CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LR699004	Bacteroides dorei isolate MGYG-HGUT-02478 chromosome 1	1 crisprs	WYL,cas2,cas1,cas4,cas7,cas8c,cas5,cas3,DinG,csa3,PD-DExK,PrimPol,DEDDh	6	4	4	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LR699004_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR699004_1

571313-571613

TypeI

I-C:NA

Consensus_repeat	Method
GTTTCAATCCNNACACACCCACGTAGGGTGTGACTT	CRT
AGTTTCAATCCACACACCCACGTAGGGTGTGAC	CRISPRCasFinder
GTTTCAATCCACACACCCACGTAGGGTGTGACT	PILER-CR

4 spacers

cas2,cas1,cas4,cas7,cas8c,cas5,cas3

The CRISPR arrays of NZ_LR699004_1

>merge|NZ_LR699004|1|571313-571613|CRT,CRISPRCasFinder,PILER-CR
TCCAATCCATATATTCCCACGCAGGGTGTGACTTTATGGAAGCAGAAGTAAAACAAGTAATCAAAGTTTCAATCCACACACCCACGTAGGGTGTGACTTTGGAGTCGGGCTTGTCTTTCTCCTTGTCCAAGAGTTTCAATCCACACACCCACGTAGGGTGTGACCTCGTATTAGTTGACAATGTAGAGATGGACATAAATAGTTTCAATCCACACACCCACGTAGGGTGTGACTTAACAGCTATCTATTTAAAAAACAAGTTTCTTGGTTTCAATCCACACACCCACGTAGGGTGTGACTC

>NZ_LR699004|1|1|571313-571613|CRT
TCCAATCCATATATTCCCACGCAGGGTGTGACTT	TATGGAAGCAGAAGTAAAACAAGTAATCAAA
GTTTCAATCCACACACCCACGTAGGGTGTGACTT	TGGAGTCGGGCTTGTCTTTCTCCTTGTCCAAGA
GTTTCAATCCACACACCCACGTAGGGTGTGACCT	CGTATTAGTTGACAATGTAGAGATGGACATAAATA
GTTTCAATCCACACACCCACGTAGGGTGTGACTT	AACAGCTATCTATTTAAAAAACAAGTTTCTTG
GTTTCAATCCACACACCCACGTAGGGTGTGACTC

>NZ_LR699004|1|1|571377-571611|CRISPRCasFinder
AGTTTCAATCCACACACCCACGTAGGGTGTGAC	TTTGGAGTCGGGCTTGTCTTTCTCCTTGTCCAAG
AGTTTCAATCCACACACCCACGTAGGGTGTGAC	CTCGTATTAGTTGACAATGTAGAGATGGACATAAAT
AGTTTCAATCCACACACCCACGTAGGGTGTGAC	TTAACAGCTATCTATTTAAAAAACAAGTTTCTT
GGTTTCAATCCACACACCCACGTAGGGTGTGAC

>NZ_LR699004|1|1|571378-571612|PILER-CR
GTTTCAATCCACACACCCACGTAGGGTGTGACT	TTGGAGTCGGGCTTGTCTTTCTCCTTGTCCAAGA
GTTTCAATCCACACACCCACGTAGGGTGTGACC	TCGTATTAGTTGACAATGTAGAGATGGACATAAATA
GTTTCAATCCACACACCCACGTAGGGTGTGACT	TAACAGCTATCTATTTAAAAAACAAGTTTCTTG
GTTTCAATCCACACACCCACGTAGGGTGTGACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR699004.1\|WP_007843550.1\|573095_573761_-\|CRISPR-associated-protein-Cas4	cas4	pfam01930_cas4_CAS-I	gnl\|CDD\|273040
NZ_LR699004.1\|WP_038604780.1\|580484_581849_-\|histidine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234586
NZ_LR699004.1\|WP_007843553.1\|573770_574622_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	cd09689_cas7_CAS-I-C	gnl\|CDD\|377458
NZ_LR699004.1\|WP_007831010.1\|560721_561306_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_LR699004.1\|WP_008655269.1\|572076_573099_-\|type-I-C-CRISPR-associated-endonuclease-Cas1	cas1	cd09721_cas1_CAS-I-C	gnl\|CDD\|188360
NZ_LR699004.1\|WP_038604777.1\|577926_580152_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
NZ_LR699004.1\|WP_038604771.1\|569670_570861_+\|[FeFe]-hydrogenase-H-cluster-maturation-GTPase-HydF	unknown	unknown	gnl\|CDD\|274853
NZ_LR699004.1\|WP_008655271.1\|565489_566953_+\|4Fe-4S-dicluster-domain-containing-protein	unknown	unknown	gnl\|CDD\|274983
NZ_LR699004.1\|WP_038604759.1\|558452_559868_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_LR699004.1\|WP_038604774.1\|574643_576365_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|378245
NZ_LR699004.1\|WP_007855618.1\|571776_572067_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
NZ_LR699004.1\|WP_005842327.1\|563157_564795_-\|chaperonin-GroEL	unknown	unknown	gnl\|CDD\|234573
NZ_LR699004.1\|WP_008655266.1\|582009_582858_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380625
NZ_LR699004.1\|WP_007831003.1\|561341_562694_-\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240548
NZ_LR699004.1\|WP_038607545.1\|567152_568190_+\|[FeFe]-hydrogenase-H-cluster-radical-SAM-maturase-HydE	unknown	unknown	gnl\|CDD\|274880
NZ_LR699004.1\|WP_038607548.1\|576361_577054_-\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09651_cas5_CAS-I-C	gnl\|CDD\|187782
NZ_LR699004.1\|WP_038604768.1\|568202_569621_+\|[FeFe]-hydrogenase-H-cluster-radical-SAM-maturase-HydG	unknown	unknown	gnl\|CDD\|274879
NZ_LR699004.1\|WP_007843558.1\|577055_577916_-\|Bro-N-domain-containing-protein	unknown	unknown	gnl\|CDD\|214989
NZ_LR699004.1\|WP_005842331.1\|564836_565109_-\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988
NZ_LR699004.1\|WP_038607542.1\|559992_560532_-\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|239474

