPSSPPRLNRLLLTGAAGGLGKVLRERLRPFARTLRVSDIAALAPAEGSHEEVVPCDLSDNAAVDAMVAGCDAIVHLGGVSVERPFEEVLEANIKGVFHIYEGARRHGVKRVVFASSNHVIGFYKQSEKIDAHAARRPDGYYGLSKSFGEDVAQFYFDRWGIETVSIRIGSSFPEPANRRMMSTWLSYRDLTALIEKSLFTPDIGHMVVYGMSANRDVWWDNHAAAQLGFQPQDSSEVFRAKVEAQPPVAADDPNAVYQGGAFTAQGPFE
>NZ_LR594675.1|WP_174255734.1|4735817_4736813_+|TRAP-transporter-substrate-binding-protein
MTFSRTLMAACTAAAAFAWGATLPTPSQAQTMTLKAADVHPAGYPNVVAIEHMGKKLEEATKGRIKLQMFPGSVLGGEKEMIEQTQVGAIQILRTSLGPIGPVVPEVNVFNMPFVFRDEAHMRAVIDGPIGQEMLDKITASPAKLVGLGWMDGGSRSLYTKKPVRTPADLKGMKIRMMGNPLFVDTMNAMGGNGISMGYGEVFTAIQTGVVDGAENNPPTLFTANHYQAGAKYYTQTNHLIIPEIFVMSKVTWDKLSKDDQALVKKFSREAQMEQRALWDKSVADYTAKLKAAGVEFINIDNKPFYDATAPVRAKYGADYATLIKRIEATK
>NZ_LR594675.1|WP_162581913.1|4736830_4737361_+|TRAP-transporter-small-permease-subunit
MDPLFVRACDRLYLACIWLAGFAIFLMSLIIPWGVFTRYVLGTGSQWPEPVAILFMMVFTFIGAAAAYRAGAHIAVSMITDLLREPLKKALAVLVDLLMIVVCAFVAYYGTRLCMETWHQSISELPWLPVGVTYAALPAGSAVTLVFVIERMACGSQAHRNVVRYEEGADAPEGAR
>NZ_LR594675.1|WP_162581914.1|4737360_4738644_+|TRAP-transporter-large-permease-subunit
MDAFVLLGSFALLMMLGMPIAYALGLSALIGALWIDIPLDAVMIQLASGVNKFSLLAIPFFVLAGAIMAEGGMSRRLVAFAGVLVGFIRGGLSLVNILASTFFGAISGSSVADTASIGSVLIPEMERKGYPRDFATAVTVSGSVQAILIPPSHNAVLYSLAAGGSVSIASLFVAGVLPGLLMGLSLAVLCLVIASRKNYPKGEVIPLRQALKICLDAMWGLMTMVIILGGILSGVFTANESASIAVVWAFFVTMFIYRDYKWRDLPKLVHRTVKTVTIVMILIGFAASFGYMMTLMQIPLKVTTFFTSVSDNKYVVLMMINVMLLVLGTLMDMSPLILILTPILLPVVKLLGVDPVHFGMIMMVNLGIGLITPPVGTVLFVGSAVSKLSIGVVTRAAAPFLVALFLVLIAVTYVPALSLWLPRALGL
>NZ_LR594675.1|WP_162581915.1|4738663_4739677_+|beta-propeller-fold-lactonase-family-protein
MTAAVYVSNAESGDITVFSLDERTGTLTRRQDVAVGGTLMPMALSPDRRRLYVARRSAPLAVIGFSIDPASGRLAPLGEAPLAHSMAYIATDRSGRHLFSASYGGHLVAVNPIDADGKPQAARQIIPTGSNAHCVQADAANRHVYATCLGSGVVMHWHFDAASGTLAPAEPAAWEAPPGSGPRHFVFAPGGRFIYLLGELDGSITVLGVDAASGALTALQSLAMLPPGFTGEPWAADLHLTPDGRFLYACERRSSTLAIIAVDALDGRLAAPRYVPTEAQPRGFAIDARGLFLVAAGQLSHRVTLYAIDPDSGALAVRDTAAAGRDPNWVEIVALSE
>NZ_LR594675.1|WP_162581916.1|4739687_4741280_+|galactarate-dehydratase
MTPPLQATAPLTIHMHERDNVAIVANDGGLPAGTVFPSGLTLREKVPQAHKVALVDIPEGGEVRRYDVVIGYALKPIAAGSWVHERLLRMPAARALDGLPIATVKPPRQAPLEGYTFEGYRNPDGSVGTRNILAITQTVQCVAGVTEFAVQRIKAELLPKYPNVDDVVALEHGYGCGVAIDAPDAVIPIRTLRNISLNPNFGGEVMVVSLGCEKLQPERLLPPGTIPLIDERNVADIGATAEPKLDVVCLQDEAHVGFMSMVDAILRQAEEHLERLNARRRETVPASELVVGVQCGGSDAFSGVTANPAVGFCTDLLVRAGATVMFSEVTEVRDGIDQLTSRAATPEVAEAMIREMAWYDAYLDRGRVDRSANTTPGNKKGGLSNIVEKAMGSIVKSGSAPISGVVPPGEKARQKGLLYAATPASDFICGTLQLAAGINLHVFTTGRGTPYGLAEVPVIKVATRSELARRWHDLMDVNAGRIADGEASIEDVGWELFRLMLDVASGRRKTWAEHWKLHNALVLFNPAPVT
>NZ_LR594675.1|WP_162581917.1|4741294_4742059_+|glucose-1-dehydrogenase
MEDLKGRSALVTGASTGIGAAVARAYAARGMRVAVHYNASADPAKALVDAITADGGEAFALQGDVRDTQAIRRIVIETKARWGGIDVLVNNAGGLVQRVPIADFEDALFDEILHLNARSMLAFCREVVPLMRAQGRGGSIINVSSVAARHGGGPGAYLYAGAKGFVNTATHGLAKELAAERIRVNAVAPGVIQTPFHDRYSTPQMLESFKATIPMARIGDPDDCVGAFLYLASEQLSGYVTGQILEVNGGQYMP
>NZ_LR594675.1|WP_162581918.1|4742086_4743184_+|beta-propeller-fold-lactonase-family-protein
MHKAFTSRALRRVALLLAAGLGAVGTSACAATWVYVSNADSQEISVLELDRGQGTLKPIETVNVGGMAMPMAVSPDKRFLYAALRSQPFRVVSFSIDGASGRLKKLGEAPLADSMANIDTDQTGRWLFAASYPGHKITVNSIDKTGAVGAIQQLLPTAPNAHAIHADASNRFVLATSLGGDHISSWRFDAEAGVLSPNEPALTTGTAKSGPRHFVWDKAQRFVYLLDELDARLHVYAWDSARGTLQLQQSTTTLPEGFTGKPWAADLHLTPDGRYLYASERTSSTLSAFKVDAATGRLQPLGQAPTEKTPRGFAIDPSGRFLVAVGQESHSASVHPIDAATGALGTPQRLTVGKNPNWVEIVEAP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