Protein	Function_ID	Function_description	E-value
NZ_LR699004.1\|WP_007843550.1\|573095_573761_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|273040	TIGR00372, conserved_hypothetical_protein, CRISPR-associated protein Cas4. This model represents a family of proteins associated with CRISPR repeats in a wide set of prokaryotic genomes. This scope of this model has been broadened since it was first built to describe an archaeal subset only. The function of the protein is undefined. Distantly related proteins, excluded from this model, include ORFs from Mycobacteriophage D29 and Sulfolobus islandicus filamentous virus and a region of the Schizosaccharomyces pombe DNA replication helicase Dna2p.	2.59196e-24
NZ_LR699004.1\|WP_038604780.1\|580484_581849_-\|histidine--tRNA-ligase	gnl\|CDD\|234586	PRK00037, hisS, histidyl-tRNA synthetase; Reviewed.	8.92584e-146
NZ_LR699004.1\|WP_007843553.1\|573770_574622_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|377458	pfam05107, Cas_Cas7, CRISPR-associated protein Cas7. CRISPR-associated protein Cas7 is one of the components of the type I-B cascade-like antiviral defense complex. In Haloferax volcanii, Cas5, Cas6 and Cas7 form a small complex that aids the stability of CRISPR-derived RNA.	6.17062e-151
NZ_LR699004.1\|WP_007831010.1\|560721_561306_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	1.21416e-14
NZ_LR699004.1\|WP_008655269.1\|572076_573099_-\|type-I-C-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|188360	TIGR03640, cas1_DVULG, CRISPR-associated endonuclease Cas1, subtype I-C/DVULG. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the DVULG subtype of CRISPR/Cas system.	7.00337e-169
NZ_LR699004.1\|WP_038604777.1\|577926_580152_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	6.21741e-50
NZ_LR699004.1\|WP_038604771.1\|569670_570861_+\|[FeFe]-hydrogenase-H-cluster-maturation-GTPase-HydF	gnl\|CDD\|274853	TIGR03918, hydrogenase_maturation_GTPase_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF. This model describes the family of the [Fe] hydrogenase maturation protein HypF as characterized in Chlamydomonas reinhardtii and found, in an operon with radical SAM proteins HydE and HydG, in numerous bacteria. It has GTPase activity, can bind an 4Fe-4S cluster, and is essential for hydrogenase activity. [Protein fate, Protein modification and repair].	0
NZ_LR699004.1\|WP_008655271.1\|565489_566953_+\|4Fe-4S-dicluster-domain-containing-protein	gnl\|CDD\|274983	TIGR04105, hypothetical_protein, [FeFe] hydrogenase, group B1/B3. See for descriptions of different groups.	0
NZ_LR699004.1\|WP_038604759.1\|558452_559868_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	1.41122e-19
NZ_LR699004.1\|WP_038604774.1\|574643_576365_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|378245	pfam09709, Cas_Csd1, CRISPR-associated protein (Cas_Csd1). CRISPR loci appear to be mobile elements with a wide host range. This entry represents proteins that tend to be found near CRISPR repeats. The species range, so far, is exclusively bacterial and mesophilic, although CRISPR loci are particularly common among the archaea and thermophilic bacteria. Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins.	0
NZ_LR699004.1\|WP_007855618.1\|571776_572067_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	1.94761e-26
NZ_LR699004.1\|WP_005842327.1\|563157_564795_-\|chaperonin-GroEL	gnl\|CDD\|234573	PRK00013, groEL, chaperonin GroEL; Reviewed.	0
NZ_LR699004.1\|WP_008655266.1\|582009_582858_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380625	cd19970, PBP1_ABC_sugar_binding-like, monosaccharide ABC transporter substrate-binding protein. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.	3.08486e-99
NZ_LR699004.1\|WP_007831003.1\|561341_562694_-\|MATE-family-efflux-transporter	gnl\|CDD\|240548	cd13143, MATE_MepA_like, Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Streptococcus aureus MepA. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. This subfamily includes Streptococcus aureus MepA and Vibrio vulnificus VmrA and functions most likely as a multidrug efflux pump.	1.01859e-111
NZ_LR699004.1\|WP_038607545.1\|567152_568190_+\|[FeFe]-hydrogenase-H-cluster-radical-SAM-maturase-HydE	gnl\|CDD\|274880	TIGR03956, iron-only_hydrogenase_maturation_rSAM_protein_HydE, [FeFe] hydrogenase H-cluster radical SAM maturase HydE. This model describes the radical SAM protein HydE, one of a pair of radical SAM proteins, along with GTP-binding protein HydF, for maturation of [Fe] hydrogenase in Chlamydomonas reinhardtii and numerous bacteria. [Protein fate, Protein modification and repair].	0
NZ_LR699004.1\|WP_038607548.1\|576361_577054_-\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|187782	cd09651, Cas5_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex; in subtype I-C this protein might be the endoribonuclease that generates crRNAs; also known as DevS family.	6.40743e-83
NZ_LR699004.1\|WP_038604768.1\|568202_569621_+\|[FeFe]-hydrogenase-H-cluster-radical-SAM-maturase-HydG	gnl\|CDD\|274879	TIGR03955, iron-only_hydrogenase_maturation_rSAM_protein_HydG, [FeFe] hydrogenase H-cluster radical SAM maturase HydG. This model describes the radical SAM protein HydG. It is part of an enzyme metallocenter maturation system, working together with GTP-binding protein HydF and another radical SAM enzyme, HydE, in H-cluster maturation in [FeFe] hydrogenases. [Protein fate, Protein modification and repair].	0
NZ_LR699004.1\|WP_007843558.1\|577055_577916_-\|Bro-N-domain-containing-protein	gnl\|CDD\|214989	smart01040, Bro-N, BRO family, N-terminal domain. This family includes the N-terminus of baculovirus BRO and ALI motif proteins. The function of BRO proteins is unknown. It has been suggested that BRO-A and BRO-C are DNA binding proteins that influence host DNA replication and/or transcription. This Pfam domain does not include the characteristic invariant alanine, leucine, isoleucine motif of the ALI proteins.	7.56054e-18
NZ_LR699004.1\|WP_005842331.1\|564836_565109_-\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	1.52028e-44
NZ_LR699004.1\|WP_038607542.1\|559992_560532_-\|carbonic-anhydrase	gnl\|CDD\|239474	cd03379, beta_CA_cladeD, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	1.64668e-59

>NZ_LR699004.1|WP_038604771.1|569670_570861_+|[FeFe]-hydrogenase-H-cluster-maturation-GTPase-HydF
MSLNNTPSANRLHVALFGRRNSGKSSLINALTGQDTALVSDIPGTTTDTVSKAMEIQGIGPCLFIDTPGFDDEGELGEMRIIRTLKAIERTDIALLLCEDEAHEEEKKWMKQLEEKNIPVILLLNKADIRKDIASTLLRIEKDCGQKPLVISAKERTGIKKIHQAILEKLPADFGQQTITGNLAKEGDLVLLVMPQDIQAPKGRLILPQVQTMRELLDKKCLVVSCTTDQIASTLQALSRPPKLIITDSQVFHTVYEQKPADSLLTSFSVLMAGYKGDIHHYIEGASAIDCLTPQSRVLIAEACTHAPATEDIGRVKLPRMLRKKIGEELQIDIVAGTDFPEDLTPYHLIIHCGACMFNRKYVLNRIDNARKQQIPMTNYGVAIAHLNGILDKIAY
>NZ_LR699004.1|WP_038604768.1|568202_569621_+|[FeFe]-hydrogenase-H-cluster-radical-SAM-maturase-HydG
MYKADSKIAEEFIDHQEILETLEYARSNKSNRALIEQLIDKAARCKGLSHREAALLLECDQPDLIERIFHLAQEIKHKFYGNRIVMFAPLYLSNYCVNGCVYCPYHLKNKTIARKKLTQEEIRKEVIALQDMGHKRLALEAGEDPLRNPIEYILESIRTIYSIKHKNGAIRRVNVNIAATTVENYRKLKDAGIGTYILFQETYHKENYEALHPTGPKSKYAYHTEAMDRAMEAGIDDVGLGVLFGLNTYRYDFVGLLMHAEHLEATFGVGPHTISVPRICPADDIATQDFPDAISDEIFCKIVAVIRIAVPYTGMIISTRESAATRRKVLNLGISQISGGSRTSVGGYAIPETPEENSAQFDISDTRTLDEVVNWLLDLGHIPSFCTACYREGRTGDRFMSLVKSGQIANCCAPNALMTLKEYLEDYATADTRAKGIQLIKKELEHIPNPKIKEIATRNLKKIEEGKRDFRF
>NZ_LR699004.1|WP_038607545.1|567152_568190_+|[FeFe]-hydrogenase-H-cluster-radical-SAM-maturase-HydE
MKQLIDKLRHKHSLTGEEYAILLTCQDADTLMYLQQQAQEVTLAHFGNAIFIRGLIEVGNRCRNNCYYCGIRKGNPAVARYALKRETILECCREGYALGFRTFVMQGGEDPALTDEWIEATVAAIRNEFSDCAITLSLGEKSREAYERFFRAGANRYLLRHETHNEQHYRKLHPEEMSLKHRLQCLQWLKEIGYQTGTGIMVGSPGQTLPHLVEDLLFIEQFHPQMIGIGPFIPHHETPFGMEPAGSVEMTLKLLSLFRLMHPSALIPSTTALATLSPDGREKGILAGANVVMPNLSPREQREKYALYDNKAAFGAEAAEGLRNLAQRLETIGYRISTDRGDYNH
>NZ_LR699004.1|WP_008655271.1|565489_566953_+|4Fe-4S-dicluster-domain-containing-protein
MAFTNNIMIVRHRLLTELVKLWKNGELTTDKIDRLPLELSPRRSKHAGRCCVHKERAVWKYKSLPLLGLDMDDETDELTPLSEYAARAIERANNGKPKDNIMCVIDEACSACVQINYEITDLCRGCTARSCQYNCPKGAVHVHADTGKAWIDHDTCISCGICHKSCPYHAIVYIPVPCEESCPVKAISKDEHGIEHIDENKCIYCGKCMNACPFGAIFEISQTFDVLQRIRKGEQVVAIVAPSILGQFSTTIEQVYGAFRQIGFTDIIEVAQGAMSTVEHEAHELIEKLEEGQKFMTTSCCPSYIELVNKYIPDMKKYVSGTGSPMYYAARIAKEKYPDAKIVFVGPCVAKRKEAQRDEAVDFVMTFEEVSSIFDAFEVNLEIVQPYAMEFSSVREAHGFAQAGGVMGAVKAFLKMEADKINAIQVSDLNKKNIGTLRAYAKSGKAPGQFIEVMACEGGCITGPSTHSGSNGKRQLVQELAKQEKTY
>NZ_LR699004.1|WP_005842331.1|564836_565109_-|co-chaperone-GroES
MNIKPLADRVLILPAPAEEKTIGGIIIPDTAKEKPLQGEVVAIGNGTKDEEMVLHVGDQVLYGKYSGTELEHDGKKYLIMRQSDVLAVLG
>NZ_LR699004.1|WP_005842327.1|563157_564795_-|chaperonin-GroEL
MAKDIKFNIDARDELKKGVDELANAVKVTLGPKGRNVIIEKKFGAPHITKDGVTVAKEVELADAFQNTGAQLVKSVASKTGDDAGDGTTTATVLAQSIVGVGLKNVTAGANPMDLKRGIDKAVAKVVESIKSQAEMVGDNYDKIEQVAAVSANNDPTIGKLIADAMRKVSKDGVITIEEAKGTDTTIGVVEGMQFDRGYLSAYFVTDTEKMECVMEHPYILIYDKKISNLKDFLPILEPAVQSGRPLLVIAEDVDSEALTTLVVNRLRSQLKICAVKAPGFGDRRKAMLEDIAVLTGGIVISEEKGLKLEQATLEMLGTCDKVTVSKDNTTIVNGAGAKENIQERINQIKAEIKNTTSDYDKEKLQERLAKLSGGVAVLYVGAASEVEMKEKKDRVDDALCATRAAIEEGIVPGGGVAYIRASEALEGLKGDNEDETTGIEIIKRAIEEPLRQIVANAGKEGAVVVQKVREGKGDFGYNARTDVYENLHAAGVVDPAKVTRVALENAASIAGMFLTTECVIVEKKEDKPEMPMGAPGMGGMGGMM
>NZ_LR699004.1|WP_007831003.1|561341_562694_-|MATE-family-efflux-transporter
MKDSIDFGSMEIPKLFRKLLIPTVLGMVFSAVFVITDGIFVGQGIGSDALAAVNITAPLFLISTGIGLMFGVGASVVASIHLSQGKLKAARINVTQAVVVSSLFLAVLWGVVCLFAPQVAVWLGSSERLLPLAVEYMYWFLPFLVFSALLSSGMFFVRLDGSPNYAMLCNAIPAVVNILLDYVFIFIFKWGMMGAALATSLGYILGAGMIVVYLSRRKNVIHFCRVKLSKKSMRLTWRNVRYMCHLGASTFLCEAAIACMMFAGNYVFIHYLGEDGVAAFSIACYFFPIIFMVYNAIGQSAQPILSYNFGAGDAMRVRSAFRLALGTAVTCGLVFFALTALFNHQIVAMFIDRSYPAYDIAVAGLPLFASGFIFFAVNIVSIGYFQSVERARPAMMITVLRGFVFMVLCLFGLPLLLKVPGIWLAVPLAEILTFLVIMAIYYRKHQWVRR
>NZ_LR699004.1|WP_007831010.1|560721_561306_-|Crp/Fnr-family-transcriptional-regulator
MDAFIQKFCEKYSLPIALSLQLLDNMEKFTFRKGDFLVQEGGRNSNFYIVSKGIWRGHYLNDGVDVSVWFASEGEAIFSSWGYVENTASLVSIEAMCDSELYGISKAKLEVLYAESVELANFGRRLFEQQLLGLESWMITGGSPRAKERYLTLLEENPELLQYVPLKHIASYLWITPQSLSRIRAELGRRKKDQ
>NZ_LR699004.1|WP_038607542.1|559992_560532_-|carbonic-anhydrase
MIDDILEFNKKFIESKGYEKYITNKYPDKKIAILSCMDTRLTELLPAALGIKNGDVKIIKNAGGVISHPFGSVIRSLMVAIYELGVKEVMVVAHSDCGACHMNSNEMIEHMKARGIKQETIDMIRFCGVDFGAWLDGFEDTEKSVKGTVRAIMEHPLIPEDIMVRGFIIDSVTGELTKV
>NZ_LR699004.1|WP_038604759.1|558452_559868_+|Gfo/Idh/MocA-family-oxidoreductase
MIKNLSTFFVGIALLCLAGCTPIPKETTATKEYTPLEVPVPERPAGQQDVIELITPKLDTVRVGFIGLGMRGPSAVERWTHIPGTKIVALCDLLPENAEKAQKIVTNAGMEAPALYSGSEDAWKQLCERNDIDLVYIATDWKHHAEMGIYAMEHGKHAAIEVPAAMSLDEIWALINTSEKTRKHCMQLENCVYDFFELTTLNMAQKGLFGEVLHVEGSYIHNLEEFWPYYWNNWRLDYNREFRGDIYATHGLGPACQLLNIHRGDRMKTLVAMDTKAVTGPELVKQYQKEEAPDFQNGDHTMTFIRTENGKTIHIQHDVMNPRPYSRMYQLTGTKGFANKYPIEQYCFRPDQIDSTSIPDHENLSMHSAVPEKVKETLMSQYKHPIHQELEETAKKIGGHGGMDFIMDYRLVYCLRNGLPLDMDVYDLAEWCCMADLTRLSIENGNAPVAVPDFTRGNWNKVDGYHHAFAQ
>NZ_LR699004.1|WP_007855618.1|571776_572067_-|CRISPR-associated-endonuclease-Cas2
MYILVTYDVDTTSKEGARRLRCVAKACLDYGQRVQNSVFECVVTEAQYSLLKGRVRDIIDMSLDSVRFYILSKNENKRVEVIGVETAYKVEEALII
>NZ_LR699004.1|WP_008655269.1|572076_573099_-|type-I-C-CRISPR-associated-endonuclease-Cas1