537736 : 549938

Bacillus_phage(66.67%)

tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162578228.1\|537736_539758_-\|plate	putative baseplate assembly protein	NA	NA	NA	NA
WP_162578229.1\|539819_542012_-\|plate	putative baseplate assembly protein	NA	NA	NA	NA
WP_162578230.1\|542008_542416_-	GPW/gp25 family protein	A0A127AW49	Bacillus_phage	4.0e-06	30.7
WP_162578231.1\|542412_543174_-	hypothetical protein	NA	NA	NA	NA
WP_162578232.1\|543181_543748_-	hypothetical protein	NA	NA	NA	NA
WP_162578233.1\|543744_544887_-	phage late control D family protein	NA	NA	NA	NA
WP_162578234.1\|544886_545543_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_162578235.1\|545539_545722_-	hypothetical protein	NA	NA	NA	NA
WP_162578236.1\|545721_546243_-\|tail	phage tail protein	NA	NA	NA	NA
WP_162578237.1\|546239_547823_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A2I7SAT7	Vibrio_phage	8.3e-07	28.9
WP_162578238.1\|547832_548294_-\|tail	phage tail protein	NA	NA	NA	NA
WP_162578239.1\|548324_549938_-\|tail	phage tail sheath subtilisin-like domain-containing protein	J9PVC2	Bacillus_phage	5.4e-62	32.0