MRKLLNTLYVTTPEAYLSKDGLNVVISVQQEEVFRIPVINIEGIVTFGYMGASPGVMKLCSDNGISLTFLSPQGRFISRVQGATKGNVLLRKKQYQLSDDASWSLHVVRLMIGGKIQNYRNILRRYIRDYGENEDINRAVQVLERAKRDVLKAQDKTELIGYEGMASNAYFEVLPILILNQKTDFPFHGRNRRPPKDAVNAMLSFAYTLIANDVAAALETVGLDPYVGFLHTLRPGRTSLALDMMEELRAYLGDRFILSLINKRQISVKDFLFQGDNGVVMTDKGKKTFITAWQARKREVIIHPYLNEKVEIGLLPYVQAMLMARYIRQDIDDYPVFLIK
>NZ_LR699004.1|WP_007843550.1|573095_573761_-|CRISPR-associated-protein-Cas4
MYNEDDMLMLSGIQHFRFCPRQWALIHIEQQWGDNRLTIEGQILHKHVDDPFYRQKCGDQITLRAVNIASRELGLYGISDAIELFPSSSLENTILHPNYPGRWQPVAVEYKHGKPKRNEVDEVQLAAQIMCIEEMYAIHIPYGAFFYGELRHRVNVDITEELRDIVRQCARDMHDIFSKAVIPKAEYGKHCDKCSLKDICMPEMVNNCTSVDNYLTKNLYL
>NZ_LR699004.1|WP_007843553.1|573770_574622_-|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MSELKNRIDFVYIFDVKDGNPNGDPDAGNLPRVDAETGMGLVTDVCLKRKVRNYVQIAKGLVNGFDIFIKEKAVLNTLIDNAHDDSEVKNAKDKIEAARRFMCNNYFDIRTFGAVMSTGKNAGQVRGPIQFTFARSIDPIAVAEHSITRMAVATEKEAEKQDGGNRTMGRKATIPYGLYVCHGFISANLAQQTGFSEEDLELFWNALKNMFDVDRSAARGLMSAQKLIVFKHDSILGNAPANKLFELVKVEKVCDGAPRSFIDYSVTIDKENAPSNVTIEELI
>NZ_LR699004.1|WP_038604774.1|574643_576365_-|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MILKALYDYYHRSGDDVAPFGLEYKEIGFIIVIDRCGNFLRFEDRRIDKKSAQQFLVKKSVSRSSAPVANYLYDNCKYVFGYSDKGDMEKIRKYFEVFKAKVKDIYDAFPDNEDIKAVYAFYQQDHSFIVGAMQKDSLWDDIAKNLNKKYSTFSFLIEGDTKIVASKTELINLFEENHGVVGNLCLITGRYSKVVEITTATKILGSQETAKLVAFQVNSGYDSYGKSKGYNAPISEEAEFAYTTALNHLLRSDSHNRFMVGSRTYLFWASSNSEASKESENSLFSLLGRIEEENDDPNRRIKLVYDTFQSIYNGKLSANDDDKFFILGLAPNSARIAVVYWNEMPLREFAGLISKHFTDMEMVDTRKDKKPYLGLHSILGNVTLGGKSSDATPNLPDAVVRSIFQGLPYPASLFQACIRRIRTEQSVNIVRAAIIKAYLNRLNENNNHKKLDVMLDKENQNQGYLCGRLFAVLDKIQEDANGIHSIRERYMNAASATPSMVFATVLNLSTHHIEKLNPGGQVFYEKLKQEIISKLDAKGFPPHLNLQDQGRFFVGYYHQRQDLFMNKENKEME
>NZ_LR699004.1|WP_038607548.1|576361_577054_-|type-I-C-CRISPR-associated-protein-Cas5
MEYTDKEYCLEVWGDWACFTRPELKVERVSYDVITPSAARAIFEAILFKRYAMRWQITKIEVLRPIKWATIRRNEVGAVVNSSMKPIYIDDGKTRQQKNTLLLLDVRYRIYAKLVFIPVKDRPKEAFAKHQPSADENPMKYYQMFERRASQGQCFTQPYLGCREFSANWKYIESTDNLDNPLAEDRDFGIMLYDMDFEENPQKPNAMFYRAQMKKGVIVVPDKDSEEVLR
>NZ_LR699004.1|WP_007843558.1|577055_577916_-|Bro-N-domain-containing-protein
MTKKETLKLFEERKVRTVWDDEKEKWYFSIVDVVSVLTDSVDATAYWRKLKQRLKEEGNETVTNCHGLKMKAADGKMRLTDVADTEQLLRIIQSIPSPKAEPFKQWMAHVASERLDQMQDPELSIEQAMMDYKRLGYSDNWINQRLKSIEIRKDLTDQWKLHNVEEGVQYATLTDIIYQQWAGKSAKEYKQFKGLKKENLRDNMTNEELVLNMLAELSTTSITKAKNPQTLGENMQCAADGGDVARVAREQLEQKTGREVVTPLSAKRFFEGQKPEDLLENKENDE
>NZ_LR699004.1|WP_038604777.1|577926_580152_-|CRISPR-associated-helicase/endonuclease-Cas3
MIDEKQLISHLYQNRENGQWMIQTNDEHQKGVADMAASFAGQFGLPSWGRALGLLHDKGKERAAFQQYIRKMNGLPTSDKKRYDDHTHAFVGGILAKELMGKDVSHLLVNQIISHHTGLHNFGDVENILKERLLSEEINEGDISINKPLLFQEFIDSPFSKSKVEWKHFHHLSRMLFSCLVDADRLDTERFMDVESWRKRGNLATLVDLLPQLEVYMQKLQSNAADTKVNRIRRQVKEQCSRTSSSEKGFYSLTVPTGGGKTLSSLLWAMKHAVSHSMNRIIIAIPYTSIIVQTAGLLKEIFGEENVLEHHSNFDPDDIKDEENREKAKLATENWNYPIIVTTNVQLFESMFSNKTSDCRKLHNMANSILVLDEVQMLPTGFLQPIVDALKAYQEMFGISVLFTTASQPVLSGLIEGTNPKADFKGIEHIKEIIPEEFALHDQLRRVKLAIDDTGRTYDEIAAKMSEYNKVLCIVNTRKDAKELYDRLPNDGVKLHLSRMMCPAHLHETIGKIKTLLKDESLPIVRVIATQLVEAGVDIDFPVVFRQEAGLDSVLQAAGRCNREGRSAMGHTFVFSLAAEKRNPFGSMADSNNARLNLPEDSDWFAPSTMKAYFCQLYSRKQTFDEKDIKHWLYKPTELCFETASKEFRLIDDTSINVIVNWENSMELIEQLKESGCTYSLVKQLAKFTVGIRSYDFKQLKGYGLVEEILEGIYVLADRSQYNKATGLSLDNHWLEEVLMI
>NZ_LR699004.1|WP_038604780.1|580484_581849_-|histidine--tRNA-ligase
MAAKPGIPKGTRDFSPVEMAKRNYIFNTIRDVFHLFGYQQIETPSMENLSTLMGKYGDEGDKLLFKIQNSGDYFNGITDEELLSRNAVKLASKFCEKGLRYDLTVPFARYVVMHRDEISFPFKRYQIQPVWRADRPQKGRYREFYQCDADVVGSNSLLNEVELVQMIDRVFGKFGVRVSIKINNRKILTGIAEIIGEADKIVDITVAIDKLDKIGLENVNAELASKGIPQEAIDKLQPIILLSGSNEEKLETLKTVLAASETGMKGVEESEFILKTVSTLGVKSEVELDLTLARGLNYYTGAIFEVKALDVQIGSISGGGRYDNLTGVFGMDGMSGVGISFGADRIFDVLNQLDLYPKEAVNGTELLFVNFGDKEAAYCLPILAKVRETGVRAEIYPDAAKMKKQMGYANDKQIPFVAIVGENEMNEGKLTLKNMATGEQSLVTPDELLAVVKA
>NZ_LR699004.1|WP_008655266.1|582009_582858_-|substrate-binding-domain-containing-protein
MKRNYKIGLVMKSLQADFFKVMKEGAIQYAAPLPFLDLVCVGTATQTEVKEQIDLMYSLIHQQVDAIVLVPIDSKALVQPAVEAVRKGIPVINIDIQLDAQLLEQAGVEVAFVGPDNFAAAYEVGKLLGKKLRNEDKVAIIEGLAAADNARQRKRGFIKAIEEKGLRLVASEPADWETEKAAEVFQAMWMRYPDLKAVYCSNDAMALGVLQQMQEKKCYLPVVGFDNDAVMKEFLSTGKLVATADIFSSQMAVRGIEFALDVLEGRIENRGVHSTAYEIIKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NZ_LR699004_1	1.3\|571479\|35\|NZ_LR699004\|CRT	571479-571513	35	NZ_LR699004.1	2364357-2364391	1.0
NZ_LR699004_1	1.4\|571548\|32\|NZ_LR699004\|CRT	571548-571579	32	NZ_LR699004.1	5116420-5116451	1.0
NZ_LR699004_1	1.6\|571477\|36\|NZ_LR699004\|CRISPRCasFinder	571477-571512	36	NZ_LR699004.1	2364358-2364393	1.0
NZ_LR699004_1	1.7\|571546\|33\|NZ_LR699004\|CRISPRCasFinder	571546-571578	33	NZ_LR699004.1	5116418-5116450	1.0
NZ_LR699004_1	1.9\|571478\|36\|NZ_LR699004\|PILER-CR	571478-571513	36	NZ_LR699004.1	2364357-2364392	1.0
NZ_LR699004_1	1.10\|571547\|33\|NZ_LR699004\|PILER-CR	571547-571579	33	NZ_LR699004.1	5116419-5116451	1.0

1. spacer 1.3|571479|35|NZ_LR699004|CRT matches to position: 2364357-2364391, mismatch: 0, identity: 1.0

cgtattagttgacaatgtagagatggacataaata	CRISPR spacer
cgtattagttgacaatgtagagatggacataaata	Protospacer
***********************************

2. spacer 1.4|571548|32|NZ_LR699004|CRT matches to position: 5116420-5116451, mismatch: 0, identity: 1.0

aacagctatctatttaaaaaacaagtttcttg	CRISPR spacer
aacagctatctatttaaaaaacaagtttcttg	Protospacer
********************************

3. spacer 1.6|571477|36|NZ_LR699004|CRISPRCasFinder matches to position: 2364358-2364393, mismatch: 0, identity: 1.0

ctcgtattagttgacaatgtagagatggacataaat	CRISPR spacer
ctcgtattagttgacaatgtagagatggacataaat	Protospacer
************************************

4. spacer 1.7|571546|33|NZ_LR699004|CRISPRCasFinder matches to position: 5116418-5116450, mismatch: 0, identity: 1.0

ttaacagctatctatttaaaaaacaagtttctt	CRISPR spacer
ttaacagctatctatttaaaaaacaagtttctt	Protospacer
*********************************

5. spacer 1.9|571478|36|NZ_LR699004|PILER-CR matches to position: 2364357-2364392, mismatch: 0, identity: 1.0

tcgtattagttgacaatgtagagatggacataaata	CRISPR spacer
tcgtattagttgacaatgtagagatggacataaata	Protospacer
************************************

6. spacer 1.10|571547|33|NZ_LR699004|PILER-CR matches to position: 5116419-5116451, mismatch: 0, identity: 1.0

taacagctatctatttaaaaaacaagtttcttg	CRISPR spacer
taacagctatctatttaaaaaacaagtttcttg	Protospacer
*********************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LR699004_1	1.1\|571347\|31\|NZ_LR699004\|CRT	571347-571377	31	MN694639	Marine virus AFVG_250M766, complete genome	16844-16874	6	0.806
NZ_LR699004_1	1.1\|571347\|31\|NZ_LR699004\|CRT	571347-571377	31	AP013378	Uncultured Mediterranean phage uvMED DNA, complete genome, group G14, isolate: uvMED-CGR-U-MedDCM-OCT-S23-C32	25103-25133	6	0.806
NZ_LR699004_1	1.1\|571347\|31\|NZ_LR699004\|CRT	571347-571377	31	NZ_AP017563	Pseudanabaena sp. ABRG5-3 plasmid ABRG53c, complete sequence	42293-42323	8	0.742
NZ_LR699004_1	1.1\|571347\|31\|NZ_LR699004\|CRT	571347-571377	31	NC_041966	Acinetobacter phage WCHABP1, complete genome	34348-34378	8	0.742
NZ_LR699004_1	1.1\|571347\|31\|NZ_LR699004\|CRT	571347-571377	31	MH853788	Acinetobacter phage vB_KpnM_IME512, complete genome	14966-14996	8	0.742
NZ_LR699004_1	1.1\|571347\|31\|NZ_LR699004\|CRT	571347-571377	31	KY670595	Acinetobacter phage WCHABP12, complete genome	26517-26547	8	0.742
NZ_LR699004_1	1.1\|571347\|31\|NZ_LR699004\|CRT	571347-571377	31	MN166083	Acinetobacter phage Abp9, complete genome	333-363	8	0.742
NZ_LR699004_1	1.4\|571548\|32\|NZ_LR699004\|CRT	571548-571579	32	MN856079	Bacteriophage sp. isolate 128, complete genome	11703-11734	8	0.75
NZ_LR699004_1	1.4\|571548\|32\|NZ_LR699004\|CRT	571548-571579	32	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	235309-235340	10	0.688
NZ_LR699004_1	1.7\|571546\|33\|NZ_LR699004\|CRISPRCasFinder	571546-571578	33	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	235307-235339	10	0.697
NZ_LR699004_1	1.4\|571548\|32\|NZ_LR699004\|CRT	571548-571579	32	MG945860	UNVERIFIED: Microviridae sp. isolate 17756-1502, complete genome	922-953	11	0.656
NZ_LR699004_1	1.4\|571548\|32\|NZ_LR699004\|CRT	571548-571579	32	AP013716	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C22-MedDCM-OCT-S38-C22, * SEQUENCING IN PROGRESS *	16405-16436	11	0.656
NZ_LR699004_1	1.10\|571547\|33\|NZ_LR699004\|PILER-CR	571547-571579	33	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	235308-235340	11	0.667