DBSCAN-SWA_2

3090366 : 3098773

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162580486.1\|3090366_3090894_-	HNH endonuclease	B6V2J8	Bacillus_phage	4.7e-15	33.1
WP_162583724.1\|3090890_3091589_-	FAD-dependent thymidylate synthase	A0A1C9C5C1	Heterosigma_akashiwo_virus	1.6e-50	47.2
WP_162580487.1\|3091612_3092719_-	metallophosphoesterase	NA	NA	NA	NA
WP_162580488.1\|3092942_3093437_-	hypothetical protein	NA	NA	NA	NA
WP_162580489.1\|3093390_3093666_-	hypothetical protein	NA	NA	NA	NA
WP_162577775.1\|3093658_3093817_-	hypothetical protein	B8QTY5	Erwinia_phage	2.0e-06	41.3
WP_162580490.1\|3093813_3097380_-	hypothetical protein	A0A2I6PHX0	Pseudomonas_phage	2.6e-64	24.8
WP_162580491.1\|3097346_3097745_-	hypothetical protein	NA	NA	NA	NA
WP_162580492.1\|3097732_3097981_-	hypothetical protein	NA	NA	NA	NA
WP_162580493.1\|3097980_3098547_-	hypothetical protein	A0A2L1IVT5	Streptomyces_phage	2.8e-13	32.4
WP_162580494.1\|3098521_3098773_-	hypothetical protein	A0A2I6PI02	Pseudomonas_phage	3.8e-07	44.8

DBSCAN-SWA_3

3160156 : 3168823

Cyanophage(33.33%)

head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162580584.1\|3160156_3163288_+	hypothetical protein	A0A127KLS6	Cyanophage	2.8e-06	29.4
WP_162580585.1\|3163436_3163760_+	hypothetical protein	NA	NA	NA	NA
WP_162580586.1\|3163756_3164152_+	hypothetical protein	A0A1B1IQ35	uncultured_Mediterranean_phage	1.2e-15	60.9
WP_162583728.1\|3164476_3165211_+\|head	head decoration protein	K7YBB0	uncultured_Mediterranean_phage	3.6e-29	47.6
WP_162580587.1\|3165210_3165693_+	hypothetical protein	A0A162E1U5	Tsukamurella_phage	6.0e-17	51.2
WP_162580588.1\|3165689_3166394_+	hypothetical protein	NA	NA	NA	NA
WP_162580589.1\|3166404_3166665_+	hypothetical protein	NA	NA	NA	NA
WP_162580590.1\|3166716_3166944_+	hypothetical protein	NA	NA	NA	NA
WP_162580591.1\|3166958_3167288_+	hypothetical protein	NA	NA	NA	NA
WP_162580592.1\|3167289_3167550_+	hypothetical protein	NA	NA	NA	NA
WP_162580593.1\|3167546_3167834_+	hypothetical protein	NA	NA	NA	NA
WP_162580594.1\|3167830_3168430_+	DUF3380 domain-containing protein	A0A2P1CKX8	Pantoea_phage	1.7e-29	40.8
WP_162580595.1\|3168499_3168823_+	hypothetical protein	A0A1D7SM88	Cyanophage	1.6e-05	36.4