1. spacer 1.1|571347|31|NZ_LR699004|CRT matches to MN694639 (Marine virus AFVG_250M766, complete genome) position: , mismatch: 6, identity: 0.806

tatggaagcagaagtaaaacaagtaatcaaa	CRISPR spacer
tatggaagcagaaataaaaaaagtaaaagat	Protospacer
*************.***** ******  .*

2. spacer 1.1|571347|31|NZ_LR699004|CRT matches to AP013378 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G14, isolate: uvMED-CGR-U-MedDCM-OCT-S23-C32) position: , mismatch: 6, identity: 0.806

tatggaagcagaagtaaaacaagtaatcaaa	CRISPR spacer
aatggaagcagaagtaaaaaaattaaaaaca	Protospacer
 ****************** ** ***  * *

3. spacer 1.1|571347|31|NZ_LR699004|CRT matches to NZ_AP017563 (Pseudanabaena sp. ABRG5-3 plasmid ABRG53c, complete sequence) position: , mismatch: 8, identity: 0.742

tatggaagcagaagtaaaacaagtaatcaaa	CRISPR spacer
aatggaagcagaaataagacaagttcctgaa	Protospacer
 ************.***.******  ...**

4. spacer 1.1|571347|31|NZ_LR699004|CRT matches to NC_041966 (Acinetobacter phage WCHABP1, complete genome) position: , mismatch: 8, identity: 0.742

tatggaagcagaagtaaaacaagtaatcaaa	CRISPR spacer
cactgaagcagaagtaaagcaagtcatagag	Protospacer
.*. **************.***** ** .*.

5. spacer 1.1|571347|31|NZ_LR699004|CRT matches to MH853788 (Acinetobacter phage vB_KpnM_IME512, complete genome) position: , mismatch: 8, identity: 0.742

tatggaagcagaagtaaaacaagtaatcaaa	CRISPR spacer
cactgaagcagaagtaaagcaagtcatagag	Protospacer
.*. **************.***** ** .*.

6. spacer 1.1|571347|31|NZ_LR699004|CRT matches to KY670595 (Acinetobacter phage WCHABP12, complete genome) position: , mismatch: 8, identity: 0.742

tatggaagcagaagtaaaacaagtaatcaaa	CRISPR spacer
cactgaagcagaagtaaagcaagtcatagag	Protospacer
.*. **************.***** ** .*.

7. spacer 1.1|571347|31|NZ_LR699004|CRT matches to MN166083 (Acinetobacter phage Abp9, complete genome) position: , mismatch: 8, identity: 0.742

tatggaagcagaagtaaaacaagtaatcaaa	CRISPR spacer
cactgaagcagaagtaaagcaagtcatagag	Protospacer
.*. **************.***** ** .*.

8. spacer 1.4|571548|32|NZ_LR699004|CRT matches to MN856079 (Bacteriophage sp. isolate 128, complete genome) position: , mismatch: 8, identity: 0.75

aacagctatctatttaaaaaacaagtttcttg	CRISPR spacer
agaatctacctatttaaaatacaagttttata	Protospacer
*. * ***.********** ********. *.

9. spacer 1.4|571548|32|NZ_LR699004|CRT matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 10, identity: 0.688

aacagctatctatttaaaaaacaagtttcttg	CRISPR spacer
ggtttgtatctttttaaaaaaccagtttctaa	Protospacer
...   ***** ********** ******* .

10. spacer 1.7|571546|33|NZ_LR699004|CRISPRCasFinder matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 10, identity: 0.697

ttaacagctatctatttaaaaaacaagtttctt	CRISPR spacer
taggtttgtatctttttaaaaaaccagtttcta	Protospacer
* ...   ***** ********** *******

11. spacer 1.4|571548|32|NZ_LR699004|CRT matches to MG945860 (UNVERIFIED: Microviridae sp. isolate 17756-1502, complete genome) position: , mismatch: 11, identity: 0.656

aacagctatctatttaaaaaacaagtttcttg	CRISPR spacer
tttcgctatctatttaagaaagaagttgaaga	Protospacer
  . *************.*** *****    .

12. spacer 1.4|571548|32|NZ_LR699004|CRT matches to AP013716 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C22-MedDCM-OCT-S38-C22, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 11, identity: 0.656

aacagctatctatttaaaaaacaagtttcttg	CRISPR spacer
ggtttatatctatttaaaacaaaagtttcaca	Protospacer
...   ************* * ******* ..

13. spacer 1.10|571547|33|NZ_LR699004|PILER-CR matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 11, identity: 0.667

taacagctatctatttaaaaaacaagtttcttg	CRISPR spacer
aggtttgtatctttttaaaaaaccagtttctaa	Protospacer
 ...   ***** ********** ******* .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2167466 : 2199564

uncultured_virus(50.0%)

transposase,integrase

attL 2191606:2191620|attR 2207914:2207928

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005636919.1\|2167466_2168630_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_005636924.1\|2168869_2170009_-	hypothetical protein	NA	NA	NA	NA
WP_005636926.1\|2170041_2171052_-	hypothetical protein	NA	NA	NA	NA
WP_080707039.1\|2171608_2171995_+	DUF4134 domain-containing protein	NA	NA	NA	NA
WP_005636934.1\|2172000_2172327_+	DUF4133 domain-containing protein	NA	NA	NA	NA
WP_005636936.1\|2172323_2174858_+	TraG family conjugative transposon ATPase	NA	NA	NA	NA
WP_005636939.1\|2174854_2175211_+	DUF3876 domain-containing protein	NA	NA	NA	NA
WP_005636941.1\|2175207_2175837_+	DUF4141 domain-containing protein	NA	NA	NA	NA
WP_005636943.1\|2175839_2176853_+	conjugative transposon protein TraJ	NA	NA	NA	NA
WP_005636947.1\|2176976_2177600_+	conjugative transposon protein TraK	NA	NA	NA	NA
WP_005656892.1\|2177596_2177896_+	DUF3989 domain-containing protein	NA	NA	NA	NA
WP_005636954.1\|2177846_2179154_+	conjugative transposon protein TraM	NA	NA	NA	NA
WP_005636955.1\|2179203_2180118_+	conjugative transposon protein TraN	NA	NA	NA	NA
WP_005636956.1\|2180114_2180702_+	conjugal transfer protein TraO	NA	NA	NA	NA
WP_005636957.1\|2180723_2181185_+	DUF3872 domain-containing protein	NA	NA	NA	NA
WP_005636958.1\|2181181_2181661_+	hypothetical protein	NA	NA	NA	NA
WP_004312011.1\|2182119_2183793_-\|transposase	IS66-like element ISBf10 family transposase	A0A218MNE7	uncultured_virus	2.1e-37	28.9
WP_004312010.1\|2183868_2184234_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_004319780.1\|2184237_2184594_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_147542107.1\|2184618_2185302_-	hypothetical protein	NA	NA	NA	NA
WP_007851220.1\|2185312_2186332_-	molecular chaperone DnaJ	NA	NA	NA	NA
WP_005802673.1\|2186345_2186555_-	hypothetical protein	NA	NA	NA	NA
WP_005637786.1\|2186530_2186830_-	hypothetical protein	NA	NA	NA	NA
WP_038607716.1\|2186826_2187426_-	hypothetical protein	NA	NA	NA	NA
WP_007219084.1\|2187473_2187971_-	DUF4313 domain-containing protein	NA	NA	NA	NA
WP_005637783.1\|2188021_2188273_-	hypothetical protein	NA	NA	NA	NA
WP_007851207.1\|2188342_2189230_-	hypothetical protein	NA	NA	NA	NA
WP_007851204.1\|2189233_2190376_-	hypothetical protein	NA	NA	NA	NA
WP_005634950.1\|2190360_2190657_-	hypothetical protein	NA	NA	NA	NA
WP_005640474.1\|2191069_2191477_+	hypothetical protein	NA	NA	NA	NA
2191606:2191620	attL	NA	NA	NA	NA
WP_005640472.1\|2191989_2193225_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_005640470.1\|2193298_2194504_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_005640468.1\|2194771_2196139_+	hypothetical protein	NA	NA	NA	NA
WP_005640453.1\|2196860_2198150_+\|transposase	IS1380-like element ISBvu1 family transposase	NA	NA	NA	NA
WP_005864602.1\|2198328_2199564_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	1.4e-33	36.3
2207914:2207928	attR	NA	NA	NA	NA

DBSCAN-SWA_2

4151235 : 4179239

Bacteroides_phage(23.53%)

capsid,integrase,protease,head,terminase,portal

attL 4157138:4157152|attR 4169647:4169661

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007850020.1\|4151235_4152501_-\|integrase	site-specific integrase	S0A3I4	Cellulophaga_phage	1.5e-11	23.9
WP_147542237.1\|4152738_4153206_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_038606508.1\|4153359_4153569_+	hypothetical protein	NA	NA	NA	NA
WP_007850012.1\|4153588_4153885_+	DUF3853 family protein	NA	NA	NA	NA
WP_007850010.1\|4153889_4154174_+	hypothetical protein	NA	NA	NA	NA
WP_147542516.1\|4154577_4154856_+	hypothetical protein	NA	NA	NA	NA
WP_147542239.1\|4154876_4155056_+	hypothetical protein	NA	NA	NA	NA
WP_007850001.1\|4155238_4155382_+	hypothetical protein	NA	NA	NA	NA
WP_147542241.1\|4155378_4155621_+	hypothetical protein	NA	NA	NA	NA
WP_147542243.1\|4155636_4156209_+	ERF family protein	NA	NA	NA	NA
WP_147542245.1\|4156205_4157102_+	hypothetical protein	H2A0A8	Bacteroides_phage	4.2e-48	37.3
WP_147542247.1\|4157104_4157674_+	HNH endonuclease	A0A249XVQ5	Enterococcus_phage	2.8e-29	42.9
4157138:4157152	attL	NA	NA	NA	NA
WP_147542249.1\|4157670_4157988_+	hypothetical protein	NA	NA	NA	NA
WP_147542251.1\|4157987_4158425_+	hypothetical protein	NA	NA	NA	NA
WP_038606522.1\|4158591_4158813_+	hypothetical protein	NA	NA	NA	NA
WP_147542253.1\|4158814_4159222_+	DUF4494 family protein	NA	NA	NA	NA
WP_130054178.1\|4159578_4159779_+	hypothetical protein	NA	NA	NA	NA
WP_147542255.1\|4159775_4160099_-	hypothetical protein	NA	NA	NA	NA
WP_147542257.1\|4160229_4160709_+	recombination protein NinG	NA	NA	NA	NA
WP_147542259.1\|4160758_4161619_+	hypothetical protein	A0A193GZ86	Enterobacter_phage	2.7e-12	39.8
WP_147542261.1\|4161539_4162079_+	hypothetical protein	NA	NA	NA	NA
WP_172624277.1\|4162114_4163008_+	hypothetical protein	A0A1B0VG30	Salmonella_phage	1.1e-43	37.0
WP_118439961.1\|4163295_4163478_+	hypothetical protein	NA	NA	NA	NA
WP_134770219.1\|4163558_4163945_+	hypothetical protein	NA	NA	NA	NA
WP_147542265.1\|4164163_4165291_+	hypothetical protein	A0A2I7RHT9	Vibrio_phage	1.4e-24	45.0
WP_147542267.1\|4165378_4165660_+	hypothetical protein	NA	NA	NA	NA
WP_038606532.1\|4165678_4166074_+	hypothetical protein	H2A0H1	Bacteroides_phage	8.3e-17	41.9
WP_147542269.1\|4166066_4167173_+\|integrase	tyrosine-type recombinase/integrase	A0A0H4TI16	Erysipelothrix_phage	4.9e-14	27.2
WP_147542271.1\|4167129_4168122_+	SAM-dependent DNA methyltransferase	A0A2I7RNS1	Vibrio_phage	1.1e-17	37.6
WP_147542273.1\|4168149_4168437_+	hypothetical protein	A0A076G7F3	Bacillus_phage	1.4e-18	54.1
WP_147542274.1\|4168663_4168885_+	hypothetical protein	NA	NA	NA	NA
WP_147542276.1\|4168881_4169184_+	hypothetical protein	NA	NA	NA	NA
WP_147542278.1\|4169186_4169651_+	DUF551 domain-containing protein	NA	NA	NA	NA
WP_134771306.1\|4169654_4169870_+	hypothetical protein	NA	NA	NA	NA
4169647:4169661	attR	NA	NA	NA	NA
WP_147542280.1\|4169875_4170100_+	hypothetical protein	NA	NA	NA	NA
WP_147542282.1\|4170096_4170498_+	hypothetical protein	NA	NA	NA	NA
WP_147542284.1\|4170494_4170734_+	hypothetical protein	NA	NA	NA	NA
WP_172624278.1\|4170739_4170910_+	hypothetical protein	NA	NA	NA	NA
WP_147542286.1\|4170919_4171402_+	adenine methyltransferase	B5TR99	Bacteroides_phage	5.9e-65	69.8
WP_147542518.1\|4171778_4171964_+	hypothetical protein	NA	NA	NA	NA
WP_147542288.1\|4171960_4172530_+	hypothetical protein	H2A0F1	Bacteroides_phage	1.1e-14	33.5
WP_147542290.1\|4172532_4172805_+	hypothetical protein	NA	NA	NA	NA
WP_038606558.1\|4173078_4173573_+\|terminase	terminase small subunit	M5A984	Nitratiruptor_phage	2.7e-09	41.4
WP_147542292.1\|4173572_4175582_+\|terminase	PBSX family phage terminase large subunit	A0A0S2SXL6	Bacillus_phage	3.6e-23	31.9
WP_007849900.1\|4175927_4177241_+\|portal	phage portal protein	A0A0F7L7L5	uncultured_marine_virus	2.4e-12	24.0
WP_007849899.1\|4177194_4177929_+\|head,protease	HK97 family phage prohead protease	I6S2W2	Marinomonas_phage	1.7e-23	38.6
WP_134771317.1\|4177925_4179239_+\|capsid	phage major capsid protein	R9ZZJ5	Cellulophaga_phage	6.4e-29	26.7

DBSCAN-SWA_3

4330659 : 4341303

Vibrio_phage(25.0%)

integrase

attL 4335779:4335791|attR 4340373:4340385

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147542259.1\|4330659_4331520_+	hypothetical protein	A0A193GZ86	Enterobacter_phage	2.7e-12	39.8
WP_147542261.1\|4331440_4331980_+	hypothetical protein	NA	NA	NA	NA
WP_172624277.1\|4332015_4332909_+	hypothetical protein	A0A1B0VG30	Salmonella_phage	1.1e-43	37.0
WP_118439961.1\|4333196_4333379_+	hypothetical protein	NA	NA	NA	NA
WP_134770219.1\|4333459_4333846_+	hypothetical protein	NA	NA	NA	NA
WP_147542265.1\|4334064_4335192_+	hypothetical protein	A0A2I7RHT9	Vibrio_phage	1.4e-24	45.0
WP_147542267.1\|4335279_4335561_+	hypothetical protein	NA	NA	NA	NA
WP_038606532.1\|4335579_4335975_+	hypothetical protein	H2A0H1	Bacteroides_phage	8.3e-17	41.9
4335779:4335791	attL	NA	NA	NA	NA
WP_147542269.1\|4335967_4337074_+\|integrase	tyrosine-type recombinase/integrase	A0A0H4TI16	Erysipelothrix_phage	4.9e-14	27.2
WP_147542271.1\|4337030_4338023_+	SAM-dependent DNA methyltransferase	A0A2I7RNS1	Vibrio_phage	1.1e-17	37.6
WP_147542273.1\|4338050_4338338_+	hypothetical protein	A0A076G7F3	Bacillus_phage	1.4e-18	54.1
WP_147542274.1\|4338564_4338786_+	hypothetical protein	NA	NA	NA	NA
WP_147542276.1\|4338782_4339085_+	hypothetical protein	NA	NA	NA	NA
WP_147542278.1\|4339087_4339552_+	DUF551 domain-containing protein	NA	NA	NA	NA
WP_134771306.1\|4339555_4339771_+	hypothetical protein	NA	NA	NA	NA
WP_147542280.1\|4339776_4340001_+	hypothetical protein	NA	NA	NA	NA
WP_147542282.1\|4339997_4340399_+	hypothetical protein	NA	NA	NA	NA
4340373:4340385	attR	NA	NA	NA	NA
WP_147542284.1\|4340395_4340635_+	hypothetical protein	NA	NA	NA	NA
WP_172624278.1\|4340640_4340811_+	hypothetical protein	NA	NA	NA	NA
WP_147542335.1\|4340820_4341303_+	adenine methyltransferase	B5TR99	Bacteroides_phage	7.7e-65	68.6

DBSCAN-SWA_4

5018508 : 5052355

unidentified_phage(40.0%)

integrase,holin

attL 5014287:5014301|attR 5052971:5052985

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5014287:5014301	attL	NA	NA	NA	NA
WP_147542421.1\|5018508_5018982_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_147542423.1\|5018989_5019550_-	hypothetical protein	NA	NA	NA	NA
WP_147542425.1\|5019546_5020524_-	hypothetical protein	NA	NA	NA	NA
WP_147542426.1\|5020520_5021372_-	hypothetical protein	NA	NA	NA	NA
WP_147542428.1\|5021368_5022859_-	hypothetical protein	NA	NA	NA	NA
WP_147542522.1\|5022855_5023158_-	hypothetical protein	NA	NA	NA	NA
WP_147542430.1\|5023443_5025210_-	hypothetical protein	NA	NA	NA	NA
WP_147542432.1\|5025212_5025851_-	hypothetical protein	NA	NA	NA	NA
WP_147542434.1\|5025847_5026177_-	hypothetical protein	NA	NA	NA	NA
WP_147542436.1\|5026252_5026630_-	hypothetical protein	NA	NA	NA	NA
WP_147542438.1\|5026743_5027133_-	hypothetical protein	NA	NA	NA	NA
WP_147542440.1\|5027210_5028164_-	hypothetical protein	NA	NA	NA	NA
WP_147542442.1\|5028244_5030254_-	hypothetical protein	H7BUS6	unidentified_phage	1.8e-35	26.2
WP_172624281.1\|5030265_5031228_-	S49 family peptidase	NA	NA	NA	NA
WP_147542446.1\|5031279_5031636_-	hypothetical protein	NA	NA	NA	NA
WP_147542448.1\|5031752_5032241_-	hypothetical protein	NA	NA	NA	NA
WP_147542450.1\|5032812_5033109_-	hypothetical protein	NA	NA	NA	NA
WP_147542524.1\|5033105_5033363_-	hypothetical protein	NA	NA	NA	NA
WP_147542452.1\|5033688_5034099_-	hypothetical protein	NA	NA	NA	NA
WP_147542454.1\|5034079_5034607_-	SocA family protein	NA	NA	NA	NA
WP_147542456.1\|5034806_5035340_-	chromosome partitioning protein ParA	I6S627	Salmonella_phage	1.9e-16	37.4
WP_147542458.1\|5035361_5039375_-	DNA primase	C7F4F5	Cyanophage	1.1e-36	30.8
WP_147542460.1\|5039352_5039769_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_172624282.1\|5039719_5040064_-	hypothetical protein	NA	NA	NA	NA
WP_147542462.1\|5040082_5040292_-	hypothetical protein	NA	NA	NA	NA
WP_147542464.1\|5040282_5040582_-	hypothetical protein	NA	NA	NA	NA
WP_147542466.1\|5040587_5041151_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_147542468.1\|5041316_5041619_-	hypothetical protein	NA	NA	NA	NA
WP_147542470.1\|5041615_5041837_-	hypothetical protein	NA	NA	NA	NA
WP_147542472.1\|5042378_5043371_-	SAM-dependent DNA methyltransferase	A0A2I7RNS1	Vibrio_phage	8.5e-18	34.8
WP_147542474.1\|5043327_5044434_-\|integrase	tyrosine-type recombinase/integrase	A0A0H4TI16	Erysipelothrix_phage	8.3e-14	27.2
WP_038606532.1\|5044426_5044822_-	hypothetical protein	H2A0H1	Bacteroides_phage	8.3e-17	41.9
WP_147542476.1\|5044840_5045122_-	hypothetical protein	NA	NA	NA	NA
WP_147542476.1\|5045140_5045422_-	hypothetical protein	NA	NA	NA	NA
WP_172624283.1\|5045595_5046513_-\|integrase	site-specific integrase	R9ZYY8	Cellulophaga_phage	1.9e-16	27.5
WP_147542479.1\|5046592_5046811_-	hypothetical protein	NA	NA	NA	NA
WP_147542481.1\|5046935_5047289_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_051924169.1\|5047568_5048813_+\|integrase	site-specific integrase	H7BUI8	unidentified_phage	3.1e-33	32.7
WP_038608085.1\|5048897_5049188_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_038607248.1\|5049307_5050483_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	8.8e-14	34.6
WP_038607251.1\|5050743_5051022_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_038607254.1\|5051119_5052355_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	9.0e-25	31.8
5052971:5052985	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_LR699004.1|WP_004291533.1|1638655_1639072_+|PcfK-like-family-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_LR699004.1|WP_008654998.1|3404930_3405356_+|PcfK-like-family-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_LR699004.1|WP_004291533.1|1638655_1639072_+|PcfK-like-family-protein

1638655_1639072_+

138 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|40	0.5571428571428572	0.9855072463768116	0.9929078014184397

NZ_LR699004.1|WP_008654998.1|3404930_3405356_+|PcfK-like-family-protein

3404930_3405356_+

141 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|40	0.9361702127659575	1	1.0

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LR699004

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information