DBSCAN-SWA_4

4661323 : 4669103

Burkholderia_virus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162581849.1\|4661323_4662592_+	recombinase RecT	A0A0F6TJP0	Escherichia_coli_O157_typing_phage	2.4e-57	48.6
WP_162581850.1\|4662618_4663422_+	YqaJ viral recombinase family protein	A0A2I7RGP6	Vibrio_phage	7.9e-06	27.1
WP_162581851.1\|4663456_4663888_+	hypothetical protein	NA	NA	NA	NA
WP_162581852.1\|4663948_4664296_+	hypothetical protein	NA	NA	NA	NA
WP_162581853.1\|4664298_4665120_+	DUF2303 family protein	I6NVL7	Burkholderia_virus	4.0e-29	32.7
WP_162581854.1\|4665122_4665323_+	hypothetical protein	NA	NA	NA	NA
WP_162581855.1\|4665319_4665943_+	DnaJ domain-containing protein	A0A0G2YAM9	Acanthamoeba_polyphaga_mimivirus	2.7e-09	40.0
WP_162581856.1\|4665942_4666149_+	hypothetical protein	NA	NA	NA	NA
WP_162581857.1\|4666145_4667213_+	DUF5131 family protein	Q6JIJ3	Burkholderia_virus	4.0e-98	56.0
WP_162581858.1\|4667209_4667416_+	hypothetical protein	NA	NA	NA	NA
WP_162581859.1\|4667412_4667835_+	ASCH domain-containing protein	A0A291AUQ6	Sinorhizobium_phage	1.1e-27	47.2
WP_162583839.1\|4668043_4668304_+	hypothetical protein	NA	NA	NA	NA
WP_162581860.1\|4668296_4669103_+	DUF1768 domain-containing protein	A0A1X7QH77	Faustovirus	5.0e-16	35.0

DBSCAN-SWA_5

5140451 : 5150886

Vibrio_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162582251.1\|5140451_5141309_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	4.3e-42	37.8
WP_162582252.1\|5141286_5142198_-	alpha/beta fold hydrolase	G1BRG0	Mycobacterium_phage	2.7e-10	27.3
WP_174255805.1\|5142231_5143092_-	2OG-Fe(II) oxygenase	A0A0G2Y3F6	Acanthamoeba_polyphaga_mimivirus	1.2e-20	32.8
WP_162582254.1\|5143070_5143856_-	peroxide stress protein YaaA	NA	NA	NA	NA
WP_162582255.1\|5144143_5147014_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.1e-142	39.3
WP_162582256.1\|5147100_5147991_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-68	49.3
WP_162582257.1\|5147971_5149090_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_162582258.1\|5149102_5149330_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_162583882.1\|5149361_5149919_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_162583883.1\|5149983_5150886_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	2.0e-58	42.5

DBSCAN-SWA_6

5783542 : 5794196

Acinetobacter_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162582976.1\|5783542_5784139_-	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.2e-11	31.1
WP_162582977.1\|5784138_5784522_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_162582978.1\|5784753_5785947_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	9.0e-14	28.7
WP_162582979.1\|5786555_5787260_-	uracil-DNA glycosylase	A0A0B5IW78	Pandoravirus	3.4e-45	47.2
WP_162582980.1\|5787256_5788057_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	5.2e-58	51.3
WP_162582981.1\|5788069_5789095_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.1e-76	44.7
WP_162582982.1\|5789148_5790198_-	low-specificity L-threonine aldolase	NA	NA	NA	NA
WP_162582983.1\|5790202_5790787_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	6.0e-56	55.8
WP_162582984.1\|5790783_5791173_-	GxxExxY protein	NA	NA	NA	NA
WP_162582985.1\|5791172_5792675_-	anthranilate synthase component I	S4VT78	Pandoravirus	1.8e-35	29.6
WP_162582986.1\|5792916_5793423_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_162582987.1\|5793419_5794196_-	SDR family NAD(P)-dependent oxidoreductase	W8CYX9	Bacillus_phage	4.2e-12	45.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LR594677

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_LR594675

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